TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30004183
Length (bp)2152
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30004183) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30004183) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30004183) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30004183) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004183

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30004183SMESG000006747.1 SmedASXL_012181SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30004183SMESG000006747.1 SmedASXL_009948SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30004183SMESG000006747.1 dd_Smed_v4_17551_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30004183SMESG000006747.1 dd_Smed_v6_17551_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 129.028 bits (323), Expect = 7.153e-31
Identity = 113/488 (23.16%), Postives = 187/488 (38.32%), Query Frame = 2
Query:  740 EVKLEYFCEKCSRILWNPIKLKCGHIICYTCQP--FPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDN-----IWNLQIYCSTILCDWFGILSNFRS-HFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSC---KFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICS--------FGRKN---------TESLEKQVRSMLEL-------------------------KDKLERSDGKIKILNSEFGTQ----------------------LLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIE 1978
            +++ +Y C  C  +L  P + +CGH  C  C         QN                +E    + DN     + +L   C +  C W G L  + S H   C L   +CP C  +++ G  E H  + C  RS+ C+ C  P    + K+H  VC    + C + C   K P +K +  +             C + +VPC F   GC    + +K   H  ++   HL M+ S         G ++          ESLEK+  +   +                         +DK+E    K++ L    G +                       +WKI +   K Q A+ G    I S  FY T+ YGY+  +R+  N       + +LS+F  +   P + LL WPF  K+ + L++Q + +H+   F P+    ++    RP    N   G   F   +     + +V  +A+FIK +++
Sbjct:   27 KLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTC-DGCGKKKIPREKFQDHV-----------KTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFY-TSRYGYKMCLRIYLNGDGTGRGT-HLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSF---QRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF4 (TNF receptor associated factor 4 [Source:HGNC Symbol;Acc:HGNC:12034])

HSP 1 Score: 127.872 bits (320), Expect = 9.251e-31
Identity = 119/485 (24.54%), Postives = 196/485 (40.41%), Query Frame = 2
Query:  731 FREEVKLEYFCEKCSRILWNPIKLK-CGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYC--STILCDWFGILSNFRSHFETCELKQIKCP-QCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSC--------------------------------------------KFPT---DKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQ-----ISEKHISHCFLPNTIVENYPFINRPKTQRNPY------FGIEKF-ANCNIFHDNSPFVAGNAMFIKILIE-PHEIV 1993
            F E+ K    C  C + +  P+++  CGH  C TC    +     V  CP D+      +I      +  +  L I C  S   C W G L + + H  TC    I CP +C   +   +  AH  + C  R + C+FC      +  +SHE +C  + + C N C                                            + P    ++     + +  L  HL+++C+   V CPF+  GCK++  +  M  H+ +    HL M+C+   +  + L++  R + EL      SDG            L+WKI +   + Q A    N E  S  FY T  YGY+  +    N  N      +LS++I +    F+ LL WPF  ++   L++Q        +H++  F P+   +N+    +P T R         FG  KF ++ +I   N  +V  +A+FI+  +E P +I+
Sbjct:    8 FLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTC--LQEFLSEGVFKCPEDQLPLDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMCALVSRQRQELQELRRELEELSVG---SDGV-----------LIWKIGSYGRRLQEAKAKPNLECFSPAFY-THKYGYKLQVSAFLN-GNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNF---QKPGTWRGSLDESSLGFGYPKFISHQDIRKRN--YVRDDAVFIRAAVELPRKIL 469          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF4 (TNF receptor associated factor 4 [Source:HGNC Symbol;Acc:HGNC:12034])

HSP 1 Score: 111.694 bits (278), Expect = 1.729e-25
Identity = 97/396 (24.49%), Postives = 154/396 (38.89%), Query Frame = 2
Query:  731 FREEVKLEYFCEKCSRILWNPIKLK-CGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYC--STILCDWFGILSNFRSHFETCELKQIKCP-QCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSC--------------------------------------------KFPT---DKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLK 1765
            F E+ K    C  C + +  P+++  CGH  C TC    +     V  CP D+      +I      +  +  L I C  S   C W G L + + H  TC    I CP +C   +   +  AH  + C  R + C+FC      +  +SHE +C  + + C N C                                            + P    ++     + +  L  HL+++C+   V CPF+  GCK++  +  M  H+ +    HL M+C+   +  + L++  R + EL      SDG            L+WKI +   + Q A    N E  S  FY T  YGY+  +    N  N      +LS++I +    F+ LL WPF  +
Sbjct:    8 FLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTC--LQEFLSEGVFKCPEDQLPLDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMCALVSRQRQELQELRRELEELSVG---SDGV-----------LIWKIGSYGRRLQEAKAKPNLECFSPAFY-THKYGYKLQVSAFLN-GNGSGEGTHLSLYIRVLPGAFDNLLEWPFARR 385          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 106.686 bits (265), Expect = 1.190e-23
Identity = 113/464 (24.35%), Postives = 206/464 (44.40%), Query Frame = 2
Query:  710 QTNNQLSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDN-----IWNLQIYCS--TILCDWFGILSNFRSHFET-CELKQIKC--PQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSN--PIFSKNAK--SHENVCDDKLIECPNS--CKF--PTDKTKAMILKQGILKFHLENACSER--------KVPCPFEM---FGCKNKSKQKKMHHHLTKYAIIHLEMICSFGR--KNTESLEKQVR---SMLELKD-KLERSDGKIKIL-NSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQ-ISEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIEPHEI 1990
            Q   +  F + V+ +Y CEKC  +L +P + +CGH  C +C          +L+    + T  ++ I + + +KDN     I  LQIYC   +  C    +L +   H +  C  +++ C  P C E +   +   H    C+ R   C  C +  P+ +       +E+V  +K I+  ++  C F    ++ K M+        HL+     +        K   PF          KS  + + + +T+   +      S G+  +NT  LE Q+     ML + D +L   D + ++L  + +   L+WKI +   + Q A++G    + S PFY T  +GY+   R+  N   +   + +LS+F  I    ++ LLPWPFK K+ + L++Q  S +H+   F P+    N     +P  + N   G   F    +  +N  ++  + +FIK++++  ++
Sbjct:   36 QGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAA-------LLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDK----SAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFY-TGYFGYKMCARVYLNGDGMGKGT-HLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDP---NSSSFKKPTGEMNIASGCPVFVAQTVL-ENGTYIKDDTIFIKVIVDTSDL 482          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 97.8265 bits (242), Expect = 1.063e-20
Identity = 109/474 (23.00%), Postives = 185/474 (39.03%), Query Frame = 2
Query:  674 LSDGFARENEFFQTNNQLSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTILCDWFGILSNFRSHFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMIC----SFGRKNTESLEKQVRSMLE----LKDKLERSDGKIKILNSEFGTQ-----------------------------LLWKIDNINEKYQAALVGANEE---IVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHI--SHCFLPNTIVENYPFINRPKTQRNP-YFGIEKFANCNIFHDNSPFVAGNAMFIK 1966
            LS  F  E + +     + F   ++ +Y C  C   L   ++  CGH  C  C     S ++    CP+D E   E+++      K  I +L + C    C     L +   H   CE   + CPQC    Q  +   H L  C  R V C  C+  +  ++ + H+  C    + C   C          IL +  +  H +  C    +PC F  FGC  K ++  +  HL +    H+ M+     S           +VR+  E    L+ +L R D +I+ L ++  TQ                              +WKI N    +   L    EE   ++ +P + T   GY+  MRL   +   +  + Y+S+F+      ++  LPWPF+  + + +++Q SE  +  +H  + +   E   F  RP   RNP  FG   F +       + F+  + + ++
Sbjct:   45 LSSSFMEEIQGYD----VEFDPPLESKYECPICLMALREAVQTPCGHRFCKAC--IIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVIC-EYCN--------TILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGN----FGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQ-SEAPVRQNHEEIMDAKPELLAF-QRPTIPRNPKGFGYVTFMHLEALRQRT-FIKDDTLLVR 496          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 144.821 bits (364), Expect = 5.544e-37
Identity = 105/436 (24.08%), Postives = 186/436 (42.66%), Query Frame = 2
Query:  713 TNNQLSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQND--VLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCS--TILCDWFGILSNFRSHFETCELKQ-IKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEK----HISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIEPHEIV 1993
            T+  + F+  +  +  C  C + L +PIKL C H  C  C      F+N+     C   +   + +  +     +  I  L + C+  +  C W G L     H   C  K  +KC +C       + E H+   CE+   +C FC+  I   + + H   C   +I CP  C   TD+ +  I        +++N C       PF  +GC     ++ +  HL+   + HL  +C        + E   R M    D+  R     +     FG QL+WKID + ++   A  GA+  I S PF S   +GY+ +M       +   + + +S+++ +    F+  L WPF   + I L++Q        +I++   P  +  N  F+ RP+ +RN  FG + F +  I  +   +V  + ++++I ++  E +
Sbjct:    2 TSQSVMFKGGLPADCTCPICEQALRDPIKLNCDHHYCRQC------FENENRTPGCAACQTIIQPELCQHDRAKQKQILALPVVCTFESSGCPWDGQLGTLHDHLSECTFKSSLKCEKCGRQFAKNDLEKHRAK-CELNRAVCSFCNKTIRDSDRERHPKTCPQVIISCPFQCGL-TDRPRLEIEAHCPSCPNVDNVC-------PFVPYGCTFAGGKESIQQHLSDEPVRHLMYLCDEITDLKGTYELMERDMGSFNDRQTRILSAAETCTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHR-FGYK-MMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCSLAILQN---YVKDDKIYVQIDVDRCETL 417          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 64.3142 bits (155), Expect = 8.666e-11
Identity = 52/234 (22.22%), Postives = 110/234 (47.01%), Query Frame = 2
Query: 1304 VPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDK--LERSDGKIKILN------SEFGTQLLWKIDNIN-EKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLS-SQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILI 1975
            + CPF+  GC  K +  ++  H+     +HL ++C       +SL   +R+ + ++    +++  G ++ ++       ++G+Q  ++I  I     +A    ++  I S PFYS   +GY + M  V   +   L+  +Y S+F+ +    ++ +L WPF+  +   +++   ++ ++     N + E   F+ RP+  RN  FG + F       +   F A   +FI+I +
Sbjct:   84 IDCPFKEHGCHKKGENSEVKRHVRDDRNLHLVLLC-------QSLNP-IRTKINIQQSAYVDKYVGMLQYMSIAESAFEKYGSQHTFRIPKIGLTVVKATKNKSHRSIYSQPFYS---HGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILSDDKKELLTKTIYVNEMPEIQEFLERPEGLRNGTFGFQNFLPLAKVTE---FAADGDIFIQIKV 303          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 121.709 bits (304), Expect = 6.397e-29
Identity = 82/338 (24.26%), Postives = 146/338 (43.20%), Query Frame = 2
Query:  995 SNFRSHFETCELKQIKC-PQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEK---HISHCFLPNTIVENYPFINRPKTQRNPY-FGIEKFANCNIFHDNSPFVAGNAMFIKILIEPHEIV 1993
            +    H  +C  + + C  +C + I  G    HK   C  R   C  C     +     H   C    + CP  C        A  + +G L+ HL + C    V C F+  GC+ K  ++ +  HL   A  HL ++ +   +  + ++     ML+           +  L+  +   LLWKI + + K   A      E+VS PFY T+ YGY+    +  N  N    + ++S++I +    ++ LL WPF   +   L  Q ++     ++  F+P+   EN+    RP  + +   FG  +F +  + H   PF+ G+ +F+++ ++P +IV
Sbjct:  174 AGLEEHNGSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCAHCQREFSADTLPLHAAQCPRAPLACPQRCD-------AGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAHLSLMVALSSRQGQQIQ-----MLK---------SAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPFY-TSQYGYKLQASMFLN-GNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENF---QRPSNEPDQLGFGFPRFISHELLHSR-PFIKGDTVFLRVKVDPSKIV 484          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 121.709 bits (304), Expect = 6.960e-29
Identity = 82/338 (24.26%), Postives = 146/338 (43.20%), Query Frame = 2
Query:  995 SNFRSHFETCELKQIKC-PQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEK---HISHCFLPNTIVENYPFINRPKTQRNPY-FGIEKFANCNIFHDNSPFVAGNAMFIKILIEPHEIV 1993
            +    H  +C  + + C  +C + I  G    HK   C  R   C  C     +     H   C    + CP  C        A  + +G L+ HL + C    V C F+  GC+ K  ++ +  HL   A  HL ++ +   +  + ++     ML+           +  L+  +   LLWKI + + K   A      E+VS PFY T+ YGY+    +  N  N    + ++S++I +    ++ LL WPF   +   L  Q ++     ++  F+P+   EN+    RP  + +   FG  +F +  + H   PF+ G+ +F+++ ++P +IV
Sbjct:  165 AGLEEHNGSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCAHCQREFSADTLPLHAAQCPRAPLACPQRCD-------AGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAHLSLMVALSSRQGQQIQ-----MLK---------SAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPFY-TSQYGYKLQASMFLN-GNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENF---QRPSNEPDQLGFGFPRFISHELLHSR-PFIKGDTVFLRVKVDPSKIV 475          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 134.035 bits (336), Expect = 5.119e-33
Identity = 122/487 (25.05%), Postives = 202/487 (41.48%), Query Frame = 2
Query:  731 FREEVKLEYFCEKCSRILWNPIKLK-CGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYC--STILCDWFGILSNFRSHFETCELKQIKCP-QCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSC--------------------------------------------KFPT---DKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQIS-----EKHISHCFLPNTIVENYPFINRPKTQRNPY------FGIEKFANCNIFHD---NSPFVAGNAMFIKILIE-PHEIV 1993
            F E+ K  + C  CS+ +  P+++  CGH  C TC    +     V  CP D+      +I      +  I  L I C  S   C W G +   +SHF TC    I CP +C   +   +   H  + C  R V C+FC +    +  ++H+ +C  + + C N C                                            +FP    ++     + +  L  H++ +C    V CPF+  GCK++  +  +  HL +    HL M+CS        + +Q + +LEL+ ++E        L+      L+WK+ + + K Q A +  N E  S PFY T  YGY+  +    N  N      +LSI+I +    ++ LL WPF  K+   +++Q        +HI+  F P+   +N+    +P + RN        FG  KF    I H+      ++  N++F+K  IE P +I+
Sbjct:    8 FLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTC--LQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQSHFSTCAFNVIPCPNRCSVKLTRRDLPEHLQHDCPKRKVKCEFCGSEFTGEAYENHQGICPQESVYCENKCGARMMRRLLSQHTMTECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLANHVKESCGSALVLCPFKEAGCKHRCPKMAIGRHLEESTKSHLTMMCSL-------VGRQRQEILELRREMEE-------LSVSHDGVLIWKLTDYSRKLQEAKLRNNHEFFSPPFY-THRYGYKLQVSAFLN-GNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNF---QKPCSSRNSLDESTLGFGYPKF----ISHEEIKKRNYIRDNSIFLKASIEIPQKIM 469          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 134.035 bits (336), Expect = 5.119e-33
Identity = 122/487 (25.05%), Postives = 202/487 (41.48%), Query Frame = 2
Query:  731 FREEVKLEYFCEKCSRILWNPIKLK-CGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYC--STILCDWFGILSNFRSHFETCELKQIKCP-QCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSC--------------------------------------------KFPT---DKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQIS-----EKHISHCFLPNTIVENYPFINRPKTQRNPY------FGIEKFANCNIFHD---NSPFVAGNAMFIKILIE-PHEIV 1993
            F E+ K  + C  CS+ +  P+++  CGH  C TC    +     V  CP D+      +I      +  I  L I C  S   C W G +   +SHF TC    I CP +C   +   +   H  + C  R V C+FC +    +  ++H+ +C  + + C N C                                            +FP    ++     + +  L  H++ +C    V CPF+  GCK++  +  +  HL +    HL M+CS        + +Q + +LEL+ ++E        L+      L+WK+ + + K Q A +  N E  S PFY T  YGY+  +    N  N      +LSI+I +    ++ LL WPF  K+   +++Q        +HI+  F P+   +N+    +P + RN        FG  KF    I H+      ++  N++F+K  IE P +I+
Sbjct:    8 FLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTC--LQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQSHFSTCAFNVIPCPNRCSVKLTRRDLPEHLQHDCPKRKVKCEFCGSEFTGEAYENHQGICPQESVYCENKCGARMMRRLLSQHTMTECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLANHVKESCGSALVLCPFKEAGCKHRCPKMAIGRHLEESTKSHLTMMCSL-------VGRQRQEILELRREMEE-------LSVSHDGVLIWKLTDYSRKLQEAKLRNNHEFFSPPFY-THRYGYKLQVSAFLN-GNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNF---QKPCSSRNSLDESTLGFGYPKF----ISHEEIKKRNYIRDNSIFLKASIEIPQKIM 469          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 112.849 bits (281), Expect = 1.281e-25
Identity = 105/485 (21.65%), Postives = 181/485 (37.32%), Query Frame = 2
Query:  710 QTNNQLSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTILCDWFGILSNFRSHFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNT-------------------------------ESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQ-----------------------------LLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYPFINRPKTQRNP-YFGIEKFANCNIFHDNSPFVAGNAMFIKILIEP 1981
            Q    + F   ++ +Y C  C   L + ++  CGH  C +C     S ++    CP+D E   E+++      K  I +L + CS   C     L     H   C      CPQC E +   + + HK   C  R + C  C+        ++HE  C      C   C+        M L +  L  H +  C +  V C F  FGC+ K  + ++  H+ ++  +H+  +  F R  T                               + L     ++LEL+ +L R D +I+ L     TQ                              +W+++N +   +    G    + S PFY+  P GY+  +RL     +    S ++S+F+      F+  L WP +  + + +++Q+  +H  H  +  T  +   F  RP   RNP  FG   F +         FV  + + ++  + P
Sbjct:   54 QQGYDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSC--IRKSIRDTGQKCPVDNEVLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVC-EYCE--------MELIRDQLALHCDTDCLKAPVACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRP-GYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQH--HIEVMETKPDLQAF-QRPTVMRNPKGFGYVTFLHLQALRQRG-FVKEDVLLVRCEVTP 522          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 112.849 bits (281), Expect = 1.281e-25
Identity = 105/485 (21.65%), Postives = 181/485 (37.32%), Query Frame = 2
Query:  710 QTNNQLSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTILCDWFGILSNFRSHFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNT-------------------------------ESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQ-----------------------------LLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYPFINRPKTQRNP-YFGIEKFANCNIFHDNSPFVAGNAMFIKILIEP 1981
            Q    + F   ++ +Y C  C   L + ++  CGH  C +C     S ++    CP+D E   E+++      K  I +L + CS   C     L     H   C      CPQC E +   + + HK   C  R + C  C+        ++HE  C      C   C+        M L +  L  H +  C +  V C F  FGC+ K  + ++  H+ ++  +H+  +  F R  T                               + L     ++LEL+ +L R D +I+ L     TQ                              +W+++N +   +    G    + S PFY+  P GY+  +RL     +    S ++S+F+      F+  L WP +  + + +++Q+  +H  H  +  T  +   F  RP   RNP  FG   F +         FV  + + ++  + P
Sbjct:   54 QQGYDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSC--IRKSIRDTGQKCPVDNEVLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVC-EYCE--------MELIRDQLALHCDTDCLKAPVACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRP-GYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQH--HIEVMETKPDLQAF-QRPTVMRNPKGFGYVTFLHLQALRQRG-FVKEDVLLVRCEVTP 522          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 112.849 bits (281), Expect = 1.281e-25
Identity = 105/485 (21.65%), Postives = 181/485 (37.32%), Query Frame = 2
Query:  710 QTNNQLSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTILCDWFGILSNFRSHFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNT-------------------------------ESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQ-----------------------------LLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYPFINRPKTQRNP-YFGIEKFANCNIFHDNSPFVAGNAMFIKILIEP 1981
            Q    + F   ++ +Y C  C   L + ++  CGH  C +C     S ++    CP+D E   E+++      K  I +L + CS   C     L     H   C      CPQC E +   + + HK   C  R + C  C+        ++HE  C      C   C+        M L +  L  H +  C +  V C F  FGC+ K  + ++  H+ ++  +H+  +  F R  T                               + L     ++LEL+ +L R D +I+ L     TQ                              +W+++N +   +    G    + S PFY+  P GY+  +RL     +    S ++S+F+      F+  L WP +  + + +++Q+  +H  H  +  T  +   F  RP   RNP  FG   F +         FV  + + ++  + P
Sbjct:   54 QQGYDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSC--IRKSIRDTGQKCPVDNEVLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVC-EYCE--------MELIRDQLALHCDTDCLKAPVACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRP-GYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQH--HIEVMETKPDLQAF-QRPTVMRNPKGFGYVTFLHLQALRQRG-FVKEDVLLVRCEVTP 522          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 135.961 bits (341), Expect = 1.644e-33
Identity = 120/487 (24.64%), Postives = 200/487 (41.07%), Query Frame = 2
Query:  731 FREEVKLEYFCEKCSRILWNPIKLK-CGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYC--STILCDWFGILSNFRSHFETCELKQIKCP-QCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSC--------------------------------------------KFPT---DKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQIS-----EKHISHCFLPNTIVENYPFINRPKTQRNPY------FGIEKFANCNIFHDN---SPFVAGNAMFIKILIE-PHEIV 1993
            F E+++ ++ C  C + +  P+++  CGH  C TC    +     V  CP D+      +I    + +  +  L I C  S   C W G L   + H   C    I CP +C   +   +   H  + C  R V C+FC      +  + H+  C  + + C N C                                            ++PT   ++     + +  L  HL+++CS   V CPF+  GCK++  +  +  HL +    HL M+ S        + +Q + +LEL+ ++E        L+      L+WKI + + K Q A V  N E  S PFY T  YGY+  +    N  N      YLS++I +    ++ LL WPF  ++   L++Q        +HI+  F P+   +N+    +P   RN        FG  KF    I H++     +V  NA+F++  +E P +I+
Sbjct:    8 FLEKLRRKFLCPLCGKAMREPVQVSTCGHRFCDTC--LQEFLSEGVFKCPEDQLPLDYAKIYPDRDLETQVMGLSIRCIHSEEGCRWSGQLKQLQPHLNICAFNVIPCPNRCSTKLIRRDLPEHMQHDCPKRKVRCEFCGADFTGEAYEDHQGCCPQESVYCENKCGARMMRRVLSQHSLVECPKRTQPCPYCNKEFVFDTIQSHQYQCPRYPTPCPNQCGIASIAREDLSNHLKDSCSSALVLCPFKDSGCKHRGPKITISRHLEENMRAHLSMMSSL-------VSRQRQEILELRKQVEE-------LSVSSEGVLIWKISDYSRKVQEAKVRGNFESFSPPFY-THKYGYKLQVSAFLN-GNGSGEGSYLSVYIRVLPGEYDNLLEWPFSYRVTFSLLDQSDPSLSKPQHITETFNPDPNWKNF---QKPTGSRNSLDESTLGFGYPKF----ISHEDIRKRNYVRDNAIFLRASVEIPQKII 469          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 112.464 bits (280), Expect = 1.084e-25
Identity = 105/481 (21.83%), Postives = 184/481 (38.25%), Query Frame = 2
Query:  719 NQLSFREEV---KLE--YFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTIL--CDWFGILSNFRSHFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSC--KFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHL--------------------EMICSF---GRKNT-----------------ESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQL------------LWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIE 1978
            NQ  F++E+   KLE  Y C  C  +L  P++ +CGH  C  C        N ++                   +    W     C  +    DW G L +   H   C      CP C  +I+  N + H    C  R + C++C    +  + K+H+ +C    + C      K P +K +  +                  +PC +   GC    +  K   H  K    HL                    EM+  F    +KNT                  + E+  R +     +LER+ G+ +++ +E  T++            +WKI    +K Q A+ G    + S PFY T  YGY+  +R+  N      ++ +LS+F  +     + LL WPF  K+ + L++Q + +H+   F P+    ++    RP ++ N   G   F   +     + +V  + +F+K++++
Sbjct:   18 NQPGFKKEILGTKLEVKYLCSDCKNLLRRPLQAQCGHRYCSHCL-------NKIIR------------------WVARNWGGVPECPAVCERSDWTGALISV-GHEGKCPYLLAPCPACKTIIRAANRDLHSERECPERKLNCRYCKLSFYFPDIKAHDEICPKFPMTCEGCGRKKIPREKVRLFVC-----------------MPCRYAAVGCTEMVENDKCLEHENKSLAEHLAKGSPAPPANAPPNNSAKVAEMLLKFDTLDKKNTTFENIVSVLNREVERSSHAAEELARQLRAADTRLERTLGQKELIVAELETRMQESELSTYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFY-TNKYGYKMCLRIYLNGDGTGRNT-HLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVSSSSF---QRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIVD 450          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 105.916 bits (263), Expect = 1.947e-23
Identity = 107/499 (21.44%), Postives = 187/499 (37.47%), Query Frame = 2
Query:  719 NQLSFREEV---KLE--YFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTIL--CDWFGILSNFRSHFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSC--KFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSF---GRKN------------------------------------------------TESLEKQVRSMLELKD-------KLERSDGKIKILNSEFGTQL------------LWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIE 1978
            NQ  F++E+   KLE  Y C  C  +L  P++ +CGH  C  C        N ++                   +    W     C  +    DW G L +   H   C      CP C  +I+  N + H    C  R + C++C    +  + K+H+ +C    + C      K P +K +  +       F      S   +PC +   GC    +  K   H  K    HL  +  +   GRK                                                  E L +Q+R+  E  +       +LER+ G+ +++ +E  T++            +WKI    +K Q A+ G    + S PFY T  YGY+  +R+  N      ++ +LS+F  +     + LL WPF  K+ + L++Q + +H+   F P+    ++    RP ++ N   G   F   +     + +V  + +F+K++++
Sbjct:   18 NQPGFKKEILGTKLEVKYLCSDCKNLLRRPLQAQCGHRYCSHCL-------NKIIR------------------WVARNWGGVPECPAVCERSDWTGALISV-GHEGKCPYLLAPCPACKTIIRAANRDLHSERECPERKLNCRYCKLSFYFPDIKAHDEICPKFPMTCEGCGRKKIPREKVRLFVCS-----FSRNITLS---LPCRYAAVGCTEMVENDKCLEHENKSLAEHLAKVWDYIQHGRKEQNDLSVRMGSLSVQGSPAPPFDTLDKKNTTFENIVSVLNREVERSSHAAEELARQLRAAQEKVEALTTKVRQLERTLGQKELIVAELETRMQESELSTYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFY-TNKYGYKMCLRIYLNGDGTGRNT-HLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVSSSSF---QRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIVD 477          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 95.5153 bits (236), Expect = 6.183e-20
Identity = 99/500 (19.80%), Postives = 190/500 (38.00%), Query Frame = 2
Query:  725 LSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTILCDWFGILSNFRSHFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESL-----------------------------------------EKQVRSMLE-LKDKLERSDGKIKILNSEFGTQ-----------------------------LLWKIDNINEKYQAALVGANEE-----IVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYP---FINRPKTQRNP-YFGIEKFANCNIFHDNSPFVAGNAMFIKILIEPH 1984
            + F   ++ +Y C  C   L   ++  CGH  C  C     S ++    CP+D E+  E+++      K  I +L++ C +  C     L +   H   C+   ++C QC       + + HK   C  R + C+ C+  +  ++  +H+  C    + C   C+        +I +Q  +  H    C+   +PC +  FGC  K ++  +  HL ++   H+ M+    R  + S+                                          + +R  +E L+ +L R D +I+ L ++  TQ                              +W+I+N N     +L+   EE     I S  FY+  P GY+  +RL   + + +  + Y+S+F+      ++ LLPWP +  + + +++Q     +        +++  P      RP   RNP  FG   F +         +V  + + ++  +  H
Sbjct:   60 VEFDPPLESKYECPICLMALREAVQTPCGHRFCKAC--ILKSIRDAGHKCPVDNESLMENQLFPDNFAKREILSLRVKCPSQGCTETMELRHLERHLVRCDFAGVECSQCQSSFPKYSLQKHKFEECPRRQIFCENCALAMALEDKLNHDQTCPLAYVTC-EYCQ------TNLIREQ--MPAHYSMDCTMAPIPCMYYEFGCTEKMQRNDLARHLQEFTQAHMRMMAQTLRSFSSSVTPTSHMPDISFCDPSQFEPAPPSVATVHSSHTPSQNDCTQETRNLRETIEQLEGRLVRQDHQIRELIAKMETQCTYVNELKHTIRSLDNRLGEMESQQCSGIFIWRINNFN-----SLLKNQEEERPVVIHSQGFYTGKP-GYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLQGTIRLSILDQSEGVAMQD---QEEVMDTKPELLAFQRPTVARNPKGFGYVTFMHLQALKQRQ-YVKNDTLLVRCSVTTH 538          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 85.8853 bits (211), Expect = 7.199e-17
Identity = 53/195 (27.18%), Postives = 98/195 (50.26%), Query Frame = 2
Query: 1424 NTESLEKQVR---SMLELKD-KLERSDGKIKIL-NSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQI-SEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIEPHEI 1990
            N   LE Q+     ML + D +L   D + ++L  + +   L+WKI +   + Q A++G    + S PFY T  +GY+   R+  N   +   + +LS+F  I    ++ LLPWPFK K+++ L++Q  S +H+   F P+    N     +P  + N   G   F    +  +N  ++  + +FIK++++  ++
Sbjct:  345 NPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFY-TGYFGYKMCARVYLNGDGMGKGT-HLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDP---NSSSFKKPTGEMNIASGCPVFVAQTVL-ENGTYIKDDTIFIKVIVDTSDL 533          

HSP 2 Score: 70.8626 bits (172), Expect = 4.111e-12
Identity = 53/173 (30.64%), Postives = 84/173 (48.55%), Query Frame = 2
Query:  731 FREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDN-----IWNLQIYCS--TILCDWFGILSNFRSHFET-CELKQIKCPQ--CDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENV-CDDKLIECPNSC 1216
            F + V+ +Y CEKC  +L NP + +CGH  C TC        N +L+    +    ED I + + +KDN     +  LQ++C   T  C     L N   H ++ C+ +++ CP+  C E +   +   H   TC+ R   C+FC N +     + HE+V C   +I CP+ C
Sbjct:   38 FLKPVEEKYKCEKCRLVLCNPRQTECGHRFCETC-------MNAILSSTSPQCMACEDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQKHEDVDCPSVVISCPHMC 203          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf4 (TNF receptor associated factor 4 [Source:MGI Symbol;Acc:MGI:1202880])

HSP 1 Score: 131.724 bits (330), Expect = 4.156e-32
Identity = 121/485 (24.95%), Postives = 196/485 (40.41%), Query Frame = 2
Query:  731 FREEVKLEYFCEKCSRILWNPIKLK-CGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYC--STILCDWFGILSNFRSHFETCELKQIKCP-QCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSC--------------------------------------------KFPT---DKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQ-----ISEKHISHCFLPNTIVENYPFINRPKTQRNPY------FGIEKF-ANCNIFHDNSPFVAGNAMFIKILIE-PHEIV 1993
            F E+ K    C  C + +  P+++  CGH  C TC    +     V  CP D+      +I      +  +  L I C  S   C W G L + + H  TC    + CP +C   +   +  AH  + C  R + C+FC      +  +SHE VC  + + C N C                                            + P    ++     + +  L  HL+++CS   V CPF+  GCK++  +  M  H+ +    HL M+C+   +  + L++  R + EL      SDG            L+WKI +   + Q A    N E  S  FY T  YGY+  +    N  N      +LSI+I +    F+ LL WPF  ++   L++Q        +H++  F P+   +N+    +P T R         FG  KF ++ +I   N  +V  +A+FI+  +E P +I+
Sbjct:    8 FLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTC--LQEFLSEGVFKCPEDQLPLDYAKIYPDPELEVQVLGLAIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVVPCPNRCPAKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGVCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCAYCTKEFVYDTIQSHQYQCPRLPVPCPNQCGVGTVAREDLPTHLKDSCSTAFVLCPFKESGCKHRCPKLAMGRHVEESVKPHLAMMCALVSRQRQELQELRRELEELSIG---SDGV-----------LIWKIGSYGRRLQEAKAKPNLECFSPAFY-THKYGYKLQVSAFLN-GNGSGEGTHLSIYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNF---QKPGTWRGSLDESSLGFGYPKFISHQDIRKRN--YVRDDAVFIRASVELPRKIL 469          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 110.923 bits (276), Expect = 3.724e-25
Identity = 117/523 (22.37%), Postives = 191/523 (36.52%), Query Frame = 2
Query:  632 ISARNYSKEERVIILSDGFARENEFFQTNNQLSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQP--FPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDN-----IWNLQIYCSTILCDWFGILSNFRS-HFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFP--TDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQ--------KKMHHHLTKYAIIHLEMICSFGRKN---------TESLEKQVRSMLEL-------------------------KDKLERSDGKIKILNSEFGTQ----------------------LLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIE 1978
            ++A + +    + +L  GF++          L  R E K  Y C  C  IL  P + +CGH  C  C         QN                +E    + DN     + +L   C    C W G L  + S H   C     +CP C  +++    E H    C  RS+ CQ C  P    + + H  VC           KFP   D      + +   + H+  ACS+ +V C F   GC    +         +++  HL       LE   S G  N          + LE+++ +   +                         +DK+E    K++ L    G +                       +WKI +   K Q A+ G    I S  FY T+ YGY+  +R+  N       + +LS+F  +   P + LL WPF  K+ + L++  + +H+   F P+    ++    RP +  N   G   F   +     + +V  +A+FIK +++
Sbjct:    1 MAAASVTSPGSLELLQPGFSK--------TLLGTRLEAK--YLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCP----------KFPLTCDGCGKKKIPRETFQDHV-RACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFY-TSRYGYKMCLRVYLNGDGTGRGT-HLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSF---QRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 110.923 bits (276), Expect = 4.086e-25
Identity = 117/537 (21.79%), Postives = 193/537 (35.94%), Query Frame = 2
Query:  632 ISARNYSKEERVIILSDGFARENEFFQTNNQLSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQC----------------ENYKDN-----IWNLQIYCSTILCDWFGILSNFRS-HFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFP--TDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQ--------KKMHHHLTKYAIIHLEMICSFGRKNT---------ESLEKQVRSMLEL-------------------------KDKLERSDGKIKILNSEFGTQ----------------------LLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIE 1978
            ++A + +    + +L  GF++          L  R E K  Y C  C  IL  P + +CGH  C  C          +L C     ++       C                  + DN     + +L   C    C W G L  + S H   C     +CP C  +++    E H    C  RS+ CQ C  P    + + H  VC           KFP   D      + +   + H+  ACS+ +V C F   GC    +         +++  HL       LE   S G  N          + LE+++ +   +                         +DK+E    K++ L    G +                       +WKI +   K Q A+ G    I S  FY T+ YGY+  +R+  N       + +LS+F  +   P + LL WPF  K+ + L++  + +H+   F P+    ++    RP +  N   G   F   +     + +V  +A+FIK +++
Sbjct:    1 MAAASVTSPGSLELLQPGFSK--------TLLGTRLEAK--YLCSACKNILRRPFQAQCGHRYCSFCL-------TSILRCASILSSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCP----------KFPLTCDGCGKKKIPRETFQDHV-RACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFY-TSRYGYKMCLRVYLNGDGTGRGT-HLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSF---QRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 504          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 97.8265 bits (242), Expect = 9.336e-21
Identity = 106/482 (21.99%), Postives = 187/482 (38.80%), Query Frame = 2
Query:  674 LSDGFARENEFFQTNNQLSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTILCDWFGILSNFRSHFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMIC--------SFGRKNTESLEKQVR--------SMLELKDKLERSDGKIKILNSEFGTQ-----------------------------LLWKIDNINEKYQAALVGANEE---IVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHI--SHCFLPNTIVENYPFINRPKTQRNP-YFGIEKFANCNIFHDNSPFVAGNAMFIK 1966
            LS  F  E + +     + F   ++ +Y C  C   L   ++  CGH  C  C     S ++    CP+D E   E+++      K  I +L + C    C     L +   H   CE   + CPQC    Q      H +  C  R V C  C+  +  +  + H+  C    I C         +    IL +  +  H +  C    +PC F +FGC  K ++  +  HL +   +H+ ++         +    +  S  +  R        ++ +L+ +L R D +I+ L ++  TQ                              +WKI N    +   L    EE   ++ +P + T   GY+  MRL   +   +  + Y+S+F+      ++  LPWPF+  + + +++Q SE  I  +H  + +   E   F  RP   RNP  FG   F +       + F+  + + ++
Sbjct:   45 LSSSFMEEIQGYD----VEFDPPLESKYECPICLMALREAVQTPCGHRFCKAC--IIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIEDCPRRQVSCVNCAVSMAYEEKEIHDQSCPLANIIC---------EYCGTILIREQMPNHYDLDCPTAPIPCTFSVFGCHEKMQRNHLARHLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPEDPNYEETIKQLESRLVRQDHQIRELTAKMETQSMYVGELKRTIRTLEDKVAEMEAQQCNGIYIWKIGN----FGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQ-SEALIRQNHEEVMDAKPELLAF-QRPTIPRNPKGFGYVTFMHLEALRQGT-FIKDDTLLVR 504          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 92.0485 bits (227), Expect = 5.546e-19
Identity = 114/531 (21.47%), Postives = 200/531 (37.66%), Query Frame = 2
Query:  707 FQTNNQLSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDN-----IWNLQIYCSTI-LCDWFGILSNFRSHFETCELKQIKCPQ-----------------------------CDEMIQWGNFEAHKLNTCEMRSVLC-QFCSNPIFSKNAKSHENVCDDKLIECP---NSCKFPTDKTKAMILKQGILKFHL-----ENACSERKVPCPFEMFGCKNK-SKQKKMHHHLTK--------YAIIHLEMICSFGRKNTESLEKQVRSMLELKDK-----------------------LERSDGKIKILNSE-----------------------------FGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEK-HISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDN-SPFVAGNAMFIKILIE 1978
            F+ + +  F E+++  Y C  C  +L NP +  CGH  C  C        N V  CP+D+E  K       E +KDN     + NL +YC     C+   IL  F+ H + C  + + CP                              C   I   N + H+ N+C    V C   C   I       H  VC +   +CP     C     +   +  ++  L+ H+     +N   E++V         K K +       H T         ++ ++ + + S   K+   LE QVR +L++ ++                       LE SD ++ +L  E                             +  +L+WK+ +   K + A+ G    + S PFY T+  GYR   R   N       + +LS++  +    F+ LL WPF+ ++ + L++Q  +K HI   F  +    N     RP  + N   G  +F + +   ++ + ++  + +F+K+ ++
Sbjct:   27 FEPDTEYQFVEQLEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLREL-NSVPICPVDKEVIKPQ-----EVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNLQDHEENSCPAYPVSCPNRCVQTIPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHMLLVLEKNYQLEQRVNALLSSLERKKKMAAADSAIQHATNPMSRFQDIFSFLYRKALTSHTDKSA-WLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFY-TSRCGYRLCARAYLNGDGSGKGT-HLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADP---NSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVD 545          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q61382|TRAF4_MOUSE (TNF receptor-associated factor 4 OS=Mus musculus OX=10090 GN=Traf4 PE=1 SV=2)

HSP 1 Score: 131.724 bits (330), Expect = 2.907e-31
Identity = 121/485 (24.95%), Postives = 196/485 (40.41%), Query Frame = 2
Query:  731 FREEVKLEYFCEKCSRILWNPIKLK-CGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYC--STILCDWFGILSNFRSHFETCELKQIKCP-QCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSC--------------------------------------------KFPT---DKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQ-----ISEKHISHCFLPNTIVENYPFINRPKTQRNPY------FGIEKF-ANCNIFHDNSPFVAGNAMFIKILIE-PHEIV 1993
            F E+ K    C  C + +  P+++  CGH  C TC    +     V  CP D+      +I      +  +  L I C  S   C W G L + + H  TC    + CP +C   +   +  AH  + C  R + C+FC      +  +SHE VC  + + C N C                                            + P    ++     + +  L  HL+++CS   V CPF+  GCK++  +  M  H+ +    HL M+C+   +  + L++  R + EL      SDG            L+WKI +   + Q A    N E  S  FY T  YGY+  +    N  N      +LSI+I +    F+ LL WPF  ++   L++Q        +H++  F P+   +N+    +P T R         FG  KF ++ +I   N  +V  +A+FI+  +E P +I+
Sbjct:    8 FLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTC--LQEFLSEGVFKCPEDQLPLDYAKIYPDPELEVQVLGLAIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVVPCPNRCPAKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGVCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCAYCTKEFVYDTIQSHQYQCPRLPVPCPNQCGVGTVAREDLPTHLKDSCSTAFVLCPFKESGCKHRCPKLAMGRHVEESVKPHLAMMCALVSRQRQELQELRRELEELSIG---SDGV-----------LIWKIGSYGRRLQEAKAKPNLECFSPAFY-THKYGYKLQVSAFLN-GNGSGEGTHLSIYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNF---QKPGTWRGSLDESSLGFGYPKFISHQDIRKRN--YVRDDAVFIRASVELPRKIL 469          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q12933|TRAF2_HUMAN (TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2)

HSP 1 Score: 129.028 bits (323), Expect = 3.435e-30
Identity = 113/488 (23.16%), Postives = 187/488 (38.32%), Query Frame = 2
Query:  740 EVKLEYFCEKCSRILWNPIKLKCGHIICYTCQP--FPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDN-----IWNLQIYCSTILCDWFGILSNFRS-HFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSC---KFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICS--------FGRKN---------TESLEKQVRSMLEL-------------------------KDKLERSDGKIKILNSEFGTQ----------------------LLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIE 1978
            +++ +Y C  C  +L  P + +CGH  C  C         QN                +E    + DN     + +L   C +  C W G L  + S H   C L   +CP C  +++ G  E H  + C  RS+ C+ C  P    + K+H  VC    + C + C   K P +K +  +             C + +VPC F   GC    + +K   H  ++   HL M+ S         G ++          ESLEK+  +   +                         +DK+E    K++ L    G +                       +WKI +   K Q A+ G    I S  FY T+ YGY+  +R+  N       + +LS+F  +   P + LL WPF  K+ + L++Q + +H+   F P+    ++    RP    N   G   F   +     + +V  +A+FIK +++
Sbjct:   27 KLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTC-DGCGKKKIPREKFQDHV-----------KTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFY-TSRYGYKMCLRIYLNGDGTGRGT-HLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSF---QRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q9BUZ4|TRAF4_HUMAN (TNF receptor-associated factor 4 OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 4.442e-30
Identity = 119/485 (24.54%), Postives = 196/485 (40.41%), Query Frame = 2
Query:  731 FREEVKLEYFCEKCSRILWNPIKLK-CGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYC--STILCDWFGILSNFRSHFETCELKQIKCP-QCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSC--------------------------------------------KFPT---DKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQ-----ISEKHISHCFLPNTIVENYPFINRPKTQRNPY------FGIEKF-ANCNIFHDNSPFVAGNAMFIKILIE-PHEIV 1993
            F E+ K    C  C + +  P+++  CGH  C TC    +     V  CP D+      +I      +  +  L I C  S   C W G L + + H  TC    I CP +C   +   +  AH  + C  R + C+FC      +  +SHE +C  + + C N C                                            + P    ++     + +  L  HL+++C+   V CPF+  GCK++  +  M  H+ +    HL M+C+   +  + L++  R + EL      SDG            L+WKI +   + Q A    N E  S  FY T  YGY+  +    N  N      +LS++I +    F+ LL WPF  ++   L++Q        +H++  F P+   +N+    +P T R         FG  KF ++ +I   N  +V  +A+FI+  +E P +I+
Sbjct:    8 FLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTC--LQEFLSEGVFKCPEDQLPLDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMCALVSRQRQELQELRRELEELSVG---SDGV-----------LIWKIGSYGRRLQEAKAKPNLECFSPAFY-THKYGYKLQVSAFLN-GNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNF---QKPGTWRGSLDESSLGFGYPKFISHQDIRKRN--YVRDDAVFIRAAVELPRKIL 469          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q6IWL4|TRAF6_DANRE (TNF receptor-associated factor 6 OS=Danio rerio OX=7955 GN=traf6 PE=1 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 9.672e-25
Identity = 105/485 (21.65%), Postives = 181/485 (37.32%), Query Frame = 2
Query:  710 QTNNQLSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTILCDWFGILSNFRSHFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNT-------------------------------ESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQ-----------------------------LLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYPFINRPKTQRNP-YFGIEKFANCNIFHDNSPFVAGNAMFIKILIEP 1981
            Q    + F   ++ +Y C  C   L + ++  CGH  C +C     S ++    CP+D E   E+++      K  I +L + CS   C     L     H   C      CPQC E +   + + HK   C  R + C  C+        ++HE  C      C   C+        M L +  L  H +  C +  V C F  FGC+ K  + ++  H+ ++  +H+  +  F R  T                               + L     ++LEL+ +L R D +I+ L     TQ                              +W+++N +   +    G    + S PFY+  P GY+  +RL     +    S ++S+F+      F+  L WP +  + + +++Q+  +H  H  +  T  +   F  RP   RNP  FG   F +         FV  + + ++  + P
Sbjct:   54 QQGYDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSC--IRKSIRDTGQKCPVDNEVLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVC-EYCE--------MELIRDQLALHCDTDCLKAPVACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRP-GYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQH--HIEVMETKPDLQAF-QRPTVMRNPKGFGYVTFLHLQALRQRG-FVKEDVLLVRCEVTP 522          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 2.605e-24
Identity = 117/523 (22.37%), Postives = 191/523 (36.52%), Query Frame = 2
Query:  632 ISARNYSKEERVIILSDGFARENEFFQTNNQLSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQP--FPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDN-----IWNLQIYCSTILCDWFGILSNFRS-HFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFP--TDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQ--------KKMHHHLTKYAIIHLEMICSFGRKN---------TESLEKQVRSMLEL-------------------------KDKLERSDGKIKILNSEFGTQ----------------------LLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIE 1978
            ++A + +    + +L  GF++          L  R E K  Y C  C  IL  P + +CGH  C  C         QN                +E    + DN     + +L   C    C W G L  + S H   C     +CP C  +++    E H    C  RS+ CQ C  P    + + H  VC           KFP   D      + +   + H+  ACS+ +V C F   GC    +         +++  HL       LE   S G  N          + LE+++ +   +                         +DK+E    K++ L    G +                       +WKI +   K Q A+ G    I S  FY T+ YGY+  +R+  N       + +LS+F  +   P + LL WPF  K+ + L++  + +H+   F P+    ++    RP +  N   G   F   +     + +V  +A+FIK +++
Sbjct:    1 MAAASVTSPGSLELLQPGFSK--------TLLGTRLEAK--YLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCP----------KFPLTCDGCGKKKIPRETFQDHV-RACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFY-TSRYGYKMCLRVYLNGDGTGRGT-HLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSF---QRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A1I8J068 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 7.904e-60
Identity = 131/424 (30.90%), Postives = 217/424 (51.18%), Query Frame = 2
Query:  731 FREEVKLEYFCEKCSRILWNPIKLK-CGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTI--LCDWFGILSNFRSHFETCELKQIKCP-QCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQI----SEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIE 1978
            F E +  +Y C  C ++L  P++ + CGH  C +C   PD  +     CPID++T  +D++   + ++    +L + CS     C+W G+LS   SH E C+     CP +C    Q    E H+L  C  R + CQFC   + ++    H   C   L+ CPN CK      K  + ++ +++ HLEN C  + + CPF  +GC    ++K++  H+ +  + H+E++CS  ++  ++ EKQ + +LE++ KL   + ++  L + FG QL+W+IDN  EK   A  G    I S PF  T  +GY+  +       + K   QY+S+F  IC    + LL WPF  KL   L++Q     + K+I +   PN   EN PF+ RP  +RN  FG  +FA  +       ++  + M++K+ ++
Sbjct:   50 FLESLDKKYECPVCGQVLRYPVQFEECGHRCCSSC--LPDLLRV-APRCPIDQQTIDKDKVYADKAFQKETDSLGVKCSFFERGCNWTGVLSELMSHIEGCDRMLTTCPMRCGVEFQKRFLEKHRLEDCPKRDIQCQFCEIGLVAEQEAGHLETCPKFLVPCPNKCK------KKEVARE-MMQEHLENECMRQDLCCPFSTYGCDFSGRKKQLKEHIAEKQLNHMEILCSAVKQGDKNQEKQQKQILEMEKKLVGVERRVGGLENLFGPQLVWRIDNYQEKLAEAKAGKKATIFSPPFL-TNRHGYKLALSACL-YGDGKFRGQYMSLFACICKGENDALLAWPFAYKLTFQLIDQCEDVSARKNIVYTVTPNPCKENRPFLGRPLGERNASFGAARFAELDAI-GKLDYIKDDTMYVKVTVD 460          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A267F122 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023102g1 PE=4 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 9.928e-60
Identity = 130/424 (30.66%), Postives = 215/424 (50.71%), Query Frame = 2
Query:  731 FREEVKLEYFCEKCSRILWNPIKLK-CGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTI--LCDWFGILSNFRSHFETCELKQIKCP-QCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQI----SEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIE 1978
            F E +  +Y C  C ++L  P++ + CGH  C +C P           CPID++T  +D++   + ++    +L + CS     C+W G+LS   SH E C+     CP +C    Q    E H+L  C  R + CQFC   + ++    H   C   L+ CPN CK      K  + ++ +++ HLEN C  + + CPF  +GC    ++K++  H+ +  + H+E++CS  ++  ++ EKQ + +LE++ KL   + ++  L + FG QL+W+IDN  EK   A  G    I S PF  T  +GY+  +       + K   QY+S+F  IC    + LL WPF  KL   L++Q     + K+I +   PN   EN PF+ RP  +RN  FG  +FA  +       ++  + M++K+ ++
Sbjct:   31 FLESLDKKYECPVCGQVLRYPVQFEECGHRCCSSCLP---DLLRVAPRCPIDQQTIDKDKVYADKAFQKETDSLGVKCSFFERGCNWTGVLSELMSHIEGCDRMLTTCPMRCGVEFQKRFLEKHRLEDCPKRDIQCQFCEIGLVAEQEAGHLETCTKFLVPCPNKCK------KKEVARE-MMQEHLENECMRQDLCCPFSTYGCDFSGRKKQLKEHIAEKQLNHMEILCSAVKQGDKNQEKQQKQILEMEKKLVGVERRVGGLENLFGPQLVWRIDNYQEKLAEAKAGKKATIFSPPFL-TNRHGYKLALSACL-YGDGKFRGQYMSLFACICKGENDALLAWPFAYKLTFQLIDQCEDVSARKNIVYTVTPNPCKENRPFLGRPLGERNASFGAARFAELDAI-GKLDYIKDDTMYVKVTVD 441          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A267DCA2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023102g3 PE=4 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 1.009e-59
Identity = 130/424 (30.66%), Postives = 215/424 (50.71%), Query Frame = 2
Query:  731 FREEVKLEYFCEKCSRILWNPIKLK-CGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTI--LCDWFGILSNFRSHFETCELKQIKCP-QCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQI----SEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIE 1978
            F E +  +Y C  C ++L  P++ + CGH  C +C P           CPID++T  +D++   + ++    +L + CS     C+W G+LS   SH E C+     CP +C    Q    E H+L  C  R + CQFC   + ++    H   C   L+ CPN CK      K  + ++ +++ HLEN C  + + CPF  +GC    ++K++  H+ +  + H+E++CS  ++  ++ EKQ + +LE++ KL   + ++  L + FG QL+W+IDN  EK   A  G    I S PF  T  +GY+  +       + K   QY+S+F  IC    + LL WPF  KL   L++Q     + K+I +   PN   EN PF+ RP  +RN  FG  +FA  +       ++  + M++K+ ++
Sbjct:   50 FLESLDKKYECPVCGQVLRYPVQFEECGHRCCSSCLP---DLLRVAPRCPIDQQTIDKDKVYADKAFQKETDSLGVKCSFFERGCNWTGVLSELMSHIEGCDRMLTTCPMRCGVEFQKRFLEKHRLEDCPKRDIQCQFCEIGLVAEQEAGHLETCPKFLVPCPNKCK------KKEVARE-MMQEHLENECMRQDLCCPFSTYGCDFSGRKKQLKEHIAEKQLNHMEILCSAVKQGDKNQEKQQKQILEMEKKLVGVERRVGGLENLFGPQLVWRIDNYQEKLAEAKAGKKATIFSPPFL-TNRHGYKLALSACL-YGDGKFRGQYMSLFACICKGENDALLAWPFAYKLTFQLIDQCEDVSARKNIVYTVTPNPCKENRPFLGRPLGERNASFGAARFAELDAI-GKLDYIKDDTMYVKVTVD 460          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A1I8G0B1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 1.227e-59
Identity = 131/424 (30.90%), Postives = 217/424 (51.18%), Query Frame = 2
Query:  731 FREEVKLEYFCEKCSRILWNPIKLK-CGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTI--LCDWFGILSNFRSHFETCELKQIKCP-QCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQI----SEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIE 1978
            F E +  +Y C  C ++L  P++ + CGH  C +C   PD  +     CPID++T  +D++   + ++    +L + CS     C+W G+LS   SH E C+     CP +C    Q    E H+L  C  R + CQFC   + ++    H   C   L+ CPN CK      K  + ++ +++ HLEN C  + + CPF  +GC+   ++K++  H+ +  + H+E++CS  ++  ++ EKQ + +LE++ KL   + ++  L + FG QL+W+IDN  EK   A  G    I S PF  T  +GY+  +       + K   QY+S+F  IC    + LL WPF  KL   L++Q     + K+I +   PN   EN PF+ RP  +RN  FG  +FA          ++  + M++K+ ++
Sbjct:   50 FLESLDKKYECPVCGQVLRYPVQFEECGHRCCSSC--LPDLLRV-APRCPIDQQTIDKDKVYADKAFQKETDSLGVKCSFFERGCNWTGVLSELMSHIEGCDRMLTTCPMRCGVEFQKRFLEKHRLEDCPKRDIQCQFCEIGLVAEQEAGHLETCPKFLVPCPNKCK------KKEVARE-MMQEHLENECMRQDLCCPFSTYGCEFSGRKKQLKEHIAEKQLNHMEILCSAVKQGDKNQEKQQKQILEMEKKLVGVERRVGGLENLFGPQLVWRIDNYQEKLAEAKAGKKATIFSPPFL-TNRHGYKLALSACL-YGDGKFRGQYMSLFACICKGENDALLAWPFAYKLTFQLIDQCEDVSARKNIVYTVTPNPCKENRPFLGRPLGERNASFGAARFAELEAI-GKLDYIKDDTMYVKVTVD 460          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A267DKH1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023102g2 PE=4 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 1.473e-59
Identity = 130/424 (30.66%), Postives = 215/424 (50.71%), Query Frame = 2
Query:  731 FREEVKLEYFCEKCSRILWNPIKLK-CGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTI--LCDWFGILSNFRSHFETCELKQIKCP-QCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQI----SEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIE 1978
            F E +  +Y C  C ++L  P++ + CGH  C +C P           CPID++T  +D++   + ++    +L + CS     C+W G+LS   SH E C+     CP +C    Q    E H+L  C  R + CQFC   + ++    H   C   L+ CPN CK      K  + ++ +++ HLEN C  + + CPF  +GC+   ++K++  H+ +  + H+E++CS  ++  ++ EKQ + +LE++ KL   + ++  L + FG QL+W+IDN  EK   A  G    I S PF  T  +GY+  +       + K   QY+S+F  IC    + LL WPF  KL   L++Q     + K+I +   PN   EN PF+ RP  +RN  FG  +FA          ++  + M++K+ ++
Sbjct:   50 FLESLDKKYECPVCGQVLRYPVQFEECGHRCCSSCLP---DLLRVAPRCPIDQQTIDKDKVYADKAFQKETDSLGVKCSFFERGCNWTGVLSELMSHIEGCDRMLTTCPMRCGVEFQKRFLEKHRLEDCPKRDIQCQFCEIGLVAEQEAGHLETCPKFLVPCPNKCK------KKEVARE-MMQEHLENECMRQDLCCPFSTYGCEFSGRKKQLKEHIAEKQLNHMEILCSAVKQGDKNQEKQQKQILEMEKKLVGVERRVGGLENLFGPQLVWRIDNYQEKLAEAKAGKKATIFSPPFL-TNRHGYKLALSACL-YGDGKFRGQYMSLFACICKGENDALLAWPFAYKLTFQLIDQCEDVSARKNIVYTVTPNPCKENRPFLGRPLGERNASFGAARFAELEAI-GKLDYIKDDTMYVKVTVD 460          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:103024022])

HSP 1 Score: 136.346 bits (342), Expect = 8.903e-34
Identity = 122/487 (25.05%), Postives = 202/487 (41.48%), Query Frame = 2
Query:  731 FREEVKLEYFCEKCSRILWNPIKLK-CGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYC--STILCDWFGILSNFRSHFETCELKQIKCP-QCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSC--------------------------------------------KFPT---DKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQIS-----EKHISHCFLPNTIVENYPFINRPKTQRNPY------FGIEKFANCNIFHD---NSPFVAGNAMFIKILIE-PHEIV 1993
            F E+ K  + C  CS+ +  P+++  CGH  C TC    +     V  CP D+      +I      +  I  L I C  S   C W G +   + HF TC    I CP +C   +   +   H  + C  R V C+FC +    +  ++H+ +C  + + C N C                                            +FP    ++     + +  L  H++ +C    V CPF+  GCK++  +  +  HL +    HL M+CS        + +Q + ++EL+ ++E        L+      L+WK+++ + K Q A +  N E  S PFY T  YGY+  +    N  N      +LSI+I +    ++ LL WPF  K+   +++Q        +HI+  F P+   +N+    +P + RN        FG  KF    I HD      ++  NA+F+K  IE P +I+
Sbjct:    8 FLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTC--LQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCAVKLTRRDLPEHLQHDCPKRKVKCEFCGSEFTGEAFENHQGICPQESVYCENKCGARMMRRLLAQHTMAECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLATHVKESCGSALVLCPFKDAGCKHRCPKLAIGRHLEETTKSHLTMMCSL-------VGRQRQEIIELRREMEE-------LSVSHDGVLIWKLNDYSRKLQEAKLHNNHEFFSPPFY-THRYGYKLQVSAFLN-GNGSGEGSHLSIYIRVLPGEYDNLLEWPFAYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNF---QKPSSSRNSLDESTLGFGYPKF----ISHDEIRKRNYIRDNAIFLKASIEIPQKIM 469          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 116.316 bits (290), Expect = 3.618e-27
Identity = 99/467 (21.20%), Postives = 176/467 (37.69%), Query Frame = 2
Query:  752 EYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTILCDWFGILSNFRS-HFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSC--KFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELK---------------------------------DKLERSDGKIKILNSEFGTQ----------------------LLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIE 1978
            ++ C  C +IL  P + +CGH        FPD+                          K  +  L+  C    C W G +  + + H   C+   I CP C E+++    E H    C  R++ C++C  P   KN K+H+ +C    + C      K P +K    I             C++ + PC F + GC     + + +  LT   +++        +     L ++ +  LELK                                 DK+E  + K++ L    G +                       +WKI + ++K Q A+ G    + S  FY T+ YGY+  +R+  N       + +LS+F  +     + LL WPF  K+ + L++Q + +HI   F P+    ++    RP +  N   G   F   +     + ++  + +FIK +++
Sbjct:   31 KHLCNICQKILRRPFQAQCGHRF-SPASAFPDNAA------------------------KREVEALEAVCINEGCSWTGTIKEYEATHEGQCDFMIIPCPSCKELLRANELERHNERECPERTLNCKYCKEPFHFKNIKAHDEICPKYPMICEGCAKKKIPREKYVDHI-----------KLCTKFRTPCRFHVVGCDMSVSKPQWNLILTPRDLLYTSFTVPLSQTKVAELSRRCQE-LELKVGTFENIVCVLNREMERSATTMEAYNRQHRLDQDKIEILNNKVRQLERTVGLRDLSIVEMEGKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFY-TSKYGYKMCLRIYLNGDGTGRGT-HLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRPDISSSSF---QRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 455          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 115.931 bits (289), Expect = 1.065e-26
Identity = 108/486 (22.22%), Postives = 186/486 (38.27%), Query Frame = 2
Query:  710 QTNNQLSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTILCDWFGILSNFRSHFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNT--------------------------------ESLEKQVRSMLELKDKLERSDGKIK---ILNSEFGTQL--------------------------LWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYPFINRPKTQRNP-YFGIEKFANCNIFHDNSPFVAGNAMFIKILIEP 1981
            Q    + F   ++ +Y C  C   L + ++  CGH  C  C     S ++    CP+D E   ED++      K  I +L + C  + C     L +  +H   C+   + CPQC E +     E H    C  R + C  C+  I     + HE +C    +     C++       M L +  L  H +  C +  V C F +FGC+ K  +  +  H+ ++  +H+  +    R  T                                + L++   ++LEL+ +L R D K++   I N    TQ+                          +W+++  +   +    G    + S PFY+  P GY+  +RL     N    S Y+S+F+      F+  L WP +  + + +++Q   +H  H  +  T  +   F  RP  QRNP  FG   F      H    FV  + + ++  + P
Sbjct:   53 QQGYDVDFDPPLESKYECPICLMGLRSAVQTPCGHRFCNCC--IRKSIRDTGQKCPVDNEVLTEDQLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCPQCQESVWKSELEEHINQECSHRLITCPDCAENIIYAEKQFHEQLC----LFANTVCEYCN-----MELIRNQLASHCDTDCLKAPVACTFSIFGCREKMLRNDLALHMQEFTQMHMRYMADVLRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQQMRETVLELESRLVRQDHKLRELSIRNETQSTQMTELRKKLASLEESMRELQAQQYQGVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRP-GYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQH--HVEVMETKPDLQAF-QRPTVQRNPKGFGYVTFMQLQALHQRG-FVRDDVLMVRCEVTP 522          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 115.931 bits (289), Expect = 1.065e-26
Identity = 108/486 (22.22%), Postives = 186/486 (38.27%), Query Frame = 2
Query:  710 QTNNQLSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTILCDWFGILSNFRSHFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNT--------------------------------ESLEKQVRSMLELKDKLERSDGKIK---ILNSEFGTQL--------------------------LWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYPFINRPKTQRNP-YFGIEKFANCNIFHDNSPFVAGNAMFIKILIEP 1981
            Q    + F   ++ +Y C  C   L + ++  CGH  C  C     S ++    CP+D E   ED++      K  I +L + C  + C     L +  +H   C+   + CPQC E +     E H    C  R + C  C+  I     + HE +C    +     C++       M L +  L  H +  C +  V C F +FGC+ K  +  +  H+ ++  +H+  +    R  T                                + L++   ++LEL+ +L R D K++   I N    TQ+                          +W+++  +   +    G    + S PFY+  P GY+  +RL     N    S Y+S+F+      F+  L WP +  + + +++Q   +H  H  +  T  +   F  RP  QRNP  FG   F      H    FV  + + ++  + P
Sbjct:   53 QQGYDVDFDPPLESKYECPICLMGLRSAVQTPCGHRFCNCC--IRKSIRDTGQKCPVDNEVLTEDQLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCPQCQESVWKSELEEHINQECSHRLITCPDCAENIIYAEKQFHEQLC----LFANTVCEYCN-----MELIRNQLASHCDTDCLKAPVACTFSIFGCREKMLRNDLALHMQEFTQMHMRYMADVLRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQQMRETVLELESRLVRQDHKLRELSIRNETQSTQMTELRKKLASLEESMRELQAQQYQGVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRP-GYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQH--HVEVMETKPDLQAF-QRPTVQRNPKGFGYVTFMQLQALHQRG-FVRDDVLMVRCEVTP 522          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 105.916 bits (263), Expect = 1.421e-23
Identity = 106/486 (21.81%), Postives = 182/486 (37.45%), Query Frame = 2
Query:  710 QTNNQLSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTILCDWFGILSNFRSHFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNT--------------------------------ESLEKQVRSMLELKDKLERSDGKIK---ILNSEFGTQL--------------------------LWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYPFINRPKTQRNP-YFGIEKFANCNIFHDNSPFVAGNAMFIKILIEP 1981
            Q    + F   ++ +Y C  C   L + ++  CGH  C  C     S ++    CP+D E   ED++      K  I +L + C  + C     L +  +H   C+   + CPQC E +     E H          + Q CS+                +LI CP       D  + +I  +  L  H +  C +  V C F +FGC+ K  +  +  H+ ++  +H+  +    R  T                                + L++   ++LEL+ +L R D K++   I N    TQ+                          +W+++  +   +    G    + S PFY+  P GY+  +RL     N    S Y+S+F+      F+  L WP +  + + +++Q   +H  H  +  T  +   F  RP  QRNP  FG   F      H    FV  + + ++  + P
Sbjct:   53 QQGYDVDFDPPLESKYECPICLMGLRSAVQTPCGHRFCNCC--IRKSIRDTGQKCPVDNEVLTEDQLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCPQCQESVWKSELEEH----------INQECSH----------------RLITCP-------DCAENIIYAEKQLASHCDTDCLKAPVACTFSIFGCREKMLRNDLALHMQEFTQMHMRYMADVLRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQQMRETVLELESRLVRQDHKLRELSIRNETQSTQMTELRKKLASLEESMRELQAQQYQGVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRP-GYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQH--HVEVMETKPDLQAF-QRPTVQRNPKGFGYVTFMQLQALHQRG-FVRDDVLMVRCEVTP 498          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.2705 bits (212), Expect = 4.714e-18
Identity = 45/174 (25.86%), Postives = 93/174 (53.45%), Query Frame = 2
Query: 1475 KLERSDGKIKIL-NSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQ-ISEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIEPHEI 1990
            +L   D + ++L  + +  +L+WKI +   + Q A+ G    + S PFY T+P+GYR   R   N   V   + +LS+F  +    ++ LLPWPF+ ++ + L++Q  + + +S  F P+    ++    RP +  N   G   F + ++  +++ ++  + +FIK++++  E+
Sbjct:  307 RLAEMDLRFQVLETASYNGKLVWKIRDYARRKQDAVSGRTLSLYSQPFY-TSPFGYRMCARAYLNGDGVGRGT-HLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPDPASSSF---RRPTSDMNIASGCPLFVS-HVALESASYLQDDTIFIKVVVDTGEL 474          

HSP 2 Score: 59.6918 bits (143), Expect = 1.443e-9
Identity = 47/190 (24.74%), Postives = 81/190 (42.63%), Query Frame = 2
Query:  926 YKDN-----IWNLQIYC--STILCDWFGILSNFRSHFETCELKQIKCPQ--CDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPI-FSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLE 1465
            ++DN     I  L+++C   T  C     L   + H   C  + + CP   C E +  G    H    C  R+  C++C+  +  ++  K +E  C    I CPN C+  +   + ++   GI        C  ++  C F  FGCK K   + +  H +     HL ++ +     + +LE +V SML+
Sbjct:    3 FRDNCCRREILALRVHCRNDTAGCKQIVELGKLQEHMAVCVHEAVNCPHAGCTERLLRGELVNHVALGCHFRTESCRYCNQQVPLAEKRKHYETRCPRYPIPCPNKCEEQSIAREELVSHLGI--------CPYKQAECFFSQFGCKYKGTLQGLKEHESGATQQHLSLVTA----RSANLELKV-SMLQ 179          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 5.213e-18
Identity = 42/170 (24.71%), Postives = 91/170 (53.53%), Query Frame = 2
Query: 1478 LERSDGKIKIL-NSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQ-ISEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIEP 1981
            L+ ++ ++++L  + +  +L+WKI +   + Q A  G    + S PFY T+P+GY+   R   N   V   + +LS+F  +    ++ LL WPF+ ++ + L++Q  + +H+S  F P+    ++    RP    N   G   F + ++  + S ++  + +F++++++P
Sbjct:  251 LDTAERRLQVLETAGYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFY-TSPFGYKMCARAYLNGDGVGRGT-HLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPDPASGSF---RRPDGDMNVASGCPLFVS-HVALEGSSYLVDDTVFVRVVVDP 414          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 81.2629 bits (199), Expect = 2.809e-16
Identity = 59/245 (24.08%), Postives = 107/245 (43.67%), Query Frame = 2
Query:  671 ILSDGFARENEFFQTNNQLSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTILCDWFGILSNFRSHFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMI 1405
            +  D  A E + ++ +    F   ++ +Y C  C   L  P++  CGH  C  C       ++    CP+D     E ++      K  I +L + C    C   G L   + H   CE  Q+ C +C+  +   +   H+   C  R V C  C   +  K++K+HE +C   ++ C   C+      + +I +Q  L  HLE  C + +VPC F   GC+ +  +  +  H+ ++  +H+ ++
Sbjct:   39 VSGDDSATEAQGYEAD----FEPPLESKYECPICLMALREPVQTPCGHRFCRACILHSMRLRDAGPKCPVDNAVLHEGQLFPDNFAKREILSLTVRCPNKPCGHRGELRALQEHQLRCEYAQVPCVRCEMPVCRRDLAKHEEQECMRRIVTCLHCCEKMAYKDSKNHEQMCPLVVVNC-KHCQ------QELIREQ--LGPHLEVDCQQAQVPCTFSPLGCEAQMVRSLLAAHMHEHTQVHMRLL 270          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV5])

HSP 1 Score: 166.777 bits (421), Expect = 6.414e-45
Identity = 113/425 (26.59%), Postives = 193/425 (45.41%), Query Frame = 2
Query:  752 EYFCEKCSRILWNPIKLK-CGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTIL--CDWFGILSNFRSHFETCELKQIKCP-QCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNK-------SKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQ----ISEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANC-NIFHDNSPFVAGNAMFIKILIE 1978
            +Y C  C  +LW P+++K CGH +C  C        +    CP   +   E+  +  + + + I  L + C  +   C W G ++ F SH E C+   I C   C    Q      H    C  + + C +C      K+ K H   C      CPN C       K + + +  L  H+EN C   K+ C +E+ GC ++         ++KM  H     I H++M+     KN E + +    + E    +E+ + ++  L     +QL+W+I++   K + A  G N + + +P ++T+ +GYR    +  N  + K    ++S+FIS+    F+ LL WPF  ++   L++Q       KHI     PN   +N PF+ RP+ ++N  FG  KFA    I   N  ++  + +F+KI ++
Sbjct:   42 KYICLDCEGLLWYPVQIKPCGHRVCTKCY---TKLLSSSARCPGCMDELNENIPDIDKAFHEEIQELDVKCRNVEWNCKWEGCVNEFSSHVEKCDYSDILCENDCGAKFQRRFLTKHLDKDCPEKLITCLYCDEKHLRKDKKGHLENCPLLPCPCPNKC------DKKLTIHRCELDSHVENDCPRTKLMCEYEVLGCGHRITGLEGGGSREKMPKHNKTNIIAHVKMVADLALKNKELIMRFSEKLSEHGTLIEKHEKRLNDLEKIAHSQLIWRIEDYTRKMKEAKAG-NTDTLFSPTFTTSKHGYRLCASVCLN-GDGKGKGTHMSVFISVLKGAFDALLKWPFDYRVTFVLLDQNDDPAQRKHIRFSIKPNPCADNEPFLGRPRLEKNASFGGAKFAKHEEIVSRN--YIKEDTIFLKISVD 453          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV3])

HSP 1 Score: 156.762 bits (395), Expect = 2.942e-41
Identity = 107/420 (25.48%), Postives = 196/420 (46.67%), Query Frame = 2
Query:  752 EYFCEKCSRILWNPIKLK-CGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYC--STILCDWFGILSNFRSHFETCELKQIKCP-QCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQI----SEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFH---DNSPFVAGNAMFIKILIE 1978
            ++ C  C  I  +P+++K CGH +C  C  +   +++    CP       +   +  + +++++  L   C      C      +   +H   CE   I C   C    Q    + H    C  + + C +C +    +N K H   C    + CPN C    DKT  + + +G L  H+E  C   K+ C FE  GC+++  ++KM  H+    I H++MI     +  E L+   +   E +  +++ D ++  L     +Q++W+I++   K + A  G N E + +P ++T+ +GYR    +  N  + K    ++S+F+S+    F+ LL WPF  ++   L+NQ       KH+     PN I +N PF+ RP+ ++N  FG  KF    I H   ++  F+  + +F+K+ ++
Sbjct:   52 KHLCPVCEDIFVSPVQIKECGHRLCQHC--YKTIWRSPEPKCPKCSGDLDDKIPDVDQAFENDMNELPCRCINHEWGCKVEVPFTQMITHKGECEYSDILCDNDCGAKFQRRFKQKHLDKDCPKKIISCPYCDDRHLRENKKEHLEDCLLIPLPCPNKC----DKT--LTIPRGQLDEHIEKECPRAKLMCEFESLGCQHRCSREKMAKHMKSEIIGHVKMIFGVVLEQKEKLDNHAQKFEEHETIMKQVDSRVGDLEKIAHSQIIWRIEDYTRKLKEAKAG-NAETLFSPTFTTSKHGYRLCASVCLN-GDGKGKGTHMSVFVSVLKGAFDALLKWPFHYRVTFFLLNQHENPEERKHVKFSIKPNPIPDNEPFLGRPRLEKNASFGGAKF----IKHEEIESGNFIKDDTVFLKVSVD 457          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGK7])

HSP 1 Score: 145.976 bits (367), Expect = 5.193e-38
Identity = 115/428 (26.87%), Postives = 189/428 (44.16%), Query Frame = 2
Query:  722 QLSFREEVKLEYFCEKCSRILWNPIKLK-CGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTIL--CDWFGILSNFRSHFETCELKQIKC--PQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEK--HISHCFLPNTIVENYPFI-NRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIEP 1981
            +  F E +  EY C  C     +PI+++ CGH  C +C       Q   + CP+D       ++   +  +  I  L + C      C+W G LSN   H + C  + + C  P+C+E++   + + H ++ C+ R V C FC+     K+ K+H   C    IEC N C        A  + +  + FH+ + C     PC +   GC  K ++  +  H       HL + C   R+N      + RS+                 N  F    LWKI N   +Y  A+    E  + +P + T+ YGY+  ++   N  + +    +LS++I I    ++ LL WPFK K+  +L++Q SEK  H +H   PN  + N   + NRP  + N   G   F    +  ++  +V  + MFIK ++EP
Sbjct:   13 EAEFVEPLPEEYECPICQLAFRDPIQIEECGHRFCQSCLQELRRLQGSPVLCPMDRRPISSTKVFVDKAARRAILGLGVKCWNWKRKCEWTGELSNIEEHAKNCAHEDVHCTNPECNEVMPRRSLQYHLVSKCKWRIVSCHFCTEMYTYKDGKTHMKSCKRLPIECVNKC-------GAKDIPREEMPFHM-SECPLAVHPCMYRDIGCPFKGRRDALEEHCKNAVHTHLNIACQKIREN------ESRSL---------------CTNGIF----LWKISNYKHQYDQAVASPEELAIFSPPFYTSQYGYKLRLKAYLNGRD-RGKGTHLSLYIIIMKGDYDALLEWPFKQKITFYLIDQ-SEKQNHRTHLLSPNRSLPNIKVVFNRPTVKENLGIGNPCFVPNEVL-ESGEYVKDDVMFIKAVVEP 404          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO45915 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA4])

HSP 1 Score: 125.561 bits (314), Expect = 5.989e-31
Identity = 111/426 (26.06%), Postives = 184/426 (43.19%), Query Frame = 2
Query:  761 CEKCSRILWNPIKLK-CGHIICYTC-QPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTILC-------DWFGILSNFRSHFE-TCELKQIKCPQ-CDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKD--KLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVG-ANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQI----SEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHD---NSPFVAGNAMFIKILI 1975
            C  C   L +P+++  CGH +C TC +P     +N    CP+D  T    +I     + DN  + QI    ILC       +W G +S+   H E  C L +++CP+ C   ++ G  E H    C  R V C  C+  +   +   H   C    I CP +C        A  L +  L  HL   C    +PC F   GC  K+K++KM  H+ +    H+ M+C    +    +  Q   +L  K+  +L+  + + +  N EF    +WKI   + K   A  G A+E ++S  FY T+P+GY+    +  N        +Y+S+ + +    F+ +L WP   +    L++Q     +++ +   F P +       I+RP   R    G  +F    +  D    + +   N +FIK  +
Sbjct:   18 CPVCLMALRDPVQVTPCGHRVCQTCIKPI---IRNRRPRCPLDNLTLNVGKI-----FPDNACHRQILSMDILCPHHGDGCEWQGTISDLEKHLERGCNLSEVRCPKDCGASVERGKLEGH-YPECSRRLVNCTHCNKEVVFADMNVHLQSCASFPISCPLTCG-------AKDLTKEALAVHLNQECPLLVIPCRFAEAGCTFKAKRQKMAAHVQESLTSHVAMLCDLVCEQKLQISAQKERLLLQKEHIQLQIVECRSRCANGEF----IWKIQCFSRKLMDAKTGRASEPMISEAFY-TSPHGYKMCAGVWLNGIGTG-RGRYISVGLQVQSGEFDSILKWPLYPRYTFTLLDQSEDTKTKRDVVATFEPQS-------ISRPSADRQLGKGARRF----VLQDEVCGTTYCKDNTIFIKFSV 410          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO37750 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SER6])

HSP 1 Score: 117.087 bits (292), Expect = 7.147e-28
Identity = 80/321 (24.92%), Postives = 151/321 (47.04%), Query Frame = 2
Query: 1034 QIKCPQ-CDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEK----HISHCFLPNTIVENYPFINRP-KTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIE 1978
             + CP+ C E ++  +   H    C  R V CQ+C+  I  ++ ++H   C    + CPN+C           + +G ++ HL   C    + CPF   GC  +  Q+ +  H+ +    HLE++     +     +K++ S+ E+          ++       ++LLW+ID+  E +         E+ S  FY T+ YGY+F + ++F   N      +LS++I +    ++ LLPWPF+ ++ + L++Q ++K    HIS  F P+    N+    RP K   +  FG  +F +     ++  +V  + +F+K+ I+
Sbjct:  169 HVTCPRNCGERMRVQDKARHMREDCLNRWVFCQYCNTEIVFRDRQTHHQSCPSFPLSCPNNCGVAQ-------IPRGEVELHLSRDCRSNIMQCPFRHVGCHKQFPQRSLQRHIEESVQQHLELVSELAIQQ----QKEINSLKEI----------VRHCKPYHDSKLLWRIDDFWEAFDEGKRKPGTELHSPVFY-TSNYGYKFKV-VLFPYGNGSGEGTHLSLYIRLLPGEYDSLLPWPFEGQITLTLLDQSTDKRAKRHISQSFSPDP---NWKSFQRPSKNSTSLGFGYPQFVSHRGL-ESIGYVRDDVLFLKVTID 462          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 132.109 bits (331), Expect = 2.362e-32
Identity = 121/487 (24.85%), Postives = 202/487 (41.48%), Query Frame = 2
Query:  731 FREEVKLEYFCEKCSRILWNPIKLK-CGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYC--STILCDWFGILSNFRSHFETCELKQIKCP-QCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSC--------------------------------------------KFPT---DKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQIS-----EKHISHCFLPNTIVENYPFINRPKTQRNPY------FGIEKFANCNIFHD---NSPFVAGNAMFIKILIE-PHEIV 1993
            F E+ K  + C  CS+ +  P+++  CGH  C TC    +     V  CP D+      +I      +  I +L I C  S   C W G +   + HF TC    I CP +C   +   +   H  + C  R V C+FC +    +  ++H+ VC  + + C N C                                            +FP    ++     + +  L  H+++ C    V CPF+  GCK++  +  +  HL      HL M+C+        + +Q + +LEL+ ++E        L+      L+WK+++ + K Q A + +N E  S PFY T  YGY+  +    N  N      +LS++I +    ++ LL WPF  K+   +++Q        +HI+  F P+   +N+    +P + RN        FG  KF    I H+      ++  N +FIK  IE P +I+
Sbjct:    8 FLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTC--LQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCSVKLTRRDLPDHLQHDCPKRKVKCEFCGSEFTGEAFENHQGVCPQESVYCENKCGARMMRRLLSQHGMAECPKRTQPCKYCGKEFVFDTIQNHQFHCPRFPVQCPNQCGTPNIAREDLANHVKDNCGSALVLCPFKDAGCKHRCPKLAIGRHLEDTTKSHLTMMCNL-------VSRQRQEILELRREMEE-------LSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFY-THRYGYKLQVSAFLN-GNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNF---QKPCSTRNSLDESTLGFGYPKF----ISHEEIKKRNYIRDNCIFIKASIEIPQKIM 469          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 132.109 bits (331), Expect = 3.087e-32
Identity = 121/487 (24.85%), Postives = 202/487 (41.48%), Query Frame = 2
Query:  731 FREEVKLEYFCEKCSRILWNPIKLK-CGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYC--STILCDWFGILSNFRSHFETCELKQIKCP-QCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSC--------------------------------------------KFPT---DKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQIS-----EKHISHCFLPNTIVENYPFINRPKTQRNPY------FGIEKFANCNIFHD---NSPFVAGNAMFIKILIE-PHEIV 1993
            F E+ K  + C  CS+ +  P+++  CGH  C TC    +     V  CP D+      +I      +  I +L I C  S   C W G +   + HF TC    I CP +C   +   +   H  + C  R V C+FC +    +  ++H+ VC  + + C N C                                            +FP    ++     + +  L  H+++ C    V CPF+  GCK++  +  +  HL      HL M+C+        + +Q + +LEL+ ++E        L+      L+WK+++ + K Q A + +N E  S PFY T  YGY+  +    N  N      +LS++I +    ++ LL WPF  K+   +++Q        +HI+  F P+   +N+    +P + RN        FG  KF    I H+      ++  N +FIK  IE P +I+
Sbjct:    8 FLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTC--LQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCSVKLTRRDLPDHLQHDCPKRKVKCEFCGSEFTGEAFENHQGVCPQESVYCENKCGARMMRRLLSQHGMAECPKRTQPCKYCGKEFVFDTIQNHQFHCPRFPVQCPNQCGTPNIAREDLANHVKDNCGSALVLCPFKDAGCKHRCPKLAIGRHLEDTTKSHLTMMCNL-------VSRQRQEILELRREMEE-------LSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFY-THRYGYKLQVSAFLN-GNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNF---QKPCSTRNSLDESTLGFGYPKF----ISHEEIKKRNYIRDNCIFIKASIEIPQKIM 469          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 129.413 bits (324), Expect = 1.413e-31
Identity = 101/433 (23.33%), Postives = 188/433 (43.42%), Query Frame = 2
Query:  731 FREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKD-----NIWNLQIYCSTIL--CDWFGILSNFRSHFETCELKQIKCP--QCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPI-FSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKD-KLERSDGKIKIL-NSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQI-SEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIEPHEI 1990
            F E  + +Y CE C  +L  P + +CGH  CY+C        ND+L+CP        + + + + ++D      I  L++YC +    C     L     H   C   ++ CP  +C E +       H    C+ R   C+FC N +  ++  K  E VC    + CPN C      + ++   + ++  H E                 + +S +  +    T+ + +        GR + E+   +   ML + + +L   D + ++L  + +   L+WKI +   + Q A+ G    + S PFY T  +GY+   R+  N   +     +LS+F  +    ++ LLPWPFK K+ + L++Q  S KH+   F P+    ++    RP  + N   G   F + ++    + ++  + +FIK+ ++  ++
Sbjct:   38 FVEAPEAKYCCEACRLVLCQPRQTECGHRFCYSC-------INDILSCPNPVCPADMEPLFKDKIFRDVCCHREIMALKVYCRSEANGCQEQMSLQQIPDHVNVCPFFEVPCPLGKCKERMMRKEIPEHLAWKCKYRESTCEFCKNKMPLTELQKHKETVCPAFPVSCPNHC-----TSSSLPRSEKLMSSHTEKLLELELELRSLRQLRDEMESLRGTLDTVRTRLSALE-----QGGRASLETQLNRHDDMLSVHEIRLADMDLRFQVLETASYNGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFY-TGYFGYKMCARVYLNGDGMG-KGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPDPSSSSF---RRPVAEMNIASGCPLFVSQSVLESGT-YIKDDTIFIKVTVDTSDL 447          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 123.635 bits (309), Expect = 1.427e-29
Identity = 119/493 (24.14%), Postives = 198/493 (40.16%), Query Frame = 2
Query:  731 FREEVKLEYFCEKCSRILWNPIKLK-CGHIICYTCQP------FPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYC--STILCDWFGILSNFRSHFETCELKQIKCP-QCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSC--------------------------------------------KFPT---DKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQIS-----EKHISHCFLPNTIVENYPFINRPKTQRNPY------FGIEKFANCNIFHD---NSPFVAGNAMFIKILIE-PHEIV 1993
            F E+ K  + C  CS+ +  P+++  CGH  C TC        FP      +   P                 +  I +L I C  S   C W G +   + HF TC    I CP +C   +   +   H  + C  R V C+FC +    +  ++H+ VC  + + C N C                                            +FP    ++     + +  L  H+++ C    V CPF+  GCK++  +  +  HL      HL M+C+        + +Q + +LEL+ ++E        L+      L+WK+++ + K Q A + +N E  S PFY T  YGY+  +    N  N      +LS++I +    ++ LL WPF  K+   +++Q        +HI+  F P+   +N+    +P + RN        FG  KF    I H+      ++  N +FIK  IE P +I+
Sbjct:    8 FLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSIFFPMGLLPQIYPDP---------------ELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCSVKLTRRDLPDHLQHDCPKRKVKCEFCGSEFTGEAFENHQGVCPQESVYCENKCGARMMRRLLSQHGMAECPKRTQPCKYCGKEFVFDTIQNHQFHCPRFPVQCPNQCGTPNIAREDLANHVKDNCGSALVLCPFKDAGCKHRCPKLAIGRHLEDTTKSHLTMMCNL-------VSRQRQEILELRREMEE-------LSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFY-THRYGYKLQVSAFLN-GNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNF---QKPCSTRNSLDESTLGFGYPKF----ISHEEIKKRNYIRDNCIFIKASIEIPQKIM 462          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000001369.2 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:101170323])

HSP 1 Score: 93.5893 bits (231), Expect = 1.713e-19
Identity = 75/285 (26.32%), Postives = 131/285 (45.96%), Query Frame = 2
Query:  611 NDLEKTKISARNYSKEERVIILSDGFARENEFFQTNNQLSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTC-QPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCS-TILCDWFGILSNFRSHFETCELKQIKC--PQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSH-ENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQV 1450
            +D  +  + +R  S E  +       + E+E     + L F  ++K E+ C  C  ++ NP +  CGHI C+ C Q   +S       CP+++      E+ Q    K  I +L++YC+ + LC     L+  + H ++C+ +Q+ C  P C E++Q    + H   TC  R   C  C  P      + H ++ C +  + CP+ C        + ++ +  L  H E +C E    C F+MFGC  K K++K+  H       H+ ++     K++  LE+QV
Sbjct:   18 SDDARRSLGSRLESGESPMRSAGSMASWESELASLQHSLKFVMKLKEEFICPICKGVVLNPQQNSCGHIYCFHCLQGLLESSLLSGPVCPVEKAAITPSEVFQDNCCKREISSLEVYCTNSPLCTSVLALNQLQEHLKSCQYEQLLCSNPGCTELLQRRLLQEHLNATCPHRRESCPHCLQPFQLSVIQDHVQSSCPEVKVGCPDGC--------STLVPRNRLTEHGE-SCPEVHTDCSFKMFGCSVKGKRRKVKLHEEAAVCHHVLLVL----KSSAHLEQQV 289          

HSP 2 Score: 60.4622 bits (145), Expect = 4.426e-9
Identity = 39/160 (24.38%), Postives = 81/160 (50.62%), Query Frame = 2
Query: 1514 SEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEK-HISHCFLPNTIVENYPFINRPKTQ--RNPYFGIEKFANCNIFH--DNSPFVAGNAMFIKILIE 1978
            + +  +L+WKI +  ++ +A   G +  + S PF+ T   GY+  M+   N  + +    +LS+++ +    F+ LLPWPFK  +++ +++Q   + H S  F P+    N  F ++P  +   N   G   F + +      N+ +V  + +F+K+ ++
Sbjct:  424 TSYDGRLIWKIKDFQKRREAEATGQHPCLSSVPFH-TGRCGYKMAMKAYLN-GDGEGRGTHLSLYVVLMPGDFDALLPWPFKQTVSLSVLDQSGARNHQSFNFRPDPT--NTCF-HQPAAESASNVAVGFPCFISLDALEAPGNAVYVKDDTLFVKVKVD 578          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000006747.1 (SMESG000006747.1)

HSP 1 Score: 1043.88 bits (2698), Expect = 0.000e+0
Identity = 519/525 (98.86%), Postives = 524/525 (99.81%), Query Frame = 2
Query:  419 MNDLETENQELVNENKSSPIAIIEKSPEEEMDPIQPTKLNESLKNDEKLSEHNYDINENKTTEMNDLEKTKISARNYSKEERVIILSDGFARENEFFQTNNQLSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDNIWNLQIYCSTILCDWFGILSNFRSHFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIEPHEIV 1993
            MNDLETENQELVNENKSSPIAIIEKSPEEEMDPIQPTKLNESLKNDEKLSEHNYDINENKTTEMNDLEKT+ISARNYSKEERVIILSDGFARENEFFQTNNQLSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDV+NCPIDEETTKEDEIEQCENYKDNIWNLQIYCSTILCDWFGILSNFRSHFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSK+AKSHENVCD+KLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVR MLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGY+FIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIEPHEIV
Sbjct:    1 MNDLETENQELVNENKSSPIAIIEKSPEEEMDPIQPTKLNESLKNDEKLSEHNYDINENKTTEMNDLEKTEISARNYSKEERVIILSDGFARENEFFQTNNQLSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVMNCPIDEETTKEDEIEQCENYKDNIWNLQIYCSTILCDWFGILSNFRSHFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKDAKSHENVCDEKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRFMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYKFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIEPHEIV 525          

HSP 2 Score: 95.1301 bits (235), Expect = 3.327e-20
Identity = 51/80 (63.75%), Postives = 61/80 (76.25%), Query Frame = 2
Query:  248 ENQELMDENKISPIDIIEKAPEVATDPIQPTELNESLKNDKKLSEHNDDLNENKTVKMNDLETENQELVNENKSSPIAII 487
            ENQEL++ENK SPI IIEK+PE   DPIQPT+LNESLKND+KLSEHN D+NENKT +MNDLE       N +K   + I+
Sbjct:    7 ENQELVNENKSSPIAIIEKSPEEEMDPIQPTKLNESLKNDEKLSEHNYDINENKTTEMNDLEKTEISARNYSKEERVIIL 86          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000016362.1 (SMESG000016362.1)

HSP 1 Score: 202.216 bits (513), Expect = 4.175e-58
Identity = 114/363 (31.40%), Postives = 193/363 (53.17%), Query Frame = 2
Query:  926 YKDNIWNLQIYCSTIL--CDWFGILSNFRSHFETCELKQIKCPQ-CDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQI----SEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIEPHEIV 1993
            ++  I NL + CS     C W G+L    +H E+C  + I CP  C+   +    E HK + C  R + CQFC   + ++   +H  VC+   I CPN CK      K  IL++ + + HLE+ C +++  CPF  +GC  K K+K++  HL    + HL ++C   ++NT  +E+Q + + + + ++   + +I+ L   +G QL+WKIDN  EK+  A  G    I S PF  T+ +GY+  + +     + K   ++ S+FI IC   ++ LL WPF  ++   L++Q     + K++ +   PNT  EN PF+ RP T RN  FG +KF   ++  +   ++  +A+FIK  ++  E++
Sbjct:   25 FQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCK------KKEILRENLAE-HLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFM-TSRFGYKMALSVCL-YGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVL-NTLDYIRDDAIFIKAQVDCDEMI 377          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000003970.1 (SMESG000003970.1)

HSP 1 Score: 137.887 bits (346), Expect = 9.647e-37
Identity = 70/223 (31.39%), Postives = 124/223 (55.61%), Query Frame = 2
Query: 1322 MFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISE----KHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIE 1978
            MFGCK +  + ++ +HL + AI HL ++     KN+ +LE  V+ +L+ K K    + ++ +    +G+QL+WK++  ++K+  A  G      S PF+S+  YGY+  + L      +    ++LS+F+ IC   ++ LL WPF LK+   L++Q  E    K + + F+PN I +N+PF+ RP  +RNP+FG  KF + +   +   +     +F K+ I+
Sbjct:    1 MFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLIWKVERFSQKFSDAKSGVTTTFFSPPFFSSH-YGYKLALGLCPFGDGIA-KGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDIQ 221          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000027153.1 (SMESG000027153.1)

HSP 1 Score: 123.635 bits (309), Expect = 1.057e-29
Identity = 118/450 (26.22%), Postives = 193/450 (42.89%), Query Frame = 2
Query:  761 CEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENY-KDN-----IWNLQIYCSTILCDWFGILSNFRSHFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKNAKS------HENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCK-NKSKQKKMHHHLTKYAIIHLEMICSFGR------KN-TESLEKQVRSMLELKDKLERSDGKI--------KILNSEFGTQL---------------LWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQ-ISEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIE 1978
            C  C RIL N  +  CG   C  C        N    CP  +   +   +   E+   DN     I +L++ C   LC     L N   H  +CE ++I C +C   +Q  + E+H  N CEMR + C++C   +  ++ KS       E+ C      CPN+C   T         +  LK HL+  CS++K+ CPF    C  +K  ++ +  HL +  + H   + S  +      KN T+ LE Q     EL D  ++S   +        K+    F T +               +WK  +   K   A  G    + S+PFY T+ +GY+  +R ++   +      +LS+F +I    F+ LL WPFK K+ + +++Q    KH S  F P+     Y    +P  + N   G  KF   ++  +NS +   + +++KI ++
Sbjct:   28 CVLCQRILKNAKQTSCGCKACENC--IKSYLANGPKPCPSKQIDCENVMLHMDEDINADNATNKEIASLKVKCPFKLCSSEMPLRNMVEHINSCEFREISCNKCQSKLQAKDKESHDKNKCEMRKLKCEYCLEEMSFRDLKSIHLNSDREDFCVKYTAICPNNCDVHT---------KVCLKEHLK-LCSKKKLECPFHSLNCNVDKMTKENLMKHLNEEYVSHTSNLISKIKDMENTIKNLTDELENQKVLTKELLDMNKKSSLSVLKTQETIEKLKTKSFPTPIQAVENKSVIFRNATFIWKFTDFESKRIDAESGRKVSVTSDPFY-TSEFGYKMCLR-IYPAGDGVGKGTHLSVFFAIMKGEFDDLLSWPFKQKVTLSIMDQEAGTKHHSDTFKPDARSACY---QKPVDECNIASGSPKFILLSLIMNNSLYCKNDTIYLKIAVD 460          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025043.1 (SMESG000025043.1)

HSP 1 Score: 120.553 bits (301), Expect = 1.365e-27
Identity = 118/406 (29.06%), Postives = 177/406 (43.60%), Query Frame = 2
Query:  740 EVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFPDSFQNDVLNCPXXXXXXXXXXXXQCENYKDN--IWNLQIYCSTILCDWFGILSNFRSHFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSN-------PIFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLE-MICSFGRKNTE-SLEKQVRSMLELKDKLERSDGKIKIL--NSEFGTQ-----LLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKF 1903
            ++K    C +C  +L    + KCG  IC  C    +  + + + CP  +ET + DE     +   N  I NL + C    C+W G++    SH   CE  +I C +C         + H    C  R   C+FC          +  +N K  E +CD     C N+C    DK K        LK H  N CS + V CP E+F C+ +    +M  H+ + +I H E M+ + G KN E S    ++ M E++ K+++    IK L  NS    +     L+WKI    EK Q A  G    + S P YS    GY+  +RL  N  +   +  ++S+FI +    ++ LL WPF  K N+ L  +  E H +     N      P + RP T  N   G  +F
Sbjct: 1174 DIKERLKCCRCKELLIGARQTKCGCRICTDC--TIEVIKTETIKCPGCDETIERDEDPTTMDKATNKEINNLLVQCRVKECEWKGLMKEAESHANECEYNEILCEKCQTSTTKKTMKEHH-KVCIKREEKCEFCGVIGEWIKIEMEHRNPK-EEQICDLYEGICANNCDR-KDKVK--------LKEHW-NECSGKPVKCPLELFNCQAQLPVAEMQKHMMENSIEHTEIMMKTIGIKNFERSQGDTLKKMGEMEKKMQQMTNSIKELETNSSIARKHPTAPLIWKITEFAEKLQRAKDGTQRILDSPPIYSWE-NGYKLGIRLYPN-GDGNATGTHISVFIRVGKGDYDELLAWPF--KQNMILTMKGYEDHRNPIRTGNE-----PQMGRPTTDWNTAIGTPRF 1556          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF27.153e-3123.16TNF receptor associated factor 2 [Source:HGNC Symb... [more]
TRAF49.251e-3124.54TNF receptor associated factor 4 [Source:HGNC Symb... [more]
TRAF41.729e-2524.49TNF receptor associated factor 4 [Source:HGNC Symb... [more]
TRAF31.190e-2324.35TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF61.063e-2023.00TNF receptor associated factor 6 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-15.544e-3724.08TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-28.666e-1122.22TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Traf46.397e-2924.26gene:FBgn0026319 transcript:FBtr0077429[more]
Traf46.960e-2924.26gene:FBgn0026319 transcript:FBtr0334401[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf4a5.119e-3325.05tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf4a5.119e-3325.05tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf61.281e-2521.65TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf61.281e-2521.65TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf61.281e-2521.65TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sytl21.644e-3324.64synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
TRAF21.084e-2521.83TNF receptor associated factor 2 [Source:NCBI gene... [more]
TRAF21.947e-2321.44TNF receptor associated factor 2 [Source:NCBI gene... [more]
egf6.183e-2019.80epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
ssh27.199e-1727.18slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf44.156e-3224.95TNF receptor associated factor 4 [Source:MGI Symbo... [more]
Traf23.724e-2522.37TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf24.086e-2521.79TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf69.336e-2121.99TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
Traf55.546e-1921.47TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q61382|TRAF4_MOUSE2.907e-3124.95TNF receptor-associated factor 4 OS=Mus musculus O... [more]
sp|Q12933|TRAF2_HUMAN3.435e-3023.16TNF receptor-associated factor 2 OS=Homo sapiens O... [more]
sp|Q9BUZ4|TRAF4_HUMAN4.442e-3024.54TNF receptor-associated factor 4 OS=Homo sapiens O... [more]
sp|Q6IWL4|TRAF6_DANRE9.672e-2521.65TNF receptor-associated factor 6 OS=Danio rerio OX... [more]
sp|P39429|TRAF2_MOUSE2.605e-2422.37TNF receptor-associated factor 2 OS=Mus musculus O... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8J0687.904e-6030.90Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F1229.928e-6030.66Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DCA21.009e-5930.66Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8G0B11.227e-5930.90Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DKH11.473e-5930.66Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf4a8.903e-3425.05TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf2a3.618e-2721.20TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf61.065e-2622.22TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf61.065e-2622.22TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf61.421e-2321.81TNF receptor associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000000074.14.714e-1825.86pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.15.213e-1824.71pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
traf62.809e-1624.08TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO328516.414e-4526.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328492.942e-4125.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495455.193e-3826.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459155.989e-3126.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377507.147e-2824.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf4a2.362e-3224.85TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a3.087e-3224.85TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf31.413e-3123.33TNF receptor associated factor 3 [Source:NCBI gene... [more]
traf4a1.427e-2924.14TNF receptor associated factor 4 [Source:NCBI gene... [more]
ENSORLT00000001369.21.713e-1926.32TNF receptor-associated factor 5 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006747.13.327e-2098.86SMESG000006747.1[more]
SMESG000016362.14.175e-5831.40SMESG000016362.1[more]
SMESG000003970.19.647e-3731.39SMESG000003970.1[more]
SMESG000027153.11.057e-2926.22SMESG000027153.1[more]
SMESG000025043.11.365e-2729.06SMESG000025043.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004183 ID=SMED30004183|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=2152bp
GCTCACATACACAGCCAACTAAATGAATTGACAGACAAGGAATGATTGCC
ATTGTACAAATAAGAGATGTGTATTCTATACAATGCAAACATTATTGTTT
CAAGAATTATACCATTAAAATAGTAGAATTTCTAACATGCAATTTCAGTT
GGAAAATGATAAATAATACTGCCTTTCCAAATATTTAATATTTTTCGAAT
AGTTACTATTTTTGTTTCTCAAAGAATCGGTGCAGATAAACAAAATGGAA
AATCAAGAATTAATGGATGAGAATAAAATTTCCCCAATAGATATTATAGA
AAAAGCACCAGAGGTAGCAACGGACCCAATCCAACCAACCGAATTGAACG
AATCCTTAAAGAATGACAAGAAGTTATCAGAACACAATGATGATTTAAAT
GAAAATAAAACTGTCAAAATGAACGATCTCGAAACGGAAAATCAAGAATT
AGTGAATGAGAATAAAAGTTCCCCAATAGCTATTATAGAAAAGTCACCAG
AAGAAGAAATGGACCCAATCCAACCAACCAAATTGAATGAATCCTTAAAG
AATGACGAGAAATTATCAGAACACAATTATGATATAAATGAAAATAAAAC
TACCGAAATGAACGATCTCGAAAAAACGAAAATCTCCGCAAGAAATTATT
CTAAAGAAGAACGCGTTATAATTCTTTCCGACGGTTTTGCTAGAGAGAAT
GAATTTTTCCAAACTAATAATCAACTTTCTTTTCGGGAGGAGGTAAAATT
AGAGTATTTCTGTGAGAAGTGCAGTCGGATTTTGTGGAATCCAATTAAGT
TAAAATGTGGTCACATAATTTGTTATACATGTCAACCTTTTCCCGATTCA
TTCCAGAATGACGTTCTGAATTGCCCGATTGATGAAGAAACGACAAAAGA
AGACGAAATTGAACAATGCGAGAATTATAAAGATAATATTTGGAACTTAC
AAATTTATTGTTCAACAATTTTGTGTGATTGGTTTGGAATTTTAAGCAAC
TTTAGAAGTCATTTTGAAACTTGTGAATTAAAACAAATAAAATGCCCGCA
GTGCGATGAAATGATACAGTGGGGAAATTTTGAAGCTCACAAGCTTAACA
CATGCGAAATGCGTTCAGTACTCTGTCAATTCTGTTCGAATCCCATTTTT
TCAAAAAATGCAAAGTCCCACGAAAATGTCTGCGACGACAAACTTATCGA
ATGTCCGAATAGTTGCAAATTTCCGACGGATAAAACAAAGGCAATGATTC
TCAAACAAGGGATTTTGAAATTCCATTTGGAAAACGCATGTTCAGAAAGA
AAAGTTCCGTGCCCGTTTGAAATGTTTGGCTGCAAAAACAAGTCAAAACA
GAAAAAAATGCATCATCATTTGACAAAGTATGCCATAATTCATTTGGAAA
TGATTTGCAGTTTTGGAAGGAAAAATACAGAATCCCTTGAAAAACAAGTC
AGATCCATGTTGGAATTGAAGGATAAGTTGGAGAGAAGCGATGGAAAGAT
AAAAATTCTGAATTCTGAGTTTGGTACGCAATTGCTGTGGAAAATTGACA
ATATCAATGAAAAATATCAAGCGGCATTAGTCGGAGCTAACGAGGAGATT
GTGAGCAATCCGTTCTATTCGACCGCACCTTACGGATACAGATTTATTAT
GCGATTGGTTTTCAATGTGCATAATGTGAAATTATCCAGCCAATACCTGT
CCATTTTTATTTCGATTTGCGACAGCCCATTCAATGTTCTACTGCCTTGG
CCGTTCAAGTTAAAATTGAACATCCATCTTGTGAATCAGATCTCTGAGAA
ACATATCAGTCATTGCTTCCTTCCGAATACAATTGTTGAAAATTATCCTT
TCATTAATCGACCAAAAACGCAAAGAAATCCTTATTTTGGAATCGAGAAA
TTTGCAAATTGTAACATTTTTCACGACAACAGCCCGTTTGTAGCGGGAAA
TGCGATGTTTATCAAGATTTTAATAGAACCTCATGAAATCGTATAAAATC
TTTTCCATATACTATACACAAATAATCACTGGCCTTTATATCAAGAAGAA
TCATTTTTATTATACCTCTACTTTTTGATTTTTCACTCCAACTTTATTTT
CTATGTATATTTGATTTACTAATGTGTTATTAGATAACTTTATATATTCT
AC
back to top

protein sequence of SMED30004183-orf-1

>SMED30004183-orf-1 ID=SMED30004183-orf-1|Name=SMED30004183-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=584bp
MENQELMDENKISPIDIIEKAPEVATDPIQPTELNESLKNDKKLSEHNDD
LNENKTVKMNDLETENQELVNENKSSPIAIIEKSPEEEMDPIQPTKLNES
LKNDEKLSEHNYDINENKTTEMNDLEKTKISARNYSKEERVIILSDGFAR
ENEFFQTNNQLSFREEVKLEYFCEKCSRILWNPIKLKCGHIICYTCQPFP
DSFQNDVLNCPIDEETTKEDEIEQCENYKDNIWNLQIYCSTILCDWFGIL
SNFRSHFETCELKQIKCPQCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNP
IFSKNAKSHENVCDDKLIECPNSCKFPTDKTKAMILKQGILKFHLENACS
ERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEK
QVRSMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANE
EIVSNPFYSTAPYGYRFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLL
PWPFKLKLNIHLVNQISEKHISHCFLPNTIVENYPFINRPKTQRNPYFGI
EKFANCNIFHDNSPFVAGNAMFIKILIEPHEIV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001817regulation of cytokine production
GO:0008063Toll signaling pathway
GO:0032088negative regulation of NF-kappaB transcription factor activity
GO:0033209tumor necrosis factor-mediated signaling pathway
GO:0042981regulation of apoptotic process
GO:0045087innate immune response
GO:0050688regulation of defense response to virus
GO:0007165signal transduction
GO:0007250activation of NF-kappaB-inducing kinase activity
GO:0016567protein ubiquitination
GO:0046330positive regulation of JNK cascade
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005622intracellular
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR012227TNF_rcpt-assoc_TRAF_met
IPR043211TNF_rcpt-assoc_TRAF
IPR001293Znf_TRAF
IPR008974TRAF-like
IPR013083Znf_RING/FYVE/PHD
IPR002083MATH/TRAF_dom
IPR001841Znf_RING
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 337..367
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..47
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 23..47
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 102..520
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 103..153
IPR001293Zinc finger, TRAF-typePFAMPF02176zf-TRAFcoord: 251..317
e-value: 2.2E-8
score: 34.7
IPR001293Zinc finger, TRAF-typePROSITEPS50145ZF_TRAFcoord: 197..239
score: 9.395
IPR001293Zinc finger, TRAF-typePROSITEPS50145ZF_TRAFcoord: 250..315
score: 11.344
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 97..208
e-value: 9.1E-12
score: 47.0
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 209..262
e-value: 2.4E-9
score: 39.1
IPR012227TNF receptor-associated factor TRAF, metazoaPIRSFPIRSF015614TRAFcoord: 333..525
e-value: 9.4E-31
score: 104.7
coord: 87..347
e-value: 9.7E-36
score: 121.1
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 332..520
e-value: 9.3E-34
score: 118.7
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 186..239
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 371..521
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 102..520
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 115..156
score: 8.963
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 369..519
score: 11.365