SMED30004194

Overview
NameSMED30004194
Smed IDSMED30004194
Length (bp)2311
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30004194 (SMED30004194) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30004194 (SMED30004194) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30004194 (SMED30004194) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30004194 (SMED30004194) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004194

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30004194SMESG000009646.1 SmedASXL_013937SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30004194SMESG000009646.1 dd_Smed_v4_12139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30004194SMESG000009646.1 dd_Smed_v4_23871_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30004194SMESG000009646.1 dd_Smed_v6_12139_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30004194SMESG000009646.1 dd_Smed_v6_23871_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30004194 vs. Ensembl Zebrafish
Match: csmd3a (CUB and Sushi multiple domains 3a [Source:ZFIN;Acc:ZDB-GENE-050419-118])

HSP 1 Score: 60.4622 bits (145), Expect = 8.794e-9
Identity = 116/504 (23.02%), Postives = 198/504 (39.29%), Query Frame = 2
Query:  227 KYNNSEKIIYLCQNGYFLQNSKYNQNAIYFNNTCLNGSWKFKTEFIPFCKSSCLRWDMRLQQWKTIMLNATEQIFGFVLSPEYPSNIDNVGENCSYIIEATAGF-IKLKSLELNLEKY--YLEIKS---ENSVIYWPNNGSMNGSYVFYGHKSITIHLKENLHHHNSIGKKENFKLIYRKIG-TNCKSYSYDNNLIVNKRELNNHNLLETYSCKYPHKLIGPSQRTCIHEI---WTSLVIPKCKLLCGPPIRISTDGNLELKTDLQEISNCKLQIFSLR---GTGILHIHIKRLSNVINKNCIYMTIGDTRRICIINRSENFYFTSSTIL-SVVKDSNYIPEIVEFLIQSKPS------------RNCSHPPAIRKGALVF--NTTSLFSVAGVSCNDGHILIGSPKLQCQLHYSGVAYWKGLKRPECVKLCNSQWKNIEIAEGPYAISSPPFLNLNFSENQYCKWKIKSKNAFPIIYISSIYNI-KDYVIMSLTNDDNTLENQ 1651
            +Y   + +++ C+ GY LQ + +         TC+ G  +     +P C + C                A  ++ G +LSP +P N  + G +C++ I    GF I ++ L  + E    YLEI+S   E   +    +G      +F      T H      H +    K  F + Y+     +C       N IV   + +   +  ++ C   + LIG +  TC+H I   W +  IP+C+ LCG  I  S +G +       E  N +  ++S+R   G GI +I+   LS     + I +  G  +    I +     F+ +T L SV   SN I  +++F      S            R C  P  +    ++   N   +  +    C+ G  L+GS  L C+L   G         P C   C +     + +     I SP + + ++   Q C W I  +  + I      +   K+Y I+ +  D  T+ +Q
Sbjct: 1793 RYMVGDVVMFQCEQGYSLQGNAHI--------TCMPGPVRRWNYPVPLCLAQCG--------------GAMTEVSGVILSPGFPGNYPS-GLDCTWTITLPIGFGIHVQFLNFSTEAIHDYLEIRSGPSETGTVIDRFSGPQVPESLFS-----TTHETSFFFHSDYSQNKPGFHITYQAYQLQSCPDPRPFRNGIVIGSDFS-VGMTVSFECLPGYSLIGETSLTCLHGISRNWNN-PIPRCEALCGGNI-TSMNGTIFSPGHPAEYPNFQDCVWSVRVPPGNGI-YINFTVLSTEPIYDYITVWDGPDQSSPQIGQ-----FSGNTALESVYSTSNQI--LIKFHSDFSGSGFFVLSYHAYQLRVCQPPLEVANADILMEDNELEIGDIIRYRCHPGFTLVGSEILTCRL---GERLQMDGHPPSCQVQCPAHDVRFDSSG---VILSPGYPD-SYPNLQMCSWSINVEKGYNITLFFEFFQTEKEYDILEVF-DGPTIHSQ 2249          

HSP 2 Score: 50.8322 bits (120), Expect = 8.111e-6
Identity = 61/252 (24.21%), Postives = 97/252 (38.49%), Query Frame = 2
Query:  953 ISTDGNLELKTDLQEISNCKLQIFSLRGTGILHIHIK-----RLSNVINKNCIYMTIGDTRRICIINRSENFYFTSSTILSVVKDSNYIPEIVEFLIQSKPSRNCSHPPAIRKGALVFNTTSLFSVAGVSCNDGHILIGSPKLQCQLHYSGVAYWKGLKRPEC-VKLCNSQWKNIEIAEGPYAISSPPFLNLNFSENQYCKWKIKSKNAFPIIYISSIYNIKDYVIMSLTNDDNTLENQNYLQDNSNKISII 1690
            I TD   E K D  E+   +     L G  +    +      RL  V + N  Y       ++    RS +F      +     +SN    + E  I+ + S +C  P     G  + N  S+ + A  +C++ H+L GS  + CQ      A W    RP C VK C S        +GP    S P   + +  N  C W I + N   +I I    N +D+  + L  D  T+ +   + D    + ++
Sbjct:  112 IFTDFQTEEKYDYLEVEGSEPPTIWLSGMNVPSPIVSNKNWLRLHFVTDSNHRYKGFSAHYQV---KRSVDFKSRGVKLFPGKDNSNKFSILNEGGIK-QASNSCPDPGEPENGKRIGNDFSIGATAEFTCDEDHVLQGSKSITCQRVAEVFAAWTD-HRPVCRVKTCGSN------LQGPSGTFSSPNFPIQYESNSQCVWIITASNLNKVIQI----NFEDF-DLELGYDTLTIGDGGEVGDPKTILQVL 347          
BLAST of SMED30004194 vs. TrEMBL
Match: A0A556U762 (CUB and sushi domain-containing protein 1 OS=Bagarius yarrelli OX=175774 GN=Baya_9016 PE=4 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.572e-8
Identity = 101/469 (21.54%), Postives = 176/469 (37.53%), Query Frame = 2
Query:  224 LKYNNSEKIIYLCQNGYFLQNSKYNQNAIYFNNTCLNGSWKFKTEFIPFCKSSCLRWDMRLQQWKTIMLNATEQIFGFVLSPEYPSNIDNVGENCSYIIEATAG-FIKLKSLELNL-EKYYLEIKSENSVIYWPNNGSMNGSYVFYGHKSITIHLKEN----LHHHNSIGKKENFKLIYRKIG-TNCKSYSYDNNLIVNKRELNNHNLLETYSCKYPHKLIGPSQRTCI---HEIWTSLVIPKCKLLCGPPIRISTDGNLELKTDLQEISN---CKLQIFSLRGTGILHIHIKRLSNVINKNCIYMTIGDTRRICIINRSENFYFTSST-----ILSVVKDSNYIPEIVEFLIQ--SKPSRNCSHPPAIRKGALVFNTTSLFSVAGVSCNDGHILIGSPKLQCQLHYSGVAYWKGLKRPECVKLCNSQWKNIEIAEGPYAISSPPFLNLNFSENQYCKWKIKSKNAFPI 1570
             ++   + +++ C +GY L+     +N I    TCL G  +  +  +P C + C                +TE I G +LSP YP+N DN  E C Y ++   G  I+L S +  L +  +L+I          ++  + G++      +I I+   N      + N  G  + FKLIY       C+     N     + + +  N    YSC   + L G S  TC+     +W    +P C   CG  I  +T G +          N   C   I +  G  I  +H       ++ + + +  G      ++           T     IL++  DS+Y      F IQ  +  +  C+ P   + G+   ++          C+ G+ + G  ++ C +  +   +W+    P C+  C           GP  +   P     +   + C W+IK    F I
Sbjct:  641 FQFGVGDSLVFTCFSGYRLEG----ENKI----TCLGGGRRVWSAALPRCVAECGA--------------STEGIEGVLLSPNYPANYDNNHE-CIYRVQTDNGKGIQLLSSDFQLHDGDFLQIYDGQD-----SSSRLLGNFTRSEMSNIIINSTSNHLWVEFNSNGTGTSKGFKLIYTSFDLVKCEEPGTPNYGYKMQDDGHFANTFVLYSCNPGYTLHGSSTLTCLSGDRRVWDK-PLPSCVAECGGHISGATSGRILSPGYPAPYDNNLHCTWSIEADAGKTI-SLHFIVFDTEVDHDILKVWDGPAENGILLKEWSGSLLPEDTHSTFNILTLQFDSDYFISKSGFSIQFSTATASTCNDPGIPQNGSRYGDSREPGDTITFQCDPGYQVQGVSEITC-VQRNNRFFWQ-PDPPTCIATCGGN------VTGPAGVILSPNYPQPYPPGKECDWRIKVNPDFVI 1071          
BLAST of SMED30004194 vs. TrEMBL
Match: W5K8T4 (CUB and Sushi multiple domains 1 OS=Astyanax mexicanus OX=7994 GN=CSMD1 PE=4 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 1.851e-7
Identity = 110/530 (20.75%), Postives = 197/530 (37.17%), Query Frame = 2
Query:  110 IPSSIFPKASSKLPKISSSCMIMESL---LSLHNLQV-----IPS-----KLKYNNSEKIIYLCQNGYFLQNSKYNQNAIYFNNTCLNGSWKFKTEFIPFCKSSCLRWDMRLQQWKTIMLNATEQIFGFVLSPEYPSNIDNVGENCSYIIEATAGFIKLKSLELNLEKYYLEIKSENSVIYWPNNGS--MNGSYVFYGHKSITIHLKEN----LHHHNSIGKKENFKLIYRKIG-TNCKSYSYDNNLIVNKRELNNHNLLETYSCKYPHKLIGPSQRTCI---HEIWTSLVIPKCKLLCGPPIRISTDGNLELKTDLQEISN---CKLQIFSLRGTGILHIHIKRLSNVINKNCIYMTIGDTRRICIINRSENFYFTSST-----ILSVVKDSNYIPEIVEFLIQ--SKPSRNCSHPPAIRKGALVFNTTSLFSVAGVSCNDGHILIGSPKLQCQLHYSGVAYWKGLKRPECVKLCNSQWKNIEIAEGPYAISSPPFLNLNFSENQYCKWKIKSKNAFPIIYISSIYNIK 1600
            I + +F   S++L  IS   M  E      S +NL+      +P+       ++   + +++ C +GY L+             TCL G  +  +  +P C + C                ++  I G +LSP YPSN DN  E C Y +    G    K ++L+   + L    +  ++Y   + S  + G++      ++ I+   N      + N  G  + FKLI+       C+     N     + + +  N    YSC   + L G S  TC+     +W    +P C   CG  I  +T G +          N   C   I +  G  I  +H       ++ + + +  G T    ++           T     IL++  DS+Y      F IQ  +  +  C+ P   + G+   ++          C+ G+ + G  ++ C +  +   +W+    P C+  C           GP  +   P     +   + C W+IK    F I  I   +N++
Sbjct: 1028 IKAGLFGNFSAQLRFISDFSMSYEGFNITFSEYNLEPCEDPGVPAYSRRVGFQFGVGDSLMFTCFSGYRLEGES--------KITCLGGGRRVWSAVLPRCVAECGA--------------SSTGIEGVLLSPNYPSNYDNNHE-CIYRVRTDNG----KGIQLSASTFQLR-DGDFLLVYDGQDSSSRLLGNFTKNEMSNVIINSTSNHLWIEFNSNGTGTSKGFKLIHTSFDLVKCEEPGTPNYGYKIQDDGHFANTYVLYSCNPGYTLHGSSTLTCLSGDRRVWDK-SLPSCVAECGGHISGATSGRILSPGYPAPYDNNLHCTWSIEADTGKTI-SLHFIVFDTEVDHDILKVWDGPTESGILLKEWSGSLLPEDTHSTFNILTLQFDSDYFISKSGFSIQFSTTTASTCNDPGTPQNGSRYGDSREPGDTISFQCDPGYQVQGVSEITC-VQLNNRFFWQ-PDPPTCMATCGGN------VTGPAGVILSPNYPQPYPAGKECDWRIKVNPDFVIALIFKSFNME 1519          
BLAST of SMED30004194 vs. TrEMBL
Match: A0A4W5PKS8 (Si:ch211-236p22.1 OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 5.581e-7
Identity = 115/504 (22.82%), Postives = 198/504 (39.29%), Query Frame = 2
Query:  227 KYNNSEKIIYLCQNGYFLQNSKYNQNAIYFNNTCLNGSWKFKTEFIPFCKSSCLRWDMRLQQWKTIMLNATEQIFGFVLSPEYPSNIDNVGENCSYIIEATAGF-IKLKSLELNLEKY--YLEIKS---ENSVIYWPNNGSMNGSYVFYGHKSITIHLKENLHHHNSIGKKENFKLIYRKIG-TNCKSYSYDNNLIVNKRELNNHNLLETYSCKYPHKLIGPSQRTCIHEI---WTSLVIPKCKLLCGPPIRISTDGNLELKTDLQEISNCKLQIFSLR---GTGILHIHIKRLSNVINKNCIYMTIGDTRRICIINRSENFYFTSSTIL-SVVKDSNYIPEIVEFLIQSKPS------------RNCSHPPAIRKGALVFNTTSL--FSVAGVSCNDGHILIGSPKLQCQLHYSGVAYWKGLKRPECVKLCNSQWKNIEIAEGPYAISSPPFLNLNFSENQYCKWKIKSKNAFPI-IYISSIYNIKDYVIMSLTNDDNTLENQ 1651
            +Y   + +++ C+ GY LQ + +         TC+ G  +     +P C + C                +   + G +LSP +P N  + G +C++ ++   GF I L+ L  + E    YLEI+S   E   +    +G      +F      T H      H +    K  F++ Y+     +C       N IV   + +   L  ++ C   + LIG +  TC+H I   W   V P+C+ LCG  I  S +G +      +E  N +  ++S+R   G GI +I+   LS     + I +  G  +    I +     F+ +T L SV   SN I  +++F      S            R C  PP +    ++     L    +    C+ G  L+GS  L C+L   G         P C   C +     +       I SP +   ++   Q C W I  +  + I +Y  S    +++ I+ + +   +  +Q
Sbjct: 1767 RYMVGDVVLFQCEQGYSLQGNAHI--------TCMPGPVRRWNYPVPLCLAQCG--------------GSMTDVSGVILSPGFPGNYPS-GLDCTWTVKLPTGFGIHLQFLNFSTEAIHDYLEIRSGTLETGTVIDRFSGPQVPKSLFS-----TTHQTSFFFHSDYSQNKPGFQITYQAYQLQSCPDPRPFRNGIVIGSDFSV-GLTVSFECLPGYSLIGDASLTCLHGISRNWNHPV-PRCEALCGGNI-TSMNGTIYSPGHPEEYPNFQDCVWSVRVPPGNGI-YINFTVLSTEPIYDYITVWDGPDQSSPQIGQ-----FSGNTALESVYSTSNQI--LIKFHSDFSGSGFFVLSYHAYQLRICQAPPEVANADILMEDGELEIGDILRYRCHPGFTLVGSEILTCRL---GERLQMDGPPPTCQVQCPAHDVRFDSTG---VILSPGYPE-SYPNLQMCIWTINVEKGYNITLYFESFQTEREFDILEVFDGSPSTNSQ 2224          
BLAST of SMED30004194 vs. TrEMBL
Match: A0A4W5P0R0 (Uncharacterized protein OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 6.106e-7
Identity = 122/522 (23.37%), Postives = 208/522 (39.85%), Query Frame = 2
Query:  227 KYNNSEKIIYLCQNGYFLQNSKYNQNAIYFNNTCLNGSWKFKTEFIPFCKSSCLRWDMRLQQWKTIMLNATEQIFGFVLSPEYPSNIDNVGENCSYIIEATAGF-IKLKSLELNLEKY--YLEIKS----ENSVIYWPNNGSMNGSYVFYGHKSI--TIHLKENLHHHNSIGKKENFKLIYRKIG-TNCKSYSYDNNLIVNKRELNNHNLLETYSCKYPHKLIGPSQRTCIHEI---WTSLVIPKCKLLCGPPIRISTDGNLELKTDLQEISNCKLQIFSLR---GTGILHIHIKRLSNVINKNCIYMTIGDTRRICIINRSENFYFTSSTIL-SVVKDSNYIPEIVEFLIQSKPS------------RNCSHPPAIRKGALVFNTTSLFSVAGV---SCNDGHILIGSPKLQCQLHYSGVAYWKGLKRPECVKLCNSQWKNIEIAEGPYAISSPPFLNLNFSENQYCKWKIKSKNAFPI-IYISSIYNIKDYVIMSLTNDDNTLENQNYLQDNSNKISIIF 1693
            +Y   + +++ C+ GY LQ + +         TC+ G  +     +P C + C                +   + G +LSP +P N  + G +C++ +    GF I L+ L  + E    YLEI+S      +VI        +G +V    KS+  T H      H +    K  F++ Y+     +C       N IV   + +   L  ++ C   + LIG +  TC+H I   W   V P+C+ LCG  I  S +G +      +E  N +  ++S+R   G GI +I+   LS     + I +  G  +    I +     F+ +T L SV   SN I  +++F      S            R C  PP +    ++      F +  +    C+ G  L+GS  L C+L   G         P C   C +     +       I SP + + ++   Q C W I  +  + I +Y  S    +++ I+ + +  +T  N   L   S  ++  F
Sbjct: 1145 RYMVGDVVLFQCEQGYSLQGNAHI--------TCMPGPVRRWNYPVPLCLAQCG--------------GSMTDVSGVILSPGFPGNYPS-GLDCTWTVILPIGFGIHLQFLNFSTEAIHDYLEIRSGTLETGTVI-----DRFSGPHV---PKSLFSTTHQTSLFFHSDYSQNKPGFQMTYQAYQLQSCPDPRPFRNGIVIGSDFSV-GLTVSFECLPGYSLIGEASLTCLHGISRNWNHPV-PRCEALCGGNI-TSMNGTIYSPGHPEEYPNFQDCVWSVRVPPGNGI-YINFTVLSTEPIYDYITVWDGPDQSSPQIGQ-----FSGNTALESVYSTSNQI--LIKFHSDFSGSGFFVLSYHVFQLRICQAPPDVANADILMEDRE-FEIGDIIWYRCHPGFTLVGSEILTCRL---GERLQMDGPPPTCQVQCPAHDVRFDSTG---VILSPGYPD-SYPNLQMCIWTINVEKGYNITLYFESFQTEREFDILEVFDGPST--NSQTLATFSGDVAAPF 1614          
BLAST of SMED30004194 vs. TrEMBL
Match: A0A4W5NX14 (Uncharacterized protein OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.032e-6
Identity = 122/522 (23.37%), Postives = 207/522 (39.66%), Query Frame = 2
Query:  227 KYNNSEKIIYLCQNGYFLQNSKYNQNAIYFNNTCLNGSWKFKTEFIPFCKSSCLRWDMRLQQWKTIMLNATEQIFGFVLSPEYPSNIDNVGENCSYIIEATAGF-IKLKSLELNLEKY--YLEIKS----ENSVIYWPNNGSMNGSYVFYGHKSI--TIHLKENLHHHNSIGKKENFKLIYRKIG-TNCKSYSYDNNLIVNKRELNNHNLLETYSCKYPHKLIGPSQRTCIHEI---WTSLVIPKCKLLCGPPIRISTDGNLELKTDLQEISNCKLQIFSLR---GTGILHIHIKRLSNVINKNCIYMTIGDTRRICIINRSENFYFTSSTIL-SVVKDSNYIPEIVEFLIQSKPS------------RNCSHPPAIRKGALVFNTTSLFSVAGV---SCNDGHILIGSPKLQCQLHYSGVAYWKGLKRPECVKLCNSQWKNIEIAEGPYAISSPPFLNLNFSENQYCKWKIKSKNAFPI-IYISSIYNIKDYVIMSLTNDDNTLENQNYLQDNSNKISIIF 1693
            +Y   + +++ C+ GY LQ + +         TC+ G  +     +P C + C                +   + G +LSP +P N  + G +C++ +    GF I L+ L  + E    YLEI+S      +VI        +G +V    KS+  T H      H +    K  F++ Y+     +C       N IV   + +   L  ++ C   + LIG +  TC+H I   W   V P+C+ LCG  I  S +G +      +E  N +  ++S+R   G GI +I+   LS     + I +  G  +    I +     F+ +T L SV   SN I  +++F      S            R C  PP +    ++      F +  +    C+ G  L+GS  L C+L   G         P C   C +     +       I SP + + ++   Q C W I  +  + I +Y  S    +++ I+ +  D +   N   L   S  ++  F
Sbjct: 1019 RYMVGDVVLFQCEQGYSLQGNAHI--------TCMPGPVRRWNYPVPLCLAQCG--------------GSMTDVSGVILSPGFPGNYPS-GLDCTWTVILPIGFGIHLQFLNFSTEAIHDYLEIRSGTLETGTVI-----DRFSGPHV---PKSLFSTTHQTSLFFHSDYSQNKPGFQMTYQAYQLQSCPDPRPFRNGIVIGSDFSV-GLTVSFECLPGYSLIGEASLTCLHGISRNWNHPV-PRCEALCGGNI-TSMNGTIYSPGHPEEYPNFQDCVWSVRVPPGNGI-YINFTVLSTEPIYDYITVWDGPDQSSPQIGQ-----FSGNTALESVYSTSNQI--LIKFHSDFSGSGFFVLSYHVFQLRICQAPPDVANADILMEDRE-FEIGDIIWYRCHPGFTLVGSEILTCRL---GERLQMDGPPPTCQVQCPAHDVRFDSTG---VILSPGYPD-SYPNLQMCIWTINVEKGYNITLYFESFQTEREFDILEVF-DGSPSTNSQTLATFSGDVAAPF 1489          
BLAST of SMED30004194 vs. Ensembl Cavefish
Match: CSMD1 (CUB and Sushi multiple domains 1 [Source:HGNC Symbol;Acc:HGNC:14026])

HSP 1 Score: 67.0106 bits (162), Expect = 7.012e-11
Identity = 110/530 (20.75%), Postives = 197/530 (37.17%), Query Frame = 2
Query:  110 IPSSIFPKASSKLPKISSSCMIMESL---LSLHNLQV-----IPS-----KLKYNNSEKIIYLCQNGYFLQNSKYNQNAIYFNNTCLNGSWKFKTEFIPFCKSSCLRWDMRLQQWKTIMLNATEQIFGFVLSPEYPSNIDNVGENCSYIIEATAGFIKLKSLELNLEKYYLEIKSENSVIYWPNNGS--MNGSYVFYGHKSITIHLKEN----LHHHNSIGKKENFKLIYRKIG-TNCKSYSYDNNLIVNKRELNNHNLLETYSCKYPHKLIGPSQRTCI---HEIWTSLVIPKCKLLCGPPIRISTDGNLELKTDLQEISN---CKLQIFSLRGTGILHIHIKRLSNVINKNCIYMTIGDTRRICIINRSENFYFTSST-----ILSVVKDSNYIPEIVEFLIQ--SKPSRNCSHPPAIRKGALVFNTTSLFSVAGVSCNDGHILIGSPKLQCQLHYSGVAYWKGLKRPECVKLCNSQWKNIEIAEGPYAISSPPFLNLNFSENQYCKWKIKSKNAFPIIYISSIYNIK 1600
            I + +F   S++L  IS   M  E      S +NL+      +P+       ++   + +++ C +GY L+             TCL G  +  +  +P C + C                ++  I G +LSP YPSN DN  E C Y +    G    K ++L+   + L    +  ++Y   + S  + G++      ++ I+   N      + N  G  + FKLI+       C+     N     + + +  N    YSC   + L G S  TC+     +W    +P C   CG  I  +T G +          N   C   I +  G  I  +H       ++ + + +  G T    ++           T     IL++  DS+Y      F IQ  +  +  C+ P   + G+   ++          C+ G+ + G  ++ C +  +   +W+    P C+  C           GP  +   P     +   + C W+IK    F I  I   +N++
Sbjct: 1028 IKAGLFGNFSAQLRFISDFSMSYEGFNITFSEYNLEPCEDPGVPAYSRRVGFQFGVGDSLMFTCFSGYRLEGES--------KITCLGGGRRVWSAVLPRCVAECGA--------------SSTGIEGVLLSPNYPSNYDNNHE-CIYRVRTDNG----KGIQLSASTFQLR-DGDFLLVYDGQDSSSRLLGNFTKNEMSNVIINSTSNHLWIEFNSNGTGTSKGFKLIHTSFDLVKCEEPGTPNYGYKIQDDGHFANTYVLYSCNPGYTLHGSSTLTCLSGDRRVWDK-SLPSCVAECGGHISGATSGRILSPGYPAPYDNNLHCTWSIEADTGKTI-SLHFIVFDTEVDHDILKVWDGPTESGILLKEWSGSLLPEDTHSTFNILTLQFDSDYFISKSGFSIQFSTTTASTCNDPGTPQNGSRYGDSREPGDTISFQCDPGYQVQGVSEITC-VQLNNRFFWQ-PDPPTCMATCGGN------VTGPAGVILSPNYPQPYPAGKECDWRIKVNPDFVIALIFKSFNME 1519          
BLAST of SMED30004194 vs. Ensembl Cavefish
Match: csmd3a (CUB and Sushi multiple domains 3a [Source:ZFIN;Acc:ZDB-GENE-050419-118])

HSP 1 Score: 55.8398 bits (133), Expect = 2.119e-7
Identity = 110/497 (22.13%), Postives = 193/497 (38.83%), Query Frame = 2
Query:  227 KYNNSEKIIYLCQNGYFLQNSKYNQNAIYFNNTCLNGSWKFKTEFIPFCKSSCLRWDMRLQQWKTIMLNATEQIFGFVLSPEYPSNIDNVGENCSYIIEATAGF-IKLKSLELNLEKY--YLEIKS---ENSVIYWPNNGSMNGSYVFYGHKSITIHLKENLHHHNSIGKKENFKLIYRKIG-TNCKSYSYDNNLIVNKRELNNHNLLETYSCKYPHKLIGPSQRTCIHEI---WTSLVIPKCKLLCGPPIRISTDGNLELKTDLQEISNCKLQIFSLR---GTGILHIHIKRLSNVINKNCIYMTIGDTRRICIINRS------ENFYFTSSTILSVVKDSNYIPEIVEFLIQSKPSRNCSHPPAIRKGALVF--NTTSLFSVAGVSCNDGHILIGSPKLQCQLHYSGVAYWKGLKRPECVKLCNSQWKNIEIAEGPYAISSPPFLNLNFSENQYCKWKIKSKNAFPI-IYISSIYNIKDYVIMSLTNDDNTLENQ 1651
            +Y   + +++ C+ GY LQ + +         TC+ G  +     +P C + C                +   + G +LSP YP N  + G +C++ +    GF I L+ L  + E    YLEI+S   + S +    +G      +F      T H      H +    K  F + Y+     +C       N IV   + +   +  ++ C   + LIG +  TC+H     W +  +P+C+ LCG  I  + +G +       E  N +  ++S+R   G GI +I+   LS     + I +  G  +    I +       E+ Y TS+ IL                  +   R C  PP +     +   N   +  +    C+ G  L+GS  L C+L   G         P C   C +   ++   +    I SP + + ++   Q C W I  +  + I ++       K+Y I+ +  D  T+ +Q
Sbjct: 1920 RYMVGDVVMFQCEQGYSLQGNAHI--------TCMPGPVRRWNYPVPLCLAQCG--------------GSMTDVSGVILSPGYPGNYPS-GLDCTWTVTLPIGFGIHLQFLNFSTEAIHDYLEIRSGPTDTSTVIDRFSGPQVPEPLFS-----TTHETSFFFHSDYSQNKPGFHITYQAYQLQSCPDPRPFRNGIVIGSDFSV-GMTVSFECLPGYSLIGETSLTCLHGTSRNW-NFPVPRCEALCGGNI-TAMNGTIFSPGHPAEYPNFQDCVWSVRVPPGNGI-YINFTVLSTEPIYDYITVWDGPDQSSPQIGQFSGNTALESVYSTSNQILIKFHSDFSGSGFFVLSYHAYQLRVCQAPPEVANADALMEDNEFEIGDIIRYRCHPGFTLVGSEILTCRL---GERLQMDGPPPSCQVQCPAH--DVRF-DSTGVILSPGYPD-SYPNLQMCSWSINVEKGYNITLHFEFFQTEKEYDILEVF-DGPTIHSQ 2376          

HSP 2 Score: 52.7582 bits (125), Expect = 1.883e-6
Identity = 33/117 (28.21%), Postives = 51/117 (43.59%), Query Frame = 2
Query: 1235 KPSRNCSHPPAIRKGALVFNTTSLFSVAGVSCNDGHILIGSPKLQCQLHYSGVAYWKGLKRPEC-VKLCNSQWKNIEIAEGPYAISSPPFLNLNFSENQYCKWKIKSKNAFPIIYIS 1582
            + S +C  P     G L+ +  S+ + A  +C++ H+L GS  + CQ      A W    RP C VK C S        +GP    + P   + +  N  C W I + N   +I I+
Sbjct:  334 QASNSCPDPGVPENGKLIGSDFSIGATAQFTCDEDHVLQGSKSITCQRVAEVFAAWSD-HRPVCRVKTCGSN------LQGPSGTFTSPNFPIQYESNSQCVWIITASNPNKVIQIN 443          
BLAST of SMED30004194 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001629.1 (pep scaffold:Pmarinus_7.0:GL476369:34656:293612:-1 gene:ENSPMAG00000001441.1 transcript:ENSPMAT00000001629.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 6.245e-8
Identity = 110/490 (22.45%), Postives = 178/490 (36.33%), Query Frame = 2
Query:  227 KYNNSEKIIYLCQNGYFLQNSKYNQNAIYFNNTCLNGSWKFKTEFIPFCKSSCLRWDMRLQQWKTIMLNATEQIFGFVLSP----EYPSNIDNVGENCSYIIEATAGF-IKLKSLELNLEKY--YLEIKS----ENSVIYWPNNGSMNGSYVFYGHKSITIHLKENLHHHNSIGKKENFKLIYRKIG-TNCKS-YSYDNNLIVNKRELNNHNLLET--YSCKYPHKLIGPSQRTCIH---EIWTSLVIPKCKLLCGPPIR--ISTDGNLELKTDLQEISNCKLQIFSLRGTGI-LHIHIKRLSNVINKNCIYMTIGDTRRICII------NRSENFYFTSSTILSVVKDSNYIPEIVEFLIQSKPSRNCSHPPAIRKGALVFN--TTSLFSVAGVSCNDGHILIGSPKLQCQLHYSGVAYWKGLKRPECVKLCNSQWKNIEIAEGPYAISSPPFLNLNFSENQYCKWKIKSKNAFPI-IYISSIYNIKDY 1606
            +Y  ++ + + C+ GY L+   +         +C+ G  +      P C + C                  +   G VLSP     YPSN+D     C++ I    GF I    L  + E    YLEIKS      +VI     G  +G  +     S T+H+     H +    K+ FK+ Y      NC     + N  +V     NN  + ++  + C   + LIG +  TC H     W S  IP C+  CG  +     T  +     +     +C   I    G GI L+  + +   V +   ++   G  +R   +         E+ Y TS  IL           +      +   ++C  PP +    ++    T  +  +    C  G  L+GS  L CQL   G      +  P C  LC++     EI      +   P    N+   Q C W +  +  + I +Y+    + K Y
Sbjct: 1898 RYLVNDVVSFQCEPGYTLEGHSFI--------SCMPGPVRRWNYAPPLCIARCG--------------GTFDDFNGVVLSPGFPGNYPSNLD-----CTWKINLPIGFGIYFTFLNFSTEPIHDYLEIKSGPAEAGTVI-----GRFSGPLIPASLIS-TMHVTTLYFHSDYSQNKQGFKISYEAYELQNCPDPRPFTNGYVVG----NNFGVGQSISFECFPGYVLIGSAVLTCQHGHSRHW-SYPIPSCEAPCGSNVTGLSGTVYSPGFPNEYPNFQDCYWLIMVPPGNGIFLNFTVLQTEPVYDFITVWYWDGPDQRAPQLGLFSGNTAMESLYSTSDKILVKFHSDFSTSGLFIINFSAYQLQSCQLPPLVANAEILMEDETFEIGDIIKYRCLLGFTLVGSEVLTCQL---GTRLQANVASPTCQALCSTN----EIRRESSGVILSPGYPSNYPNLQTCGWMLSVEKGYTITLYVEFFQSEKQY 2342          

HSP 2 Score: 49.2914 bits (116), Expect = 4.057e-6
Identity = 46/182 (25.27%), Postives = 68/182 (37.36%), Query Frame = 2
Query: 1070 SNVINKNCIYMTIGDTRRICIINRSENFYF----------TSSTILSVVKDSNYIPEIVEFLIQSKPSRNCSHPPAIRKGALVFNTTSLFSVAGVSCNDGHILIGSPKLQCQLHYSGVAYWKGLKRPEC-VKLCNSQWKNIEIAEGPYAISSPPFLNLNFSENQYCKWKIKSKNAFPIIYIS 1582
            ++VI K   YM     R   I NR   + F          +    L   KD N    ++     ++ S +C  P        + +   L ++   SC +G++L GS  + CQ      A W    RP C  K C S        EGP  + + P   L +  N  C W I + N    I I+
Sbjct:  241 THVIKKQKCYMHAQHHRSFRIFNRLFTYSFKVMKRAVDLKSRGVKLPPSKDINQKQLVLNEGGITQASSSCPDPGEPEHATRIGSDFRLGAIVQFSCKEGYVLQGSSSILCQKVNDVFAAWSD-SRPLCKAKTCGSH------LEGPSGVITSPNFPLKYDNNAQCMWTITAVNPGKTIQIN 415          
BLAST of SMED30004194 vs. Ensembl Medaka
Match: csmd3a (CUB and Sushi multiple domains 3 [Source:NCBI gene;Acc:101161736])

HSP 1 Score: 58.9214 bits (141), Expect = 2.576e-8
Identity = 107/482 (22.20%), Postives = 190/482 (39.42%), Query Frame = 2
Query:  254 YLCQNGYFLQNSKYNQNAIYFNNTCLNGSWKFKTEFIPFCKSSCLRWDMRLQQWKTIMLNATEQIFGFVLSPEYPSNIDNVGENCSYIIEATAGF-IKLKSLELNLEKY--YLEIKS---ENSVIYWPNNGSMNGSYVFYGHKSITIHLKENLHHHNSIGKKENFKLIYRKIG-TNCKSYSYDNNLIVNKRELNNHNLLETYSCKYPHKLIGPSQRTCIHEI---WTSLVIPKCKLLCGPPIRISTDGNLELKTDLQEISNCKLQIFSLR---GTGILHIHIKRLSNVINKNCIY--MTIGD-----TRRICIINRS---ENFYFTSSTILSVVKDSNYIPEIVEFLIQSKPSRNCSHPPAIRKGALVFNTTSL--FSVAGVSCNDGHILIGSPKLQCQLHYSGVAYWKGLKRPECVKLCNSQWKNIEIAEGPYAISSPPFLNLNFSENQYCKWKIKSKNAFPI-IYISSIYNIKDYVIMSL 1621
            + C+ GY LQ + +         TC+ G  +     +P C + C                +  ++ G +LSP YP N  + G +C++ +    GF I L+ L L+ E    YLEI+S   E   +    +G +    +F      T H      H +    K  F ++Y+     +C       N IV   + +   +  ++ C   + LIG +  TC+H +   W    +P+C+ LCG  I  S +G +      +E  N +  ++S+R   G GI +I+      V+N   IY  +T+ D     + +I   + +   E+ Y TS+ IL                  +   R C  PP +    ++     L    +    C+ G  L+GS  L C+L   G         P C   C +     ++      +   P    ++   Q C W I  +  + + I I S +  +++ ++ +
Sbjct: 1952 FSCEQGYSLQGNAHI--------TCMPGPVRRWNYPVPLCIAQCG--------------GSMTEVNGVILSPGYPGNYPS-GLDCTWTVTLPVGFGIHLQFLNLSTEAIHDYLEIRSGTLETGSVIDRFSGPIIPKPLFS-----TTHQTSFSFHSDYSQNKPGFHIVYQAYQLQSCPDPRPFRNGIVIGTDFSV-GMTVSFECLPGYSLIGEASLTCLHGVSRNWNH-ALPRCEALCGGNI-TSLNGTIYSPGHPEEYPNFQDCVWSVRVPPGHGI-YINF----TVLNTEPIYDYITVWDGPDQSSPQIGQFSGNTALESVYSTSNIILIKFHSDFSGAGFFVLSYHAYQLRVCQPPPEVPNADILMEDGELEIGDIIRYKCHPGFSLVGSEILTCRL---GERLQMDAPPPTCQVQCPAH----DVRYDSSGVILSPGWPESYPNLQMCSWSITVEKGYNVTITIESFHTEREFDVLEI 2390          
BLAST of SMED30004194 vs. Ensembl Medaka
Match: csmd3a (CUB and sushi domain-containing protein 3 [Source:NCBI gene;Acc:101167820])

HSP 1 Score: 55.8398 bits (133), Expect = 1.986e-7
Identity = 97/462 (21.00%), Postives = 176/462 (38.10%), Query Frame = 2
Query:  227 KYNNSEKIIYLCQNGYFLQNSKYNQNAIYFNNTCLNGSWKFKTEFIPFCKSSCLRWDMRLQQWKTIMLNATEQIFGFVLSPEYPSNIDNVGENCSYIIEATAGF-IKLKSLELNLEKY--YLEIKS---ENSVIYWPNNGSMNGSYVFYGHKSITIHLKENLHHHNSIGKKENFKLIYR--KIGTNCKSYSYDNNLIVNKRELNNHNLLETYSCKYPHKLIGPSQRTCIHEI---WTSLVIPKCKLLCGPPIRISTDGNLELKTDLQEISNCKLQIFSLRGTGILHIHIKRLSNVINKNCIY--MTIGD-----TRRICIINRS---ENFYFTSSTILSVVKDSNYIPEIVEFLIQSKPSRNCSHPPAIRKGALVFNTTSLFSVAGV---SCNDGHILIGSPKLQCQLHYSGVAYWKGLKRPECVKLCNSQWKNIEIAEGPYAISSPPFLNLNFSENQYCKW 1540
            +Y   + + + C  G+ LQ + Y         TC+ G  +     +P C + C                +     G +LSP +P N  +   +CS+ ++   GF I L+ L  + E    YLE++S   E   +    +G +  + +F      T H      H +    K  F +IY+  ++        + + +++ +    +  +  ++ C   + L+G    TC+H I   W    IP+C+ LCG  I  S +G +       E  + +  ++++R      I+I    +VIN   IY  +T+ D     + +I   + S   E    T++ +L             E    +   R C  PP +   A +      F +  +   SC  G  ++GS  L C+L        + L+      +C  Q    E+      +   P    N+   Q C W
Sbjct: 1948 RYTVGDMVSFQCDQGFSLQGNAYI--------TCMPGPVRRWNYPVPLCLAQCG--------------GSMTNFNGVILSPGFPGNYQS-SLDCSWRVQLPVGFGIHLQFLNFSTEPVHDYLEVRSGSLETGTVIDRFSGPVVPNSLFS-----TTHETTLFFHSDYSQNKPGFHIIYQAYELQRCPDPLPFRSGIVIGQDY--SVGMTISFECLPGYTLLGEPSLTCLHGISRNWNH-PIPRCEALCGGNI-TSMNGTIYSPGHPAEYPHFQDCMWTVRVPPGYGIYINF--SVINTEPIYDFITVWDGPDQSSPQIGQFSGSSVQEGVSTTANQVLIKFHSDFSTSGFFELHYYAYQLRTCQPPPPVAN-ATILTDGDEFEIGDIIRYSCQPGFTMVGSEILTCRLG-------ERLQMDGPPPVCQVQCPAHEVRFDSTGVILSPGYPENYPNLQMCSW 2367          
BLAST of SMED30004194 vs. Planmine SMEST
Match: SMESG000009646.1 (SMESG000009646.1)

HSP 1 Score: 1501.49 bits (3886), Expect = 0.000e+0
Identity = 737/738 (99.86%), Postives = 737/738 (99.86%), Query Frame = 2
Query:   71 MNVIENKENHKSYIPSSIFPKASSKLPKISSSCMIMESLLSLHNLQVIPSKLKYNNSEKIIYLCQNGYFLQNSKYNQNAIYFNNTCLNGSWKFKTEFIPFCKSSCLRWDMRLQQWKTIMLNATEQIFGFVLSPEYPSNIDNVGENCSYIIEATAGFIKLKSLELNLEKYYLEIKSENSVIYWPNNGSMNGSYVFYGHKSITIHLKENLHHHNSIGKKENFKLIYRKIGTNCKSYSYDNNLIVNKRELNNHNLLETYSCKYPHKLIGPSQRTCIHEIWTSLVIPKCKLLCGPPIRISTDGNLELKTDLQEISNCKLQIFSLRGTGILHIHIKRLSNVINKNCIYMTIGDTRRICIINRSENFYFTSSTILSVVKDSNYIPEIVEFLIQSKPSRNCSHPPAIRKGALVFNTTSLFSVAGVSCNDGHILIGSPKLQCQLHYSGVAYWKGLKRPECVKLCNSQWKNIEIAEGPYAISSPPFLNLNFSENQYCKWKIKSKNAFPIIYISSIYNIKDYVIMSLTNDDNTLENQNYLQDNSNKISIIFICPSPLCRLVIEPQKSLNNLQEKIFMEIKIILADNISPIEYHPGIYGLIFLMIILCLLSVLVYYDYSHRPYTGYTAKVLNILKSSKFKKLSAMSKFYIPCWNPISKTEEKIIIFFNKHHSDKTYIHIQRSASCPRDNINTSGTSKYRLDTAKRRFSDITDLVVQRSTIREETIPESYMNCDSANYTNLAYDCDDQKS 2284
            MNVIENKENHKSYIPSSIFPKASSKLPKISSSCMIMESLLSLHNLQVIPSKLKYNNSEKIIYLCQNGYFLQNSKYNQNAIYFNNTCLNGSWKFKTEFIPFCKSSCLRWDMRLQQWKTIMLNATEQIFGFVLSPEYPSNIDNVGENCSYIIEATAGFIKLKSLELNLEKYYLEIKSENSVIYWPNNGSMNGSYVFYGHKSITIHLKENLHHHNSIGKKENFKLIYRKIGTNCKSYSYDNNLIVNKRELNNHNLLETYSCKYPHKLIGPSQRTCIHEIWTSLVIPKCKLLCGPPIRISTDGNLELKTDLQEISNCKLQIFSLRGT ILHIHIKRLSNVINKNCIYMTIGDTRRICIINRSENFYFTSSTILSVVKDSNYIPEIVEFLIQSKPSRNCSHPPAIRKGALVFNTTSLFSVAGVSCNDGHILIGSPKLQCQLHYSGVAYWKGLKRPECVKLCNSQWKNIEIAEGPYAISSPPFLNLNFSENQYCKWKIKSKNAFPIIYISSIYNIKDYVIMSLTNDDNTLENQNYLQDNSNKISIIFICPSPLCRLVIEPQKSLNNLQEKIFMEIKIILADNISPIEYHPGIYGLIFLMIILCLLSVLVYYDYSHRPYTGYTAKVLNILKSSKFKKLSAMSKFYIPCWNPISKTEEKIIIFFNKHHSDKTYIHIQRSASCPRDNINTSGTSKYRLDTAKRRFSDITDLVVQRSTIREETIPESYMNCDSANYTNLAYDCDDQKS
Sbjct:    1 MNVIENKENHKSYIPSSIFPKASSKLPKISSSCMIMESLLSLHNLQVIPSKLKYNNSEKIIYLCQNGYFLQNSKYNQNAIYFNNTCLNGSWKFKTEFIPFCKSSCLRWDMRLQQWKTIMLNATEQIFGFVLSPEYPSNIDNVGENCSYIIEATAGFIKLKSLELNLEKYYLEIKSENSVIYWPNNGSMNGSYVFYGHKSITIHLKENLHHHNSIGKKENFKLIYRKIGTNCKSYSYDNNLIVNKRELNNHNLLETYSCKYPHKLIGPSQRTCIHEIWTSLVIPKCKLLCGPPIRISTDGNLELKTDLQEISNCKLQIFSLRGTSILHIHIKRLSNVINKNCIYMTIGDTRRICIINRSENFYFTSSTILSVVKDSNYIPEIVEFLIQSKPSRNCSHPPAIRKGALVFNTTSLFSVAGVSCNDGHILIGSPKLQCQLHYSGVAYWKGLKRPECVKLCNSQWKNIEIAEGPYAISSPPFLNLNFSENQYCKWKIKSKNAFPIIYISSIYNIKDYVIMSLTNDDNTLENQNYLQDNSNKISIIFICPSPLCRLVIEPQKSLNNLQEKIFMEIKIILADNISPIEYHPGIYGLIFLMIILCLLSVLVYYDYSHRPYTGYTAKVLNILKSSKFKKLSAMSKFYIPCWNPISKTEEKIIIFFNKHHSDKTYIHIQRSASCPRDNINTSGTSKYRLDTAKRRFSDITDLVVQRSTIREETIPESYMNCDSANYTNLAYDCDDQKS 738          
BLAST of SMED30004194 vs. Planmine SMEST
Match: SMESG000009646.1 (SMESG000009646.1)

HSP 1 Score: 459.144 bits (1180), Expect = 1.440e-158
Identity = 224/224 (100.00%), Postives = 224/224 (100.00%), Query Frame = 2
Query: 1613 MSLTNDDNTLENQNYLQDNSNKISIIFICPSPLCRLVIEPQKSLNNLQEKIFMEIKIILADNISPIEYHPGIYGLIFLMIILCLLSVLVYYDYSHRPYTGYTAKVLNILKSSKFKKLSAMSKFYIPCWNPISKTEEKIIIFFNKHHSDKTYIHIQRSASCPRDNINTSGTSKYRLDTAKRRFSDITDLVVQRSTIREETIPESYMNCDSANYTNLAYDCDDQKS 2284
            MSLTNDDNTLENQNYLQDNSNKISIIFICPSPLCRLVIEPQKSLNNLQEKIFMEIKIILADNISPIEYHPGIYGLIFLMIILCLLSVLVYYDYSHRPYTGYTAKVLNILKSSKFKKLSAMSKFYIPCWNPISKTEEKIIIFFNKHHSDKTYIHIQRSASCPRDNINTSGTSKYRLDTAKRRFSDITDLVVQRSTIREETIPESYMNCDSANYTNLAYDCDDQKS
Sbjct:    1 MSLTNDDNTLENQNYLQDNSNKISIIFICPSPLCRLVIEPQKSLNNLQEKIFMEIKIILADNISPIEYHPGIYGLIFLMIILCLLSVLVYYDYSHRPYTGYTAKVLNILKSSKFKKLSAMSKFYIPCWNPISKTEEKIIIFFNKHHSDKTYIHIQRSASCPRDNINTSGTSKYRLDTAKRRFSDITDLVVQRSTIREETIPESYMNCDSANYTNLAYDCDDQKS 224          
The following BLAST results are available for this feature:
BLAST of SMED30004194 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004194 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004194 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004194 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
csmd3a8.794e-923.02CUB and Sushi multiple domains 3a [Source:ZFIN;Acc... [more]
back to top
BLAST of SMED30004194 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004194 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004194 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004194 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A556U7621.572e-821.54CUB and sushi domain-containing protein 1 OS=Bagar... [more]
W5K8T41.851e-720.75CUB and Sushi multiple domains 1 OS=Astyanax mexic... [more]
A0A4W5PKS85.581e-722.82Si:ch211-236p22.1 OS=Hucho hucho OX=62062 PE=4 SV=... [more]
A0A4W5P0R06.106e-723.37Uncharacterized protein OS=Hucho hucho OX=62062 PE... [more]
A0A4W5NX141.032e-623.37Uncharacterized protein OS=Hucho hucho OX=62062 PE... [more]
back to top
BLAST of SMED30004194 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CSMD17.012e-1120.75CUB and Sushi multiple domains 1 [Source:HGNC Symb... [more]
csmd3a2.119e-722.13CUB and Sushi multiple domains 3a [Source:ZFIN;Acc... [more]
back to top
BLAST of SMED30004194 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001629.16.245e-822.45pep scaffold:Pmarinus_7.0:GL476369:34656:293612:-1... [more]
back to top
BLAST of SMED30004194 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004194 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004194 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
csmd3a2.576e-822.20CUB and Sushi multiple domains 3 [Source:NCBI gene... [more]
csmd3a1.986e-721.00CUB and sushi domain-containing protein 3 [Source:... [more]
back to top
BLAST of SMED30004194 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000009646.10.000e+099.86SMESG000009646.1[more]
SMESG000009646.11.440e-158100.00SMESG000009646.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004194 ID=SMED30004194|Name=SMED30004194|organism=Schmidtea mediterranea sexual|type=transcript|length=2311bp
AAAGCAAGTGGTTAGAAAGTTATAGTACAAAATGACAATGTTATTTTTAT
TTTTATTTTTTCTATCAAAAATGAACGTAATTGAAAATAAAGAAAACCAC
AAAAGCTATATACCATCATCAATTTTCCCAAAAGCTTCTTCGAAATTACC
CAAGATTTCATCCTCGTGTATGATTATGGAAAGCTTGTTGAGTTTACACA
ATTTACAGGTAATTCCTTCTAAACTCAAATATAATAATTCTGAAAAAATT
ATTTATTTGTGTCAAAATGGGTATTTCCTTCAAAACTCCAAATATAATCA
AAATGCAATTTATTTTAATAATACTTGTTTAAATGGCAGTTGGAAATTCA
AAACAGAATTTATACCATTTTGTAAGAGTAGTTGTTTGCGATGGGATATG
AGACTGCAACAATGGAAGACAATTATGTTAAACGCAACAGAACAAATCTT
CGGATTCGTCCTCAGCCCAGAGTACCCTTCTAACATCGATAATGTTGGGG
AGAATTGCTCTTATATTATTGAAGCGACAGCTGGATTTATTAAACTTAAA
TCTCTTGAACTTAATTTGGAAAAGTATTACTTGGAAATAAAATCAGAAAA
TTCGGTCATATACTGGCCCAATAATGGTTCTATGAATGGAAGTTATGTTT
TCTACGGCCATAAATCTATCACAATTCATCTTAAAGAAAATCTTCATCAT
CATAATTCTATAGGGAAAAAAGAAAACTTCAAATTAATTTATAGGAAAAT
CGGAACGAATTGCAAATCCTATTCTTATGATAACAATTTAATAGTCAACA
AAAGAGAATTAAACAATCATAATTTATTAGAGACTTATTCTTGTAAATAT
CCGCACAAGCTCATAGGTCCGTCCCAAAGAACTTGTATTCACGAAATTTG
GACCTCACTAGTTATTCCGAAATGTAAATTGCTATGTGGTCCTCCCATTA
GGATTTCAACAGATGGTAATCTAGAACTTAAAACAGACTTACAAGAAATT
TCAAATTGCAAACTGCAAATATTTAGTCTTCGTGGAACAGGTATTTTACA
TATTCATATTAAAAGACTGTCAAATGTCATCAATAAAAACTGTATTTATA
TGACTATTGGTGACACTCGACGAATATGCATAATAAACAGATCTGAAAAT
TTTTATTTCACTTCTTCAACTATTCTCTCCGTGGTTAAAGATTCGAATTA
TATACCAGAGATCGTCGAATTCCTCATCCAAAGCAAACCAAGTCGAAATT
GTTCACATCCACCAGCTATTAGAAAAGGAGCATTAGTTTTCAATACAACT
TCTTTATTTTCAGTTGCCGGTGTTTCTTGTAACGATGGACACATTTTGAT
AGGATCTCCGAAATTGCAATGTCAACTCCATTATTCGGGAGTAGCTTATT
GGAAAGGTTTAAAACGGCCAGAATGTGTCAAATTATGTAATAGCCAATGG
AAAAATATTGAAATCGCAGAGGGACCATATGCGATTTCATCCCCCCCATT
TCTGAATTTGAATTTCTCCGAAAATCAATATTGTAAGTGGAAAATCAAGT
CAAAAAATGCCTTTCCAATTATTTATATTTCTAGCATCTATAATATAAAA
GATTATGTTATAATGTCATTAACGAATGATGATAACACTTTGGAAAATCA
AAATTATTTGCAAGACAATTCTAACAAGATTAGTATAATTTTCATTTGCC
CAAGCCCCTTGTGCAGACTGGTGATTGAGCCTCAAAAAAGTTTGAACAAT
TTGCAGGAGAAAATATTTATGGAGATTAAAATTATTTTGGCAGATAATAT
ATCTCCCATAGAGTATCATCCTGGAATATATGGTCTGATTTTTTTAATGA
TAATTCTGTGCCTTTTGTCTGTATTAGTGTACTATGATTACTCTCATCGT
CCGTATACTGGATATACCGCAAAAGTTTTGAACATTTTGAAATCTTCAAA
ATTTAAAAAACTATCGGCTATGTCGAAATTTTACATTCCTTGTTGGAATC
CAATTTCCAAAACAGAAGAAAAAATTATAATATTTTTCAATAAACATCAT
TCTGACAAAACTTATATTCACATCCAGAGATCGGCTTCATGCCCTCGTGA
TAACATAAATACATCTGGAACATCGAAATATAGACTTGATACGGCTAAAC
GACGTTTTAGCGATATTACAGATTTAGTCGTACAAAGAAGCACGATTCGG
GAAGAAACCATTCCGGAATCATATATGAACTGCGATAGCGCAAACTATAC
AAACTTAGCCTATGATTGCGATGATCAAAAATCGTAGTGTTTAACATTTT
CATCTTTATTT
back to top

protein sequence of SMED30004194-orf-1

>SMED30004194-orf-1 ID=SMED30004194-orf-1|Name=SMED30004194-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=752bp
MTMLFLFLFFLSKMNVIENKENHKSYIPSSIFPKASSKLPKISSSCMIME
SLLSLHNLQVIPSKLKYNNSEKIIYLCQNGYFLQNSKYNQNAIYFNNTCL
NGSWKFKTEFIPFCKSSCLRWDMRLQQWKTIMLNATEQIFGFVLSPEYPS
NIDNVGENCSYIIEATAGFIKLKSLELNLEKYYLEIKSENSVIYWPNNGS
MNGSYVFYGHKSITIHLKENLHHHNSIGKKENFKLIYRKIGTNCKSYSYD
NNLIVNKRELNNHNLLETYSCKYPHKLIGPSQRTCIHEIWTSLVIPKCKL
LCGPPIRISTDGNLELKTDLQEISNCKLQIFSLRGTGILHIHIKRLSNVI
NKNCIYMTIGDTRRICIINRSENFYFTSSTILSVVKDSNYIPEIVEFLIQ
SKPSRNCSHPPAIRKGALVFNTTSLFSVAGVSCNDGHILIGSPKLQCQLH
YSGVAYWKGLKRPECVKLCNSQWKNIEIAEGPYAISSPPFLNLNFSENQY
CKWKIKSKNAFPIIYISSIYNIKDYVIMSLTNDDNTLENQNYLQDNSNKI
SIIFICPSPLCRLVIEPQKSLNNLQEKIFMEIKIILADNISPIEYHPGIY
GLIFLMIILCLLSVLVYYDYSHRPYTGYTAKVLNILKSSKFKKLSAMSKF
YIPCWNPISKTEEKIIIFFNKHHSDKTYIHIQRSASCPRDNINTSGTSKY
RLDTAKRRFSDITDLVVQRSTIREETIPESYMNCDSANYTNLAYDCDDQK
S*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035976Sushi/SCR/CCP_sf
IPR035914Sperma_CUB_dom_sf
IPR000436Sushi_SCR_CCP_dom
IPR000859CUB_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000436Sushi/SCR/CCP domainSMARTSM00032CCP_2coord: 49..114
e-value: 0.8
score: 16.9
coord: 407..465
e-value: 2.6E-5
score: 33.6
coord: 244..298
e-value: 0.048
score: 22.8
IPR000436Sushi/SCR/CCP domainPROSITEPS50923SUSHIcoord: 242..300
score: 7.091
IPR000436Sushi/SCR/CCP domainPROSITEPS50923SUSHIcoord: 44..116
score: 7.443
IPR000436Sushi/SCR/CCP domainPROSITEPS50923SUSHIcoord: 405..467
score: 7.878
IPR000436Sushi/SCR/CCP domainCDDcd00033CCPcoord: 407..450
e-value: 3.94447E-4
score: 37.0572
IPR000436Sushi/SCR/CCP domainCDDcd00033CCPcoord: 57..115
e-value: 0.00954479
score: 33.2052
NoneNo IPR availableGENE3DG3DSA:2.10.70.10coord: 406..465
e-value: 3.5E-7
score: 32.5
NoneNo IPR availablePANTHERPTHR19325COMPLEMENT COMPONENT-RELATED SUSHI DOMAIN-CONTAININGcoord: 69..330
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.66
NoneNo IPR availableTMHMMTMhelixcoord: 596..618
IPR035976Sushi/SCR/CCP superfamilySUPERFAMILYSSF57535Complement control module/SCR domaincoord: 243..304
IPR035976Sushi/SCR/CCP superfamilySUPERFAMILYSSF57535Complement control module/SCR domaincoord: 406..470
IPR035914Spermadhesin, CUB domain superfamilySUPERFAMILYSSF49854Spermadhesin, CUB domaincoord: 139..240