SMED30004187
Overview
Neoblast Clusters
Zeng et. al., 2018
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny AppEmbryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30004187 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 19Note: Hover over icons to view figure legend
Alignments
SMED30004187 aligns in the following genomic locations:
Homology
BLAST of SMED30004187 vs. Planmine SMEST
Match: SMESG000043423.1 (SMESG000043423.1) HSP 1 Score: 175.252 bits (443), Expect = 2.231e-58 Identity = 83/83 (100.00%), Postives = 83/83 (100.00%), Query Frame = 3 Query: 54 IVPIFCDLETYQDSEDEAEVTEKELDHYNDEKLENGAKKVLRYRYCTSRFCRFYWNRWFSCFILFYAPIGIRSRCGPKKIYCL 302 IVPIFCDLETYQDSEDEAEVTEKELDHYNDEKLENGAKKVLRYRYCTSRFCRFYWNRWFSCFILFYAPIGIRSRCGPKKIYCL Sbjct: 13 IVPIFCDLETYQDSEDEAEVTEKELDHYNDEKLENGAKKVLRYRYCTSRFCRFYWNRWFSCFILFYAPIGIRSRCGPKKIYCL 95
BLAST of SMED30004187 vs. Planmine SMEST
Match: SMESG000043393.1 (SMESG000043393.1) HSP 1 Score: 50.447 bits (119), Expect = 4.199e-9 Identity = 27/75 (36.00%), Postives = 43/75 (57.33%), Query Frame = 3 Query: 81 TYQDSEDEAEVTEKELDHYNDEKLENGAKKVLRYRYCTSRFCRFYWN-RWFSCFILFYAPIGIRSRCGPKKIYCL 302 T +S D + E+E++ ND++ EN K +++RYC R CR Y+ RWF+C + FY I C P++ C+ Sbjct: 27 TNDESFDVKSLKEEEIEEGNDKEEENDTKLFIKHRYCGLRTCRLYFGRRWFTCTVRFYR---IGRLCKPRRFACV 98
BLAST of SMED30004187 vs. Planmine SMEST
Match: SMESG000043388.1 (SMESG000043388.1) HSP 1 Score: 49.2914 bits (116), Expect = 1.196e-8 Identity = 26/75 (34.67%), Postives = 43/75 (57.33%), Query Frame = 3 Query: 81 TYQDSEDEAEVTEKELDHYNDEKLENGAKKVLRYRYCTSRFCRFYWN-RWFSCFILFYAPIGIRSRCGPKKIYCL 302 T +S D + E+E++ ND++ EN K ++++RYC R CR ++ RWF+C + FY I C P + C+ Sbjct: 27 TNDESFDVKSLKEEEIEEGNDKEEENDTKLLIKHRYCGLRTCRLHFGRRWFTCTVRFYR---IGRLCKPSRFNCV 98
BLAST of SMED30004187 vs. Planmine SMEST
Match: SMESG000040596.1 (SMESG000040596.1) HSP 1 Score: 42.743 bits (99), Expect = 3.192e-6 Identity = 29/75 (38.67%), Postives = 42/75 (56.00%), Query Frame = 3 Query: 81 TYQDSEDEAEVTEKELDHYNDEKLENGAKKVLRYRYCTSRFCRFYWN-RWFSCFILFYAPIGIRSRCGPKKIYCL 302 T +S D + E+EL+ ND++ EN K R RYC R CRF++ RWF+C + FY R C P++ C+ Sbjct: 27 TNDESFDVKSLKEEELEEGNDKEEENDTKLFKRRRYCGLRTCRFFFGRRWFTCTVRFYRS---RRLCKPRRFSCV 98 The following BLAST results are available for this feature:
BLAST of SMED30004187 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30004187 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30004187 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30004187 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30004187 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30004187 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30004187 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30004187 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 0
BLAST of SMED30004187 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30004187 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30004187 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30004187 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30004187 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30004187 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 4
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30004187 ID=SMED30004187|Name=SMED30004187|organism=Schmidtea mediterranea sexual|type=transcript|length=357bpback to top protein sequence of SMED30004187-orf-1 >SMED30004187-orf-1 ID=SMED30004187-orf-1|Name=SMED30004187-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp DTNLIMKLFYLLLGLLLIVPIFCDLETYQDSEDEAEVTEKELDHYNDEKLback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|