SMED30004178

Overview
NameSMED30004178
Smed IDSMED30004178
Length (bp)2596
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30004178 (SMED30004178) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30004178 (SMED30004178) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30004178 (SMED30004178) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30004178 (SMED30004178) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004178

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30004178SMESG000025475.1 dd_Smed_v4_2550_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004178SMESG000025475.1 dd_Smed_v4_2550_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004178SMESG000025475.1 dd_Smed_v4_2550_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004178SMESG000025475.1 dd_Smed_v4_2550_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004178SMESG000025475.1 dd_Smed_v4_2550_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30004178 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000093:105905..109459 -12712
Homology
BLAST of SMED30004178 vs. Ensembl Human
Match: EIF3C (eukaryotic translation initiation factor 3 subunit C [Source:HGNC Symbol;Acc:HGNC:3279])

HSP 1 Score: 405.216 bits (1040), Expect = 6.878e-127
Identity = 220/572 (38.46%), Postives = 345/572 (60.31%), Query Frame = -2
Query:   55 KLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFP--PYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKEEIP------------------SYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNR-NEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1707
            K+FA   EIT   ++ K+   L+ R  K   R +Q+++LQ L+ +      G G+ VKI  ++++ L  Y  + +   M  E W + L+   +++DIL  NPN I +  + +E+SE       P  V GCI+  +E +++E+TKI+   D  S    EY E L+ E ++ ++   V  YL +K    ++ CR+Y+ ++ H YY+FD     ++  P                  S   M +L  +I  KD TDR+RT AILCHIY+ ALH  W++ARD+M MS L ++I  AD   QIL+NR  VQLG+CAFR+G  K+AH AL ++Q SGR KE+L QG  L    E   E+   E+    P+H HIN++++EC YLVSAML ++ +    ++D RR MIS+ FH+ L+  +R  L G P++++EHVVAASKA+  GDWKT    I ++KM   VW LF   ++++T++V KI+ ES++ +L + ++V++S+S++ L +++EL   +VH +ISKMI++ +L ASLD+P+  ++MHRT  +  Q  AL+LA+K+  L E NE++ D  +  Y
Sbjct:  306 KMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLAT-YMKPEMWGKCLDCINELMDILFANPN-IFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQ---EYVEHLKDEAQVCAIIERVQRYLEEKG-TTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTY 871          

HSP 2 Score: 99.3673 bits (246), Expect = 1.340e-20
Identity = 62/161 (38.51%), Postives = 105/161 (65.22%), Query Frame = -2
Query: 2053 MSRFFHALXXXXXXXXXXXXXXXERPIAFDD-------SSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWXXXXXXXXXXXXXXXXLRQKIKKYNKDFEAQIADFRENSD 2514
            MSRFF   S     S    E +V +P+  +        S + ED +R+V+SA++K++E+L  +++ ++N   I+D+TK LE+FE L K+Y KA   ++ +GV +FYIR++A+LE++ N        ++KNN+K+L+ LRQKI+KYN+DFE+ I  +++N +
Sbjct:    1 MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLN-------EMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPE 154          
BLAST of SMED30004178 vs. Ensembl Human
Match: EIF3C (eukaryotic translation initiation factor 3 subunit C [Source:HGNC Symbol;Acc:HGNC:3279])

HSP 1 Score: 404.831 bits (1039), Expect = 9.898e-127
Identity = 220/572 (38.46%), Postives = 345/572 (60.31%), Query Frame = -2
Query:   55 KLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFP--PYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKEEIP------------------SYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNR-NEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1707
            K+FA   EIT   ++ K+   L+ R  K   R +Q+++LQ L+ +      G G+ VKI  ++++ L  Y  + +   M  E W + L+   +++DIL  NPN I +  + +E+SE       P  V GCI+  +E +++E+TKI+   D  S    EY E L+ E ++ ++   V  YL +K    ++ CR+Y+ ++ H YY+FD     ++  P                  S   M +L  +I  KD TDR+RT AILCHIY+ ALH  W++ARD+M MS L ++I  AD   QIL+NR  VQLG+CAFR+G  K+AH AL ++Q SGR KE+L QG  L    E   E+   E+    P+H HIN++++EC YLVSAML ++ +    ++D RR MIS+ FH+ L+  +R  L G P++++EHVVAASKA+  GDWKT    I ++KM   VW LF   ++++T++V KI+ ES++ +L + ++V++S+S++ L +++EL   +VH +ISKMI++ +L ASLD+P+  ++MHRT  +  Q  AL+LA+K+  L E NE++ D  +  Y
Sbjct:  316 KMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLAT-YMKPEMWGKCLDCINELMDILFANPN-IFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQ---EYVEHLKDEAQVCAIIERVQRYLEEKG-TTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTY 881          

HSP 2 Score: 102.064 bits (253), Expect = 2.113e-21
Identity = 61/164 (37.20%), Postives = 103/164 (62.80%), Query Frame = -2
Query: 2053 MSRFFHALXXXXXXXXXXXXXXXERPIAFDD-------SSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWXXXXXXXXXXXXXX---XXLRQKIKKYNKDFEAQIADFRENSD 2514
            MSRFF   S     S    E +V +P+  +        S + ED +R+V+SA++K++E+L  +++ ++N   I+D+TK LE+FE L K+Y KA   ++ +GV +FYIR++A+LE++ N  W +K+   K N  +    + LRQKI+KYN+DFE+ I  +++N +
Sbjct:    1 MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNELWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPE 164          
BLAST of SMED30004178 vs. Ensembl Human
Match: EIF3C (eukaryotic translation initiation factor 3 subunit C [Source:HGNC Symbol;Acc:HGNC:3279])

HSP 1 Score: 404.831 bits (1039), Expect = 9.898e-127
Identity = 220/572 (38.46%), Postives = 345/572 (60.31%), Query Frame = -2
Query:   55 KLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFP--PYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKEEIP------------------SYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNR-NEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1707
            K+FA   EIT   ++ K+   L+ R  K   R +Q+++LQ L+ +      G G+ VKI  ++++ L  Y  + +   M  E W + L+   +++DIL  NPN I +  + +E+SE       P  V GCI+  +E +++E+TKI+   D  S    EY E L+ E ++ ++   V  YL +K    ++ CR+Y+ ++ H YY+FD     ++  P                  S   M +L  +I  KD TDR+RT AILCHIY+ ALH  W++ARD+M MS L ++I  AD   QIL+NR  VQLG+CAFR+G  K+AH AL ++Q SGR KE+L QG  L    E   E+   E+    P+H HIN++++EC YLVSAML ++ +    ++D RR MIS+ FH+ L+  +R  L G P++++EHVVAASKA+  GDWKT    I ++KM   VW LF   ++++T++V KI+ ES++ +L + ++V++S+S++ L +++EL   +VH +ISKMI++ +L ASLD+P+  ++MHRT  +  Q  AL+LA+K+  L E NE++ D  +  Y
Sbjct:  316 KMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLAT-YMKPEMWGKCLDCINELMDILFANPN-IFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQ---EYVEHLKDEAQVCAIIERVQRYLEEKG-TTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTY 881          

HSP 2 Score: 102.064 bits (253), Expect = 2.113e-21
Identity = 61/164 (37.20%), Postives = 103/164 (62.80%), Query Frame = -2
Query: 2053 MSRFFHALXXXXXXXXXXXXXXXERPIAFDD-------SSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWXXXXXXXXXXXXXX---XXLRQKIKKYNKDFEAQIADFRENSD 2514
            MSRFF   S     S    E +V +P+  +        S + ED +R+V+SA++K++E+L  +++ ++N   I+D+TK LE+FE L K+Y KA   ++ +GV +FYIR++A+LE++ N  W +K+   K N  +    + LRQKI+KYN+DFE+ I  +++N +
Sbjct:    1 MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNELWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPE 164          
BLAST of SMED30004178 vs. Ensembl Human
Match: EIF3C (eukaryotic translation initiation factor 3 subunit C [Source:HGNC Symbol;Acc:HGNC:3279])

HSP 1 Score: 404.831 bits (1039), Expect = 9.898e-127
Identity = 220/572 (38.46%), Postives = 345/572 (60.31%), Query Frame = -2
Query:   55 KLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFP--PYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKEEIP------------------SYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNR-NEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1707
            K+FA   EIT   ++ K+   L+ R  K   R +Q+++LQ L+ +      G G+ VKI  ++++ L  Y  + +   M  E W + L+   +++DIL  NPN I +  + +E+SE       P  V GCI+  +E +++E+TKI+   D  S    EY E L+ E ++ ++   V  YL +K    ++ CR+Y+ ++ H YY+FD     ++  P                  S   M +L  +I  KD TDR+RT AILCHIY+ ALH  W++ARD+M MS L ++I  AD   QIL+NR  VQLG+CAFR+G  K+AH AL ++Q SGR KE+L QG  L    E   E+   E+    P+H HIN++++EC YLVSAML ++ +    ++D RR MIS+ FH+ L+  +R  L G P++++EHVVAASKA+  GDWKT    I ++KM   VW LF   ++++T++V KI+ ES++ +L + ++V++S+S++ L +++EL   +VH +ISKMI++ +L ASLD+P+  ++MHRT  +  Q  AL+LA+K+  L E NE++ D  +  Y
Sbjct:  316 KMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLAT-YMKPEMWGKCLDCINELMDILFANPN-IFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQ---EYVEHLKDEAQVCAIIERVQRYLEEKG-TTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTY 881          

HSP 2 Score: 102.064 bits (253), Expect = 2.113e-21
Identity = 61/164 (37.20%), Postives = 103/164 (62.80%), Query Frame = -2
Query: 2053 MSRFFHALXXXXXXXXXXXXXXXERPIAFDD-------SSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWXXXXXXXXXXXXXX---XXLRQKIKKYNKDFEAQIADFRENSD 2514
            MSRFF   S     S    E +V +P+  +        S + ED +R+V+SA++K++E+L  +++ ++N   I+D+TK LE+FE L K+Y KA   ++ +GV +FYIR++A+LE++ N  W +K+   K N  +    + LRQKI+KYN+DFE+ I  +++N +
Sbjct:    1 MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNELWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPE 164          
BLAST of SMED30004178 vs. Ensembl Human
Match: EIF3C (eukaryotic translation initiation factor 3 subunit C [Source:HGNC Symbol;Acc:HGNC:3279])

HSP 1 Score: 404.831 bits (1039), Expect = 9.898e-127
Identity = 220/572 (38.46%), Postives = 345/572 (60.31%), Query Frame = -2
Query:   55 KLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFP--PYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKEEIP------------------SYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNR-NEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1707
            K+FA   EIT   ++ K+   L+ R  K   R +Q+++LQ L+ +      G G+ VKI  ++++ L  Y  + +   M  E W + L+   +++DIL  NPN I +  + +E+SE       P  V GCI+  +E +++E+TKI+   D  S    EY E L+ E ++ ++   V  YL +K    ++ CR+Y+ ++ H YY+FD     ++  P                  S   M +L  +I  KD TDR+RT AILCHIY+ ALH  W++ARD+M MS L ++I  AD   QIL+NR  VQLG+CAFR+G  K+AH AL ++Q SGR KE+L QG  L    E   E+   E+    P+H HIN++++EC YLVSAML ++ +    ++D RR MIS+ FH+ L+  +R  L G P++++EHVVAASKA+  GDWKT    I ++KM   VW LF   ++++T++V KI+ ES++ +L + ++V++S+S++ L +++EL   +VH +ISKMI++ +L ASLD+P+  ++MHRT  +  Q  AL+LA+K+  L E NE++ D  +  Y
Sbjct:  316 KMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLAT-YMKPEMWGKCLDCINELMDILFANPN-IFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQ---EYVEHLKDEAQVCAIIERVQRYLEEKG-TTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTY 881          

HSP 2 Score: 102.064 bits (253), Expect = 2.113e-21
Identity = 61/164 (37.20%), Postives = 103/164 (62.80%), Query Frame = -2
Query: 2053 MSRFFHALXXXXXXXXXXXXXXXERPIAFDD-------SSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWXXXXXXXXXXXXXX---XXLRQKIKKYNKDFEAQIADFRENSD 2514
            MSRFF   S     S    E +V +P+  +        S + ED +R+V+SA++K++E+L  +++ ++N   I+D+TK LE+FE L K+Y KA   ++ +GV +FYIR++A+LE++ N  W +K+   K N  +    + LRQKI+KYN+DFE+ I  +++N +
Sbjct:    1 MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNELWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPE 164          
BLAST of SMED30004178 vs. Ensembl Celegans
Match: eif-3.C (Eukaryotic translation initiation factor 3 subunit C [Source:UniProtKB/Swiss-Prot;Acc:O02328])

HSP 1 Score: 401.749 bits (1031), Expect = 4.452e-126
Identity = 221/562 (39.32%), Postives = 342/562 (60.85%), Query Frame = -2
Query:   79 WTTVDMYGRPEVKLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDIL-NRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKN----YGDDDKCRVYMRQLEHIYYRFDPTVGIKEEIPSYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQ--GTRLNRNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKL 1743
            WT V+      V  F   EE+T + ++ K+   +  R  +   R   V  L++L+++   +  G+G+ VKI   ++S L +     S+  M  E +   L+    ++D+L   +   +S+  ++ +++ K D   Y + G I+  ++ L+ E  KIL   D  S+   +Y EKL+ E  + SL     +Y+  +N    +   + C+VYM ++EH YY++      + E  + K M  L   I   D+  RLR RA+LCH+YYLA+HD W  ARD++ MS +   +D +D  TQIL+NR   QLGLCAFR G I+EAHQ L+E+Q + R KE+LAQ  GTR +   A  E++ R +    PYH HINV+++EC YL+ +ML ++ H    + + RR M+SR+FHY LK S++ +L G P+N +EHVVAASKA+ NGDWK   D+I +DKM + VW LF N E +K ++V +I+ ES++ +LL+ + V+ ++SLK L +++ELS+  VH +ISKMI+  +L A+LDEP++CLIMHR   S LQ+ AL L+DK+  LAE NE++
Sbjct:  281 WTPVNR--EKSVVHFDPKEEVTHDVMIKKLNEVMSARGKRTTDRNQHVANLRKLLEVSEEKELGLGINVKISFCIISALFELNAKISDH-MEYETFMTTLQTVNSLLDLLIGTDRVKLSVTYAEEDENLKDDTQEYRIQGSILIAVQRLDGELAKILQNADCHSN---DYIEKLKAEKDMCSLIEKAEKYVELRNDSGIFDKHEVCKVYMMRIEHAYYKYQD----QNEEDAGKLMDYLCNKIYTLDDEKRLRQRAMLCHVYYLAVHDKWHRARDLLLMSHMQAIVDHSDVDTQILYNRTICQLGLCAFRHGFIREAHQGLSEIQNTQRAKELLAQAVGTRQHEKTAEQEKIDRSRQV--PYHMHINVELMECVYLICSMLLEIPHMASCEFEMRRRMLSRSFHYQLKQSEKASLTGPPENTREHVVAASKAMLNGDWKKCQDYIVNDKMNQKVWNLFHNAETVKGMVVRRIQEESLRTYLLTYSTVYATVSLKKLADLFELSKKDVHSIISKMIIQEELSATLDEPTDCLIMHRVEPSRLQMLALNLSDKLQTLAENNEQI 830          

HSP 2 Score: 75.485 bits (184), Expect = 1.147e-13
Identity = 57/170 (33.53%), Postives = 98/170 (57.65%), Query Frame = -2
Query: 2053 MSRFFHALXXXXXXXXXXXXXXXERPI----AFDD-----SSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVL--KFYIRVIAELEEFTNTSWXXXXXXXXXXXXXXXX---LRQKIKKYNKDFEAQ--IADFRENSD 2514
            MSRFFHA       + S E+ V ++ +     F D     +   EDE+R+V++ ++KK+++L+GI+K  ++ K+ +D+ ++L  F+ L K+Y+K+    +   V   +FYIR + E+E++ N  W +K   S  +  +  A   LRQK+KKY KD + Q  + D+R N D
Sbjct:    1 MSRFFHAKEDSDSDTSSSEDEVEDQKVNKSAKFRDDLDFMAGPEEDEKRVVRAQKDKKFDELKGIIKQNRDAKSNKDLNRLLTGFDSLAKAYDKSKTVFQRQNVANPRFYIRSLVEIEDYVNKLWDDKDAKSALSKNNAKALPPLRQKLKKYIKDQQLQDLVTDYRVNPD 170          
BLAST of SMED30004178 vs. Ensembl Celegans
Match: eif-3.C (Eukaryotic translation initiation factor 3 subunit C [Source:UniProtKB/Swiss-Prot;Acc:O02328])

HSP 1 Score: 401.749 bits (1031), Expect = 4.452e-126
Identity = 221/562 (39.32%), Postives = 342/562 (60.85%), Query Frame = -2
Query:   79 WTTVDMYGRPEVKLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDIL-NRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKN----YGDDDKCRVYMRQLEHIYYRFDPTVGIKEEIPSYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQ--GTRLNRNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKL 1743
            WT V+      V  F   EE+T + ++ K+   +  R  +   R   V  L++L+++   +  G+G+ VKI   ++S L +     S+  M  E +   L+    ++D+L   +   +S+  ++ +++ K D   Y + G I+  ++ L+ E  KIL   D  S+   +Y EKL+ E  + SL     +Y+  +N    +   + C+VYM ++EH YY++      + E  + K M  L   I   D+  RLR RA+LCH+YYLA+HD W  ARD++ MS +   +D +D  TQIL+NR   QLGLCAFR G I+EAHQ L+E+Q + R KE+LAQ  GTR +   A  E++ R +    PYH HINV+++EC YL+ +ML ++ H    + + RR M+SR+FHY LK S++ +L G P+N +EHVVAASKA+ NGDWK   D+I +DKM + VW LF N E +K ++V +I+ ES++ +LL+ + V+ ++SLK L +++ELS+  VH +ISKMI+  +L A+LDEP++CLIMHR   S LQ+ AL L+DK+  LAE NE++
Sbjct:  281 WTPVNR--EKSVVHFDPKEEVTHDVMIKKLNEVMSARGKRTTDRNQHVANLRKLLEVSEEKELGLGINVKISFCIISALFELNAKISDH-MEYETFMTTLQTVNSLLDLLIGTDRVKLSVTYAEEDENLKDDTQEYRIQGSILIAVQRLDGELAKILQNADCHSN---DYIEKLKAEKDMCSLIEKAEKYVELRNDSGIFDKHEVCKVYMMRIEHAYYKYQD----QNEEDAGKLMDYLCNKIYTLDDEKRLRQRAMLCHVYYLAVHDKWHRARDLLLMSHMQAIVDHSDVDTQILYNRTICQLGLCAFRHGFIREAHQGLSEIQNTQRAKELLAQAVGTRQHEKTAEQEKIDRSRQV--PYHMHINVELMECVYLICSMLLEIPHMASCEFEMRRRMLSRSFHYQLKQSEKASLTGPPENTREHVVAASKAMLNGDWKKCQDYIVNDKMNQKVWNLFHNAETVKGMVVRRIQEESLRTYLLTYSTVYATVSLKKLADLFELSKKDVHSIISKMIIQEELSATLDEPTDCLIMHRVEPSRLQMLALNLSDKLQTLAENNEQI 830          

HSP 2 Score: 75.485 bits (184), Expect = 1.147e-13
Identity = 57/170 (33.53%), Postives = 98/170 (57.65%), Query Frame = -2
Query: 2053 MSRFFHALXXXXXXXXXXXXXXXERPI----AFDD-----SSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVL--KFYIRVIAELEEFTNTSWXXXXXXXXXXXXXXXX---LRQKIKKYNKDFEAQ--IADFRENSD 2514
            MSRFFHA       + S E+ V ++ +     F D     +   EDE+R+V++ ++KK+++L+GI+K  ++ K+ +D+ ++L  F+ L K+Y+K+    +   V   +FYIR + E+E++ N  W +K   S  +  +  A   LRQK+KKY KD + Q  + D+R N D
Sbjct:    1 MSRFFHAKEDSDSDTSSSEDEVEDQKVNKSAKFRDDLDFMAGPEEDEKRVVRAQKDKKFDELKGIIKQNRDAKSNKDLNRLLTGFDSLAKAYDKSKTVFQRQNVANPRFYIRSLVEIEDYVNKLWDDKDAKSALSKNNAKALPPLRQKLKKYIKDQQLQDLVTDYRVNPD 170          
BLAST of SMED30004178 vs. Ensembl Celegans
Match: eif-3.C (Eukaryotic translation initiation factor 3 subunit C [Source:UniProtKB/Swiss-Prot;Acc:O02328])

HSP 1 Score: 401.749 bits (1031), Expect = 4.452e-126
Identity = 221/562 (39.32%), Postives = 342/562 (60.85%), Query Frame = -2
Query:   79 WTTVDMYGRPEVKLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDIL-NRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKN----YGDDDKCRVYMRQLEHIYYRFDPTVGIKEEIPSYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQ--GTRLNRNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKL 1743
            WT V+      V  F   EE+T + ++ K+   +  R  +   R   V  L++L+++   +  G+G+ VKI   ++S L +     S+  M  E +   L+    ++D+L   +   +S+  ++ +++ K D   Y + G I+  ++ L+ E  KIL   D  S+   +Y EKL+ E  + SL     +Y+  +N    +   + C+VYM ++EH YY++      + E  + K M  L   I   D+  RLR RA+LCH+YYLA+HD W  ARD++ MS +   +D +D  TQIL+NR   QLGLCAFR G I+EAHQ L+E+Q + R KE+LAQ  GTR +   A  E++ R +    PYH HINV+++EC YL+ +ML ++ H    + + RR M+SR+FHY LK S++ +L G P+N +EHVVAASKA+ NGDWK   D+I +DKM + VW LF N E +K ++V +I+ ES++ +LL+ + V+ ++SLK L +++ELS+  VH +ISKMI+  +L A+LDEP++CLIMHR   S LQ+ AL L+DK+  LAE NE++
Sbjct:  281 WTPVNR--EKSVVHFDPKEEVTHDVMIKKLNEVMSARGKRTTDRNQHVANLRKLLEVSEEKELGLGINVKISFCIISALFELNAKISDH-MEYETFMTTLQTVNSLLDLLIGTDRVKLSVTYAEEDENLKDDTQEYRIQGSILIAVQRLDGELAKILQNADCHSN---DYIEKLKAEKDMCSLIEKAEKYVELRNDSGIFDKHEVCKVYMMRIEHAYYKYQD----QNEEDAGKLMDYLCNKIYTLDDEKRLRQRAMLCHVYYLAVHDKWHRARDLLLMSHMQAIVDHSDVDTQILYNRTICQLGLCAFRHGFIREAHQGLSEIQNTQRAKELLAQAVGTRQHEKTAEQEKIDRSRQV--PYHMHINVELMECVYLICSMLLEIPHMASCEFEMRRRMLSRSFHYQLKQSEKASLTGPPENTREHVVAASKAMLNGDWKKCQDYIVNDKMNQKVWNLFHNAETVKGMVVRRIQEESLRTYLLTYSTVYATVSLKKLADLFELSKKDVHSIISKMIIQEELSATLDEPTDCLIMHRVEPSRLQMLALNLSDKLQTLAENNEQI 830          

HSP 2 Score: 75.485 bits (184), Expect = 1.147e-13
Identity = 57/170 (33.53%), Postives = 98/170 (57.65%), Query Frame = -2
Query: 2053 MSRFFHALXXXXXXXXXXXXXXXERPI----AFDD-----SSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVL--KFYIRVIAELEEFTNTSWXXXXXXXXXXXXXXXX---LRQKIKKYNKDFEAQ--IADFRENSD 2514
            MSRFFHA       + S E+ V ++ +     F D     +   EDE+R+V++ ++KK+++L+GI+K  ++ K+ +D+ ++L  F+ L K+Y+K+    +   V   +FYIR + E+E++ N  W +K   S  +  +  A   LRQK+KKY KD + Q  + D+R N D
Sbjct:    1 MSRFFHAKEDSDSDTSSSEDEVEDQKVNKSAKFRDDLDFMAGPEEDEKRVVRAQKDKKFDELKGIIKQNRDAKSNKDLNRLLTGFDSLAKAYDKSKTVFQRQNVANPRFYIRSLVEIEDYVNKLWDDKDAKSALSKNNAKALPPLRQKLKKYIKDQQLQDLVTDYRVNPD 170          
BLAST of SMED30004178 vs. Ensembl Fly
Match: eIF3c (gene:FBgn0034258 transcript:FBtr0086836)

HSP 1 Score: 419.083 bits (1076), Expect = 1.922e-132
Identity = 226/575 (39.30%), Postives = 356/575 (61.91%), Query Frame = -2
Query:   55 WTTV---DMYGRPEVKLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILT-CHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKE--EIP-----SYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNR-NEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1743
            W TV    +  +P  K+F  D EI    +L K+   +  R  K+  R+ Q+D+L +L D+      G  + VKI  +++S +  Y    S P M LE+W  +LE+   ++ +L  N  DI M  S  E+ E++   P+ V GC +  +E L+DE+ K+L  C   S+D    Y  +L+ E  ++    LV +Y  +    ++++CR+Y+R++EH+YY+FDP V  K+  E+P     S   M KL  FI  KD+TDR+RTRAIL HIY+ A+HD WF+ARD++ MS L ++ID AD +T+IL+NR+   LGLCAFR+G +K+AH  L +L  +G+ KE+LAQG    R +E + E+   EK    P+H HIN++++EC YLVSAML ++ +    + D RR MIS+ F+  L++S+R +L G P++++EHVVAA+KA+  G+W+  A+ I + KM   VW LF   + ++ ++   IK ES++ +L + +NV+ S+S+  L ++YEL    VH +ISKMI++ +L ASLD+PS  + MHR+  S LQ  A++  DK++ L ++NEK+ D  +  +
Sbjct:  282 WETVVKGHVVEKP--KMFEKDAEIDVPLVLAKLLEIMSARGKKRTDRRLQIDLLFELRDISDQHNLGTAVSVKIHFNIISAIYDYNQKISEP-MKLEHWALLLEVMQSMMKLLLANA-DIIMSESVAEEHEEYATSPFYVRGCPLAAVERLDDEFVKLLKECDPHSND----YVSRLKDEVNVVKTIELVLQYFERSG-TNNERCRIYLRKIEHLYYKFDPEVLKKKRGELPATTSTSVDVMDKLCKFIYAKDDTDRIRTRAILAHIYHHAMHDNWFQARDLVLMSHLQDNIDAADPATRILYNRMMANLGLCAFRQGNVKDAHHCLVDLMVTGKPKELLAQGLLPQRQHERSAEQEKIEKQRQMPFHMHINLELLECVYLVSAMLLEIPYIAAHEFDARRRMISKTFYQQLRSSERQSLVGPPESMREHVVAAAKAMRCGNWQACANFIVNKKMNTKVWDLFYESDRVREMLTKFIKEESLRTYLFTYSNVYTSISIPSLAQMYELPVPKVHSIISKMIINEELMASLDDPSETVGMHRSEPSRLQALAMQFVDKVTNLVDVNEKVFDMKQGNF 847          

HSP 2 Score: 99.7525 bits (247), Expect = 5.256e-21
Identity = 66/133 (49.62%), Postives = 93/133 (69.92%), Query Frame = -2
Query: 2053 AFDDSSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTM--EADGVL-KFYIRVIAELEEFTNTSW---XXXXXXXXXXXXXXXXLRQKIKKYNKDFEAQIADFRENSD 2433
            AF  S + E+ +R+V+S +EK+YE+L  I+K ++NHK I+DI   L  FE+LT++Y+KA   +  E +G+  +FYIR +AELE+F N  W     +KNLSKNNSKSL  LRQK++KY KDFE  ++ FRE  D
Sbjct:   30 AFQFSDDEEEVKRVVRSTKEKRYENLTSIIKTIRNHKKIKDIPNTLSSFEDLTRAYQKALPVISKEENGITPRFYIRCLAELEDFINEVWEDREGRKNLSKNNSKSLGTLRQKVRKYIKDFEDDLSRFREAPD 162          
BLAST of SMED30004178 vs. Ensembl Fly
Match: eIF3c (gene:FBgn0034258 transcript:FBtr0340269)

HSP 1 Score: 419.083 bits (1076), Expect = 1.922e-132
Identity = 226/575 (39.30%), Postives = 356/575 (61.91%), Query Frame = -2
Query:   55 WTTV---DMYGRPEVKLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILT-CHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKE--EIP-----SYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNR-NEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1743
            W TV    +  +P  K+F  D EI    +L K+   +  R  K+  R+ Q+D+L +L D+      G  + VKI  +++S +  Y    S P M LE+W  +LE+   ++ +L  N  DI M  S  E+ E++   P+ V GC +  +E L+DE+ K+L  C   S+D    Y  +L+ E  ++    LV +Y  +    ++++CR+Y+R++EH+YY+FDP V  K+  E+P     S   M KL  FI  KD+TDR+RTRAIL HIY+ A+HD WF+ARD++ MS L ++ID AD +T+IL+NR+   LGLCAFR+G +K+AH  L +L  +G+ KE+LAQG    R +E + E+   EK    P+H HIN++++EC YLVSAML ++ +    + D RR MIS+ F+  L++S+R +L G P++++EHVVAA+KA+  G+W+  A+ I + KM   VW LF   + ++ ++   IK ES++ +L + +NV+ S+S+  L ++YEL    VH +ISKMI++ +L ASLD+PS  + MHR+  S LQ  A++  DK++ L ++NEK+ D  +  +
Sbjct:  282 WETVVKGHVVEKP--KMFEKDAEIDVPLVLAKLLEIMSARGKKRTDRRLQIDLLFELRDISDQHNLGTAVSVKIHFNIISAIYDYNQKISEP-MKLEHWALLLEVMQSMMKLLLANA-DIIMSESVAEEHEEYATSPFYVRGCPLAAVERLDDEFVKLLKECDPHSND----YVSRLKDEVNVVKTIELVLQYFERSG-TNNERCRIYLRKIEHLYYKFDPEVLKKKRGELPATTSTSVDVMDKLCKFIYAKDDTDRIRTRAILAHIYHHAMHDNWFQARDLVLMSHLQDNIDAADPATRILYNRMMANLGLCAFRQGNVKDAHHCLVDLMVTGKPKELLAQGLLPQRQHERSAEQEKIEKQRQMPFHMHINLELLECVYLVSAMLLEIPYIAAHEFDARRRMISKTFYQQLRSSERQSLVGPPESMREHVVAAAKAMRCGNWQACANFIVNKKMNTKVWDLFYESDRVREMLTKFIKEESLRTYLFTYSNVYTSISIPSLAQMYELPVPKVHSIISKMIINEELMASLDDPSETVGMHRSEPSRLQALAMQFVDKVTNLVDVNEKVFDMKQGNF 847          

HSP 2 Score: 99.7525 bits (247), Expect = 5.256e-21
Identity = 66/133 (49.62%), Postives = 93/133 (69.92%), Query Frame = -2
Query: 2053 AFDDSSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTM--EADGVL-KFYIRVIAELEEFTNTSW---XXXXXXXXXXXXXXXXLRQKIKKYNKDFEAQIADFRENSD 2433
            AF  S + E+ +R+V+S +EK+YE+L  I+K ++NHK I+DI   L  FE+LT++Y+KA   +  E +G+  +FYIR +AELE+F N  W     +KNLSKNNSKSL  LRQK++KY KDFE  ++ FRE  D
Sbjct:   30 AFQFSDDEEEVKRVVRSTKEKRYENLTSIIKTIRNHKKIKDIPNTLSSFEDLTRAYQKALPVISKEENGITPRFYIRCLAELEDFINEVWEDREGRKNLSKNNSKSLGTLRQKVRKYIKDFEDDLSRFREAPD 162          
BLAST of SMED30004178 vs. Ensembl Zebrafish
Match: eif3c (eukaryotic translation initiation factor 3, subunit C [Source:NCBI gene;Acc:334234])

HSP 1 Score: 406.371 bits (1043), Expect = 2.210e-127
Identity = 222/571 (38.88%), Postives = 348/571 (60.95%), Query Frame = -2
Query:   55 KLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFP--PYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFD-----PTVGIKEEIPSYKE------------MRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRL-NRNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1707
            K+FA   EI    ++ K+   L+ R  K   R +Q+++L  L  +      G G+ VKI  ++++ L  Y  + +   M  + WK+ L+   +++DIL  N N+I +  +  EDSE       P+ V GCI+  +E +++E+TKI+   D  S    EY + L+ E ++  +   + +YL  K    ++ CRVY+R++ H YY+FD      ++G++ E  S ++            M +L  FI  KD TDR+RT AILCHIY+ ALH  W++ARD+M MS L ++I  AD   QIL+NR  VQLG+CAFR+G IK+AH AL ++Q SGR KE+L QG  + N  E   E+   EK    P+H HIN++++EC YLVSAML ++ +    + D RR MIS+ FH+ L+  +R  L G P++++EHVVAASKA+  GDW+T    I ++KM   VW LF   + ++ ++V KI+ ES++ +L + ++V++S+S++ L E++EL   +VH +ISKMI++ +L ASLD+P+  ++MHRT  + LQ  AL+LA+K+  L E NE++ D  +  Y
Sbjct:  316 KMFAKGTEINTGVVVKKLSEILQARGKKGTDRAAQIELLHALAGIAAENNLGEGILVKIKFNIIASLYDYNPNLA-AFMKADMWKKCLDCIDELLDILFNN-NNIFIGENIAEDSENLAISDQPFRVRGCILTLVERMDEEFTKIMQNTDPHSQ---EYVDNLKDEGRVCGIIDRLLQYLETKG-STEEVCRVYLRRIMHTYYKFDYKAHRRSLGLQGETKSEQDQEESEGDDSAIIMDRLCKFIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGMIKDAHNALLDIQSSGRAKELLGQGLLMRNMQERNAEQEKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWRTCHSFIINEKMNSKVWDLFPEAKCVREMLVRKIQEESLRTYLFTYSSVYDSISMETLSEMFELELPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTSLQNMALQLAEKLGGLVENNERVFDLKQGVY 880          

HSP 2 Score: 101.679 bits (252), Expect = 1.522e-21
Identity = 52/126 (41.27%), Postives = 91/126 (72.22%), Query Frame = -2
Query: 2053 SSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWXXXXXXXXXXXXXX---XXLRQKIKKYNKDFEAQIADFRENSD 2421
            S + ED +R+V+SA++K++E+L  ++K ++N   I+DI+K LE+FE+L +++ K+   ++ +GV KFYIR++A+LE++ N  W +K+   K N  +    + LRQKI+KYN+DFE +IA ++EN +
Sbjct:   39 SDDEEDTKRVVRSAKDKRFEELTNLIKTIRNAIKIRDISKCLEEFEQLCRAFVKSKTIVDKEGVPKFYIRLLADLEDYLNQLWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFETEIASYKENPE 164          
BLAST of SMED30004178 vs. Ensembl Xenopus
Match: tnip1 (TNFAIP3 interacting protein 1 [Source:Xenbase;Acc:XB-GENE-945173])

HSP 1 Score: 400.593 bits (1028), Expect = 4.496e-125
Identity = 219/574 (38.15%), Postives = 345/574 (60.10%), Query Frame = -2
Query:   55 KLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPN-----DISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFD-----PTVGIKEEIPSYKE------------MRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRL-NRNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1707
            K+FA   EIT   ++ K+   L+ R  K   R +Q+D+L  L  +      G G+ VKI  ++V+ L  Y  + +   M  + WK+ L+   D++DIL  N N      IS  S ++ ++++    P  V GCI+  +E +++E+TKI+   D  S    EY + L+ E ++  +     +YL +K    ++ CRVY+R++ H YY+FD       +   +E  S ++            M +L  +I  KD TDR+RT AILCHIY+ ALH+ WF+ARD+M MS L ++I  AD   QIL+NR  VQLG+CAFR+G I++AH AL ++Q SGR KE+L QG  +    E   E+   EK    P+H HIN++++EC YLVSAML ++ +    + D RR MIS+ FH+ L+  +R  L G P++++EHVVAASKA+  GDWKT  + I ++KM   VW LF   E ++++++ KI+ ES++ +L + ++V++S+ +  L ++++L   +VH +ISKMI++ +L ASLD+P+  ++MH T  S LQ  AL+LA+K+  L E NE++ D  +  Y
Sbjct:  318 KMFAKGTEITPPIVVKKLNEILQARGKKGTDRAAQIDLLHLLAGIAEENNLGQGIAVKIKFNIVASLYDYNTNLAT-YMKADMWKKCLDSIHDLLDILFANSNMFIGEHISEDSENLSNTDQ----PLRVRGCILTLIERMDEEFTKIMQNTDPHSQ---EYVDNLKDEARVCEVIERAQKYLQEKG-STEEVCRVYLRRIMHTYYKFDYKAHQRQLSTGQESKSEQDQAENEAEDSAILMDRLCKYIYAKDRTDRIRTCAILCHIYHHALHNRWFQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGMIRDAHNALLDIQSSGRAKELLGQGLLMRTMQERNQEQEKIEKRRQIPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCKNFIINEKMNGKVWDLFPEAERVRSMLIRKIQEESLRTYLFTYSSVYDSIRMGILGDMFQLEIPTVHSIISKMIINEELMASLDQPTQTVVMHGTEPSSLQNTALQLAEKLGNLVENNERIFDHKQGSY 882          

HSP 2 Score: 100.908 bits (250), Expect = 4.602e-21
Identity = 53/133 (39.85%), Postives = 94/133 (70.68%), Query Frame = -2
Query: 2053 RPIAFDDSSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWXXXXXXXXXXXXXX---XXLRQKIKKYNKDFEAQIADFRENSD 2442
            +PI   D  + ED +R+V+SA++K++E+L  ++K ++N   I+D+TK LE+FE+L K++ KA   ++ +GV +FYIR++++LE++ N  W +K+   K N  +    + LRQK++KYN+DFEA IA +++N +
Sbjct:   34 QPIILSD--DEEDTKRVVRSAKDKRFEELTNLIKTIRNAMKIRDMTKCLEEFEQLGKAFIKAKNIVDKEGVPRFYIRLLSDLEDYLNELWEDKEGKKKMNKNNAKALSTLRQKLRKYNRDFEAPIAAYKQNPE 164          
BLAST of SMED30004178 vs. Ensembl Xenopus
Match: tnip1 (TNFAIP3 interacting protein 1 [Source:Xenbase;Acc:XB-GENE-945173])

HSP 1 Score: 396.356 bits (1017), Expect = 8.917e-124
Identity = 220/588 (37.41%), Postives = 346/588 (58.84%), Query Frame = -2
Query:   55 KLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPN-----DISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKE-----------------EIPSYKE--------------MRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRL-NRNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1707
            K+FA   EIT   ++ K+   L+ R  K   R +Q+D+L  L  +      G G+ VKI  ++V+ L  Y  + +   M  + WK+ L+   D++DIL  N N      IS  S ++ ++++    P  V GCI+  +E +++E+TKI+   D  S    EY + L+ E ++  +     +YL +K    ++ CRVY+R++ H YY+FD     ++                 EI S ++              M +L  +I  KD TDR+RT AILCHIY+ ALH+ WF+ARD+M MS L ++I  AD   QIL+NR  VQLG+CAFR+G I++AH AL ++Q SGR KE+L QG  +    E   E+   EK    P+H HIN++++EC YLVSAML ++ +    + D RR MIS+ FH+ L+  +R  L G P++++EHVVAASKA+  GDWKT  + I ++KM   VW LF   E ++++++ KI+ ES++ +L + ++V++S+ +  L ++++L   +VH +ISKMI++ +L ASLD+P+  ++MH T  S LQ  AL+LA+K+  L E NE++ D  +  Y
Sbjct:  282 KMFAKGTEITPPIVVKKLNEILQARGKKGTDRAAQIDLLHLLAGIAEENNLGQGIAVKIKFNIVASLYDYNTNLAT-YMKADMWKKCLDSIHDLLDILFANSNMFIGEHISEDSENLSNTDQ----PLRVRGCILTLIERMDEEFTKIMQNTDPHSQ---EYVDNLKDEARVCEVIERAQKYLQEKG-STEEVCRVYLRRIMHTYYKFDYKAHQRQLSTGQEGLSTYDGRKGDEIISRRKQDQAENEAEDSAILMDRLCKYIYAKDRTDRIRTCAILCHIYHHALHNRWFQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGMIRDAHNALLDIQSSGRAKELLGQGLLMRTMQERNQEQEKIEKRRQIPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCKNFIINEKMNGKVWDLFPEAERVRSMLIRKIQEESLRTYLFTYSSVYDSIRMGILGDMFQLEIPTVHSIISKMIINEELMASLDQPTQTVVMHGTEPSSLQNTALQLAEKLGNLVENNERIFDHKQGSY 860          

HSP 2 Score: 100.908 bits (250), Expect = 3.595e-21
Identity = 53/133 (39.85%), Postives = 94/133 (70.68%), Query Frame = -2
Query: 2053 RPIAFDDSSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWXXXXXXXXXXXXXX---XXLRQKIKKYNKDFEAQIADFRENSD 2442
            +PI   D  + ED +R+V+SA++K++E+L  ++K ++N   I+D+TK LE+FE+L K++ KA   ++ +GV +FYIR++++LE++ N  W +K+   K N  +    + LRQK++KYN+DFEA IA +++N +
Sbjct:   34 QPIILSD--DEEDTKRVVRSAKDKRFEELTNLIKTIRNAMKIRDMTKCLEEFEQLGKAFIKAKNIVDKEGVPRFYIRLLSDLEDYLNELWEDKEGKKKMNKNNAKALSTLRQKLRKYNRDFEAPIAAYKQNPE 164          
BLAST of SMED30004178 vs. Ensembl Mouse
Match: Eif3c (eukaryotic translation initiation factor 3, subunit C [Source:MGI Symbol;Acc:MGI:1926966])

HSP 1 Score: 400.208 bits (1027), Expect = 4.636e-125
Identity = 219/573 (38.22%), Postives = 347/573 (60.56%), Query Frame = -2
Query:   55 KLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEK---FDFPPYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKEEIP------------------SYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNR-NEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1707
            K+FA   EIT   ++ K+   L+ R  K   R +Q+++LQ L+ +      G+G+ VKI  ++++ L  Y  + +   M  E W+  L+   +++D L  + N I +  + +E+SE    FD  P  V GCI+  +E +++E+TKI+   D  S    EY E L+ E ++ ++   V  YL +K    ++ C++Y+R++ H YY+FD     ++  P                  S   M +L  +I  KD TDR+RT AILCHIY+ ALH  W++ARD+M MS L ++I  AD   QIL+NR  VQLG+CAFR+G  K+AH AL ++Q SGR KE+L QG  L    E   E+   E+    P+H HIN++++EC YLVSAML ++ +    ++D RR MIS+ FH+ L+  +R  L G P++++EHVVAASKA+  GDWKT    I ++KM   VW LF   ++++T++V KI+ ES++ +L + ++V++S+S++ L +++EL   +VH +ISKMI++ +L ASLD+P+  ++MHRT  +  Q  AL+LA+K+  L E NE++ D  +  Y
Sbjct:  314 KMFAKGTEITHAVVIKKLNEILQVRGKKGTDRATQIELLQLLVQIAAENNLGVGVIVKIKFNIIASLYDYNPNLAT-YMKPEMWQMCLDCINELMDTLVAHSN-IFVGENILEESENLHNFD-QPLRVRGCILTLVERMDEEFTKIMQNTDPHSQ---EYVEHLKDEAQVCAIIERVQRYLEEKG-TTEEICQIYLRRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTY 879          

HSP 2 Score: 102.449 bits (254), Expect = 1.000e-21
Identity = 61/164 (37.20%), Postives = 105/164 (64.02%), Query Frame = -2
Query: 2053 MSRFFHALXXXXXXXXXXXXXXXERPIAFDD-------SSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWXXXXXXXXXXXXXX---XXLRQKIKKYNKDFEAQIADFRENSD 2514
            MSRFF   S     S    E +V +P++ +        S + ED +R+V+SA++K++E+L  +++ ++N   I+D+TK LE+FE L K+Y KA   ++ +GV +FYIR++A+LE++ N  W +K+   K N  +    + LRQKI+KYN+DFE+ I ++++N +
Sbjct:    1 MSRFFTTGSDSESESSLSGEELVTKPVSGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNELWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITNYKQNPE 164          
BLAST of SMED30004178 vs. Ensembl Mouse
Match: Eif3c (eukaryotic translation initiation factor 3, subunit C [Source:MGI Symbol;Acc:MGI:1926966])

HSP 1 Score: 100.523 bits (249), Expect = 4.565e-23
Identity = 61/164 (37.20%), Postives = 105/164 (64.02%), Query Frame = -2
Query: 2053 MSRFFHALXXXXXXXXXXXXXXXERPIAFDD-------SSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWXXXXXXXXXXXXXX---XXLRQKIKKYNKDFEAQIADFRENSD 2514
            MSRFF   S     S    E +V +P++ +        S + ED +R+V+SA++K++E+L  +++ ++N   I+D+TK LE+FE L K+Y KA   ++ +GV +FYIR++A+LE++ N  W +K+   K N  +    + LRQKI+KYN+DFE+ I ++++N +
Sbjct:    1 MSRFFTTGSDSESESSLSGEELVTKPVSGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNELWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITNYKQNPE 164          
BLAST of SMED30004178 vs. UniProt/SwissProt
Match: sp|B4MRZ8|EIF3C_DROWI (Eukaryotic translation initiation factor 3 subunit C OS=Drosophila willistoni OX=7260 GN=eIF3c PE=3 SV=1)

HSP 1 Score: 433.721 bits (1114), Expect = 6.496e-137
Identity = 229/576 (39.76%), Postives = 365/576 (63.37%), Query Frame = -2
Query:   55 GWTTV---DMYGRPEVKLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILT-CHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKE--EIPSYKE-----MRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNR-NEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1746
            GW TV    +  +P  K+F  D EI    +L K+   +  R  K+  R+ Q+D+L +L D+      G+ + VKI  +++S +  Y    S P M LE+W  +LE+   ++ +L  NP DI +  S  E+ E+++  PY++ GC +  +E L+DE+TK+L  C   S+D    Y  +L+ E  ++    LV +Y  + N  ++++CR+Y+R++EH+YY+FDP V  K+  +IP+  +     M +L  FI  KD+TDR+RTRAIL HIY+ A+HD WF+ARD++ MS L ++ID AD ST+IL+NR+   LGLCAFR+  +K+AH  L +L  +G+ KE+LAQG    R +E + E+   EK    P+H HIN++++EC YLVSAML ++ +    + D RR MIS+ F+  L++S+R +L G P++++EHVVAA+KA+  G+W+  A+ I + KM   VW LF   + ++ ++V  IK ES++ +L + +NV+ S+S+  L E+YEL    VH +ISKMI++ +L ASLD+PS  ++MHR+  S LQ  A++  DK++ L ++NEK+ D  +  +
Sbjct:  282 GWETVVKGHVVEKP--KMFEKDAEIDIPLVLAKLLEIMSARGKKRTDRRLQIDLLFELRDISDQHELGVPISVKIHFNIISAIFDYNQKISEP-MKLEHWALLLEVMQSMMKLLLANP-DIQLSESVAEEHEEYNATPYLIRGCPLAAVERLDDEFTKLLKECDPHSND----YVSRLKDEINVVKTIELVLQYF-EVNGSNNERCRIYLRKVEHLYYKFDPEVFKKKRGDIPNTTQTSVDIMDRLCKFIYAKDDTDRIRTRAILTHIYHHAMHDNWFQARDLILMSHLQDNIDAADPSTRILYNRMMANLGLCAFRQENVKDAHHCLVDLMVTGKAKELLAQGLLPQRQHERSAEQEKIEKQRQMPFHMHINLELLECVYLVSAMLLEIPYIAAHEFDARRRMISKTFYQQLRSSERQSLVGPPESMREHVVAAAKAMRCGNWQACANFIVNKKMNTKVWDLFYESDRVRDMLVKFIKEESLRTYLFTYSNVYTSISIPSLAEMYELPVQKVHSIISKMIINEELMASLDDPSETVVMHRSEPSRLQALAMQFVDKVTNLVDVNEKVFDMKQGNF 848          

HSP 2 Score: 102.449 bits (254), Expect = 7.620e-21
Identity = 66/134 (49.25%), Postives = 96/134 (71.64%), Query Frame = -2
Query: 2059 RPIAFDDSSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTM--EADGVL-KFYIRVIAELEEFTNTSWX---XXXXXXXXXXXXXXXLRQKIKKYNKDFEAQIADFREN 2442
            +  AF  S + E+ +R+V+S +EK+YE+L  I+K+++NHK I+DI+  L  FE+LTK+Y+KA   +  E +G+  +FYIR +AELE+F N  W     +KNLSKNN+KSL  LRQK++KY KDFE  ++ FREN
Sbjct:   27 KATAFQFSDDEEEVKRVVRSTKEKRYENLTAIIKSIRNHKKIRDISNTLTSFEDLTKAYQKALPVISKEENGITPRFYIRCLAELEDFINEVWEDRDGRKNLSKNNAKSLGTLRQKVRKYIKDFEDDLSRFREN 160          
BLAST of SMED30004178 vs. UniProt/SwissProt
Match: sp|Q17Q06|EIF3C_AEDAE (Eukaryotic translation initiation factor 3 subunit C OS=Aedes aegypti OX=7159 GN=eIF3-S8 PE=3 SV=1)

HSP 1 Score: 427.943 bits (1099), Expect = 8.320e-135
Identity = 223/568 (39.26%), Postives = 357/568 (62.85%), Query Frame = -2
Query:   79 GWTTVD---MYGRPEVKLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILT-CHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTV--GIKEEIP-----SYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNR-NEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKL 1746
            GW  V+        + K+FA D EI    ++ K+   +  R  K+  RK Q++ L++L  +      G  +  KI  ++VS +  Y    S P M LE+W ++LE    ++ +L  N +DI +  + +E++E+++  PY + GCI+  +E L+DE+TK+L  C   S+D    Y ++L+ E  + S+   V +Y+ +    D + CRVY+R+++H+YY+FDP V    K+E+P     S  EM +L  F+  KD+TDRLRTRAIL HI++ ALHD WF+ARD++ MS L   I  +D  TQIL+NR    LGLCAFR G +K+AHQ L +L  +G+ KE+LAQG    R NE + E+   EK    P+H HIN++++EC YLVSAML ++ +    + D RR MIS+ F+  L++S+R +L G P++++EHVVAA+KA+ +G+W   +  I + KM   VW LF   + ++ +++  IK ES++ +L + +NV+ S+S+ YL E++EL +  VH LISKMI++ +L ASLD+P+  +++HR+  S LQ  +++L+DK++ L + NE++
Sbjct:  281 GWEVVNGNRSTSAEQPKMFAKDAEIDVNVVINKLNEVMAARGKKRTDRKLQIEFLRELRTIADTHNLGDAVAAKIRFNIVSAIFDYNPKVSEP-MKLEHWSKLLEEIQALIKLLLAN-DDIVLSETILEENEEYETAPYKIRGCILTAVERLDDEFTKLLKECDPHSND----YVDRLKDEVTVSSVIEQVVKYIERLG-NDTETCRVYLRKIDHLYYKFDPNVLKKKKKELPASTLTSVDEMDRLCRFVYAKDQTDRLRTRAILSHIFHHALHDNWFQARDLVLMSHLQETIHHSDPPTQILYNRTMANLGLCAFRHGNVKDAHQCLVDLMMTGKPKELLAQGLVPQRQNERSLEQEKVEKQRQMPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKTFYQQLRSSERQSLVGPPESMREHVVAAAKAMRHGNWNACSTFIVNKKMNVKVWDLFYEADRVREMLIKFIKEESLRTYLFTYSNVYASISVPYLAEMFELPKSKVHSLISKMIINEELMASLDDPTETVVLHRSEPSRLQALSMQLSDKVTNLVDSNERI 841          

HSP 2 Score: 97.4413 bits (241), Expect = 2.718e-19
Identity = 71/160 (44.38%), Postives = 101/160 (63.12%), Query Frame = -2
Query: 2059 MSRFFHALXXXXXXXXXXXXXXXERPIA--FDDSSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHK--TMEADGVL-KFYIRVIAELEEFTNTSWXXXXXXXXXXXXXXX---XLRQKIKKYNKDFEAQIADFREN 2514
            MSRFF    SDSDS  S +  VV RP A  F  S E ED +R+V+S +EK+YEDL  I+KN++N+K I+D++ +L  FEELT+++ KA    T   +GV  +F IR +AELE+F N  W +K+     +  +      LRQK +KY KDF++ +  FRE+
Sbjct:    1 MSRFFAGGGSDSDSESSSDSEVVARPAAPQFTFSDEEEDVKRVVRSTKEKRYEDLSNIIKNIRNYKKIKDMSSMLTSFEELTRAHTKALPVITKVENGVTPRFIIRALAELEDFINMVWEDKEGRKNLSKNNSKSLGTLRQKFRKYIKDFDSDLKKFRES 160          
BLAST of SMED30004178 vs. UniProt/SwissProt
Match: sp|B4LNA1|EIF3C_DROVI (Eukaryotic translation initiation factor 3 subunit C OS=Drosophila virilis OX=7244 GN=eIF3c PE=3 SV=1)

HSP 1 Score: 427.172 bits (1097), Expect = 1.584e-134
Identity = 229/577 (39.69%), Postives = 362/577 (62.74%), Query Frame = -2
Query:   55 WTTV---DMYGRPEVKLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILT-CHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKE--EIP-------SYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNR-NEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1743
            W TV   ++  +P  K+F  D EI    +L K+   +  R  K+  R+ Q+D+L +L D+      G  + VKI  +++S +  Y    S P M LE+W  +LE+   ++ +L  NP +I+M  S  E+ E++   PY + GC +  +E L+DE+TK+L  C   S+D    Y  +L+ E  ++    LV +Y  +    ++++CR+Y+R++EH+YY+FDP V  ++  E+P       S + M KL  FI  KD+TDR+RTRAIL HIY+ A+HD WF+ARD++ MS L ++ID AD ST+IL+NR+   LGLCAFR+  IK+AH  L +L  +G+ KE+LAQG    R +E + E+   EK    P+H HIN++++EC YLVSAML ++ +    + D RR MIS+ F+  L++S+R +L G P++++EHVVAA+KA+  G+W+  A+ I + KM   VW LF   E ++ ++V  IK ES++ +L + +NV+ S+S+  L ++YEL    VH +ISKMI++ +L ASLD+PS  ++MHR+  S LQ  A++  DK++ L ++NEK+ D  +  +
Sbjct:  286 WETVVKGNVVEKP--KMFEKDAEIDIPLVLAKLVEIMSARGKKRTDRRLQIDLLFELRDISEQHELGTPISVKIHFNIISAIFDYNQKISEP-MKLEHWALLLEVMQSMLKLLLANP-EINMNESVAEEHEEYGAAPYFIRGCPLAAVERLDDEFTKLLKECDPHSND----YVSRLKDEINVVKTIELVVQYFERCG-SNNERCRIYLRKIEHLYYKFDPEVLKRKRGELPAAGTAPSSVEVMDKLCKFIYAKDDTDRIRTRAILAHIYHHAMHDNWFQARDLVLMSHLQDNIDAADPSTRILYNRMMANLGLCAFRQENIKDAHHCLVDLMVTGKPKELLAQGLLPQRQHERSAEQEKIEKQRQMPFHMHINLELLECVYLVSAMLLEIPYIAAHEFDARRRMISKTFYQQLRSSERQSLVGPPESMREHVVAAAKAMRCGNWQACANFIVNKKMNTKVWDLFYESERVREMLVKFIKEESLRTYLFTYSNVYTSISIPSLAQMYELPLPKVHSIISKMIINEELMASLDDPSETVVMHRSEPSRLQALAMQFVDKVTNLVDVNEKVFDMKQGNF 853          

HSP 2 Score: 101.293 bits (251), Expect = 1.685e-20
Identity = 67/132 (50.76%), Postives = 92/132 (69.70%), Query Frame = -2
Query: 2053 FDDSSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTM--EADGVL-KFYIRVIAELEEFTNTSW---XXXXXXXXXXXXXXXXLRQKIKKYNKDFEAQIADFRENSD 2430
            F  S + E+ +R+V+S +EK+YE+L GI+K ++NHK I+DI   L  FE+LT++Y KA   +  E +G+  +FYIR +AELE+F N  W     +KNLSKNNSKSL  LRQK++KY KDFE  +A FRE  D
Sbjct:   31 FQFSDDEEEVKRVVRSTKEKRYENLTGIIKTIRNHKKIKDIPNTLSSFEDLTRAYTKALPVISKEENGITPRFYIRCLAELEDFINEVWEDREGRKNLSKNNSKSLGTLRQKVRKYIKDFEEDLARFREAPD 162          
BLAST of SMED30004178 vs. UniProt/SwissProt
Match: sp|B4KN00|EIF3C_DROMO (Eukaryotic translation initiation factor 3 subunit C OS=Drosophila mojavensis OX=7230 GN=eIF3c PE=3 SV=1)

HSP 1 Score: 427.172 bits (1097), Expect = 1.915e-134
Identity = 229/577 (39.69%), Postives = 361/577 (62.56%), Query Frame = -2
Query:   55 WTTV---DMYGRPEVKLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILT-CHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKE--EIP-------SYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNR-NEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1743
            W TV   ++  +P  K+F  D EI    +L K+   +  R  K+  R+ Q+D+L +L D+      G  + VKI  +++S +  Y    S P M LE+W  +LE+   ++ +L  NP DI M  S  E+ E++   P+ + GC +  +E L+DE+TK+L  C   S+D    Y  +L+ E  ++    LV +Y  +    ++++CR+Y+R++EH+YY+FDP V  ++  E+P       S + M KL  FI  KD+TDR+RTRAIL HIY+ A+HD WF+ARD++ MS L ++ID AD ST+IL+NR+   LGLCAFR+  IK+AH  L +L  +G+ KE+LAQG    R +E + E+   EK    P+H HIN++++EC YLVSAML ++ +    + D RR MIS+ F+  L++S+R +L G P++++EHVVAA+KA+  G+W+  A+ I + KM   VW LF   E ++ ++V  IK ES++ +L + +NV+ S+S+  L ++YEL    VH +ISKMI++ +L ASLD+PS  ++MHR+  S LQ  A++  DK++ L ++NEK+ D  +  +
Sbjct:  286 WETVVKGNVVEKP--KMFEKDAEIDIPLVLAKLIEIMSARGKKRTDRRLQIDLLFELRDIAEQHALGTPISVKIHFNIISAIFDYNQKISEP-MKLEHWALLLEVMQSMMKLLLANP-DIIMNESVAEEHEEYVTAPFYIRGCPLAAVERLDDEFTKLLKECDPHSND----YVSRLKDEINVVKTIELVVQYFERCG-NNNERCRIYLRKIEHLYYKFDPEVLKRKRGELPAAGTAPSSVEVMDKLCKFIYAKDDTDRIRTRAILAHIYHHAMHDNWFQARDLVLMSHLQDNIDAADPSTRILYNRMMANLGLCAFRQENIKDAHHCLVDLMVTGKPKELLAQGLLPQRQHERSAEQEKIEKQRQMPFHMHINLELLECVYLVSAMLLEIPYIAAHEFDARRRMISKTFYQQLRSSERQSLVGPPESMREHVVAAAKAMRCGNWQACANFIVNKKMNTKVWDLFYESERVREMLVKFIKEESLRTYLFTYSNVYTSISIPSLAQMYELPLPKVHSIISKMIINEELMASLDDPSETVVMHRSEPSRLQALAMQFVDKVTNLVDVNEKVFDMKQGNF 853          

HSP 2 Score: 98.5969 bits (244), Expect = 1.097e-19
Identity = 65/132 (49.24%), Postives = 91/132 (68.94%), Query Frame = -2
Query: 2053 FDDSSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTM--EADGVL-KFYIRVIAELEEFTNTSW---XXXXXXXXXXXXXXXXLRQKIKKYNKDFEAQIADFRENSD 2430
            F  S + E+ +R+V+S +EK+YE+L  I+K ++NHK I+DI   L  FE+LT++Y KA   +  E +G+  +FYIR +AELE+F N  W     +KNLSKNN+KSL  LRQK++KY KDFE  +A FRE  D
Sbjct:   31 FQFSDDEEEVKRVVRSTKEKRYENLTSIIKTIRNHKKIKDIPNTLSSFEDLTRAYTKALPVISKEENGITPRFYIRCLAELEDFINEVWEDREGRKNLSKNNAKSLGTLRQKVRKYIKDFEEDLARFREAPD 162          
BLAST of SMED30004178 vs. UniProt/SwissProt
Match: sp|B4J789|EIF3C_DROGR (Eukaryotic translation initiation factor 3 subunit C OS=Drosophila grimshawi OX=7222 GN=eIF3c PE=3 SV=1)

HSP 1 Score: 425.631 bits (1093), Expect = 8.732e-134
Identity = 230/587 (39.18%), Postives = 360/587 (61.33%), Query Frame = -2
Query:   55 GWTTV---DMYGRPEVKLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILT-CHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTV-----GIKEEI-------------PSYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNR-NEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1746
            GW TV   ++  +P  K+F  D EI    +L K+   +  R  K+  R+ Q+D+L +L D+      G  + +KI  S++S +  Y    S P M LE+W  +LE+   ++ +L  NP DI+M  S  E+ E++   P+ V GC +  +E L+DE+TK+L  C   S+D    Y  +L+ E  ++    LV +Y       ++++CR+Y+R++EH+YY+FDP V     G ++                S + M KL  FI  KD+TDR+RTRAIL HIY+ A+HD WF+ARD++ MS L ++ID AD ST+IL+NR+   LGLCAFR+  IK+AH  L +L  +G+ KE+LAQG    R +E + E+   EK    P+H HIN++++EC YLVSAML ++ +    + D RR MIS+ F+  L++S+R +L G P++++EHVVAA+KA+  G+W+  A+ I + KM   VW LF   E ++ ++V  IK ES++ +L + +NV+ S+S+  L ++YEL    VH +ISKMI++ +L ASLD+PS  ++MHR+  S LQ  A++  DK++ L ++NEK+ D  +  +
Sbjct:  287 GWETVVKGNVVEKP--KMFEKDAEIDVPLVLAKLIEIMSARGKKRTDRRLQIDLLFELRDISEQHSLGTAVAIKIHFSIISAIFDYNLKISEP-MKLEHWALLLEVMQSMMKLLLANP-DINMNESIAEEHEEYATAPFYVRGCPLAAVERLDDEFTKLLKECDPHSND----YVSRLKDEVNVVKTIELVVQYFELSG-SNNERCRIYLRKIEHLYYKFDPEVLKRKRGEQQPATGAAGATPAAPVQSSVEVMDKLCKFIYAKDDTDRIRTRAILAHIYHHAMHDNWFQARDLVLMSHLQDNIDAADPSTRILYNRMMANLGLCAFRQENIKDAHHCLVDLMVTGKPKELLAQGLLPQRQHERSAEQEKIEKQRQMPFHMHINLELLECVYLVSAMLLEIPYIAAHEFDARRRMISKTFYQQLRSSERQSLVGPPESMREHVVAAAKAMRCGNWQACANFIVNKKMNTKVWDLFYESERVREMLVKFIKEESLRTYLFTYSNVYTSISIPSLSQMYELPLPKVHSIISKMIINEELMASLDDPSETVVMHRSEPSRLQALAMQFVDKVTNLVDVNEKVFDMKQGNF 864          

HSP 2 Score: 97.8265 bits (242), Expect = 1.813e-19
Identity = 66/132 (50.00%), Postives = 91/132 (68.94%), Query Frame = -2
Query: 2053 FDDSSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTM--EADGVL-KFYIRVIAELEEFTNTSW---XXXXXXXXXXXXXXXXLRQKIKKYNKDFEAQIADFRENSD 2430
            F  S + E+ +R+V+S +EK+YE+L  I+K ++NHK I+DI   L  FE+LT++Y KA   +  E +G+  +FYIR +AELE+F N  W     +KNLSKNNSKSL  LRQK++KY KDFE  +A FRE  D
Sbjct:   31 FQFSDDEEEVKRVVRSTKEKRYENLTSIIKTIRNHKKIKDIPNTLSSFEDLTRAYTKALPVISKEENGITPRFYIRCLAELEDFINEVWEDREGRKNLSKNNSKSLGTLRQKVRKYIKDFEDDLARFREAPD 162          
BLAST of SMED30004178 vs. TrEMBL
Match: E2F3W6 (Eukaryotic translation initiation factor 3 subunit C (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 503.056 bits (1294), Expect = 1.932e-167
Identity = 242/429 (56.41%), Postives = 320/429 (74.59%), Query Frame = -2
Query:   79 PPYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKEEIP------SYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNRNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKL 1347
            PPY + GCII   EH++DEYTKIL   D    +  +Y EKL+FETK+  LC+ ++ YL  K Y  +D CR Y+R++EH+YYRFD      E +       SY+EM+ L  +I  KD+TDRLRTRA+LCHIYYLALHD+W+EARDMMAMS L N IDR+DASTQIL+NR TVQLGLCAFR+G IK++HQALA+LQGSGR+KE+LAQG   NR E T +E  REK  L PYH+HIN++++EC YLVSAML+DVNHC     DGRR MISRNFH+VLK+S+R TL G P+ +++HVVAASKALF GDW+    +I + KM   VW LF     +K ++++KIK+E+++ FLL  +++ +SLSL +L + ++L    +HQ+ISKMIL  +L ASL++P+NCLIMHR+  S LQ  AL+LA++++QL ELNE+L
Sbjct:    3 PPYRLHGCIINLFEHMDDEYTKILQNID---ARAPDYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEIKIIHQIISKMILMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERL 428          
BLAST of SMED30004178 vs. TrEMBL
Match: K1P5V7 (Eukaryotic translation initiation factor 3 subunit C OS=Crassostrea gigas OX=29159 GN=CGI_10010150 PE=3 SV=1)

HSP 1 Score: 460.299 bits (1183), Expect = 3.166e-143
Identity = 229/548 (41.79%), Postives = 360/548 (65.69%), Query Frame = -2
Query:   73 KLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTV--GIKEEIPSYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNR-NEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQD 1707
            K+FA D E+  E+++ K+   +  R  K   R  Q+ +L++L  +      G  + +KIM  ++S +  Y  + +  CM  E W++ L    +++D++  NP DI++  + +E+SE    PPY V GC++  +E +++E+TK+L   D  S    EY ++L+ E ++  +   +  YL  +    ++ CRVY+R++EH+YY+FDP      K E  S+K+M ++  FI  KD TDRLRTR++LC IY+ ALHD W++ARD+M MS L + I  +D  TQIL+NR  VQLGLCAFR+G I++AH AL ++Q  GR KE+LAQG  L R +E TPE+   EK  L PYH HIN++++EC YLVSAML +V +    + D RR MIS+NFH+V++ S+R  L G P++++EHVVAASKA+  G+WK   ++I ++KM   VW LF   E ++ ++  KI+ ES++ +L + ++V++SLSL+ L E++E+ Q  VH +ISKMI++ +L ASLDEP++ ++MHRT  + LQ  AL+L++K+S L + NE++ +
Sbjct:  292 KMFAKDTEVNHEAVIKKLNEIISARGKKGTDRNEQIALLKELQSISNANNLGPAISMKIMFHIISAIYDYNPNIAT-CMRSEMWEKCLAGVSELLDMVEANP-DINIGENILEESENVTTPPYRVRGCVLTIVERMDEEFTKMLQACDAHS---TEYVDRLKDEKEVCVILDRLQTYLVPRG-TTEEICRVYLRRIEHMYYKFDPEAYDNPKLENKSFKDMEEMCKFIYAKDLTDRLRTRSMLCQIYHQALHDRWYQARDLMLMSHLQDTIQHSDVPTQILYNRTMVQLGLCAFRKGNIRDAHNALVDIQSGGRAKELLAQGLLLQRQHERTPEQEKIEKRRLLPYHMHINLELLECVYLVSAMLIEVPYMAAHEMDARRRMISKNFHHVMRMSERQALTGPPESMREHVVAASKAMKTGNWKECKNYIINEKMNAKVWELFYKSETVQEMVTSKIQEESLRTYLFTYSSVYDSLSLETLAEMFEIDQGVVHSIISKMIINEELMASLDEPTHTVVMHRTEPTRLQSLALQLSEKVSSLVDNNERIME 833          

HSP 2 Score: 110.153 bits (274), Expect = 1.013e-20
Identity = 61/134 (45.52%), Postives = 98/134 (73.13%), Query Frame = -2
Query: 2053 RPIAFDDSSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADG-VLKFYIRVIAELEEFTNTSW---XXXXXXXXXXXXXXXXLRQKIKKYNKDFEAQIADFRENSD 2442
            RP+A+  S + ++ +RIV+SA++K++++L+ I+K + NHK I+D+  VL DFEEL K+Y+K+ K +E +  + +F++R + ELE+F +  W     +K +SKNN+K L  LRQK+KKYN+DFE+ IA +REN D
Sbjct:   32 RPVAYAFSDDEDEPKRIVRSAKDKRFDELREIIKKMGNHKKIKDMASVLTDFEELGKAYDKSKKVIEKENQIPRFFLRCLVELEDFVSECWEDREGRKQMSKNNAKGLTTLRQKLKKYNRDFESDIATYRENPD 165          
BLAST of SMED30004178 vs. TrEMBL
Match: A0A1J1IYL2 (Eukaryotic translation initiation factor 3 subunit C OS=Clunio marinus OX=568069 GN=CLUMA_CG017966 PE=3 SV=1)

HSP 1 Score: 452.21 bits (1162), Expect = 1.190e-141
Identity = 238/573 (41.54%), Postives = 361/573 (63.00%), Query Frame = -2
Query:   55 NGWTTVDMYGRPE-VKLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILT-CHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTV-----GIKEEIPSYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNR-NEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1749
             GW TV  YG  E  K+FA D EI    +L+K+   +  R  KK  RK Q++ L +L  +      G  L VKI  ++VS +  Y    S P M +E W ++LE+  D++ +L  N NDI +  S  +++E+++  PY + GC++  +E L+DE+ K+L  C   S+D    Y E+L+ E  +  L   V +Y+  +     + CRVY+R+++H+YY+FDP V     G  E   S  EM KL  FI   D TDRLRTRAIL HI++ ALHD WF+ARD++ MS L   I  +D STQIL+NR+   LGLCAFR+G IK+AHQ L EL  + + KE+LAQG    R +E + E+   EK    P+H HIN++++EC YLVSAML ++ +    + D RR MIS+ F+  L++S+R +L G P++++EHVVAASKA+ +G+WK  ++ I + KM   VW LF   + ++ ++V  IK ES++ +L + +NV+ S+S+ YL E+Y+L +  VH +ISKMI++ +L ASLD+P+  ++MHR+  S LQ  +++LADKI+ L + NE++ +A +P +
Sbjct:  281 GGWETVPKYGASEKPKMFAKDAEIDIHIVLSKLNEVMSNRGKKKTDRKLQIEFLHELKTIAEQHNLGAALAVKIRFNIVSAIFDYNLKISEP-MKIEYWSKLLEVMADLMKLLLVNLNDIKLSESITDETEEYETKPYRLRGCVLTAVERLDDEFIKLLKECDPHSND----YVERLKDEVTVTKLIEQVLKYVEVQG-TPLEICRVYLRKIDHLYYKFDPNVLKKKKGQFENRTSVDEMEKLCHFIYANDNTDRLRTRAILSHIFHHALHDNWFQARDLVLMSHLQETIQHSDPSTQILYNRMMANLGLCAFRQGNIKDAHQCLIELMMTTKPKELLAQGLLPQRQHERSVEQEKVEKQRQMPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKTFYQQLRSSERQSLVGPPESMREHVVAASKAMRHGEWKACSEFIVNKKMNTKVWDLFYEADRVREMLVKFIKEESLRTYLFTYSNVYGSISVPYLSEMYDLPKLKVHSIISKMIINEELMASLDDPTETVVMHRSEPSRLQALSMQLADKITNLVDANERIFEAKQPNF 847          

HSP 2 Score: 97.4413 bits (241), Expect = 7.240e-17
Identity = 61/128 (47.66%), Postives = 90/128 (70.31%), Query Frame = -2
Query: 2053 SESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTM--EADGVL-KFYIRVIAELEEFTNTSWX---XXXXXXXXXXXXXXXLRQKIKKYNKDFEAQIADFRENSD 2418
            S+ ED +R+V+S +EK+YE+L  I+K+++NH+ I+DI  +L  FE+ T++Y KA   +  E  G++ +F IR I ELE+F N +W     +KN+SKNN KSL  LRQK +KY KDFE+++  FREN D
Sbjct:   37 SDDEDVKRVVRSQKEKRYEELTNIIKSIRNHRKIKDIGSILSSFEDFTRAYTKAQPVIIKEEKGIIPRFVIRSIVELEDFINVTWEDKDGRKNMSKNNGKSLGTLRQKFRKYIKDFESEMKKFRENPD 164          
BLAST of SMED30004178 vs. TrEMBL
Match: A0A2T7PD49 (Eukaryotic translation initiation factor 3 subunit C OS=Pomacea canaliculata OX=400727 GN=C0Q70_06733 PE=3 SV=1)

HSP 1 Score: 449.514 bits (1155), Expect = 2.009e-141
Identity = 235/550 (42.73%), Postives = 354/550 (64.36%), Query Frame = -2
Query:   70 KLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPT---VGIKEEIPSYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNR-NEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDA 1707
            K+FA D+EI  E+++ K+   +  R  K   R   +D+L +L ++      G  + VKI+ ++++ +  Y  + +  CM  E W+  LE    ++D+L R   +I++    +E++E F+  PY V GCI+  +E +++E+TK+L   D  S    E+ E+L+ E K+  L   +  Y+ K    ++  CR Y+R++EH+Y++FDPT   V   + + S K M KL  FI  KD TDRLRTRAILC IY+ ALHD WF+ARD+M MS L ++I  +D  TQIL+NR  VQLGLCAFR+G +++AH AL ++Q S R KE+LAQG    R +E TPE+   EK  L PYH HIN++++EC YLVSAML ++ +    + D RR MIS+NFH+V+K S+R TL G P++++EHVVAASKA+  GDW+   + I ++KM   VW LF   ++++ +I  KI+ ES++ +L   ++V++S+SL YL  ++EL    VH +ISKMI+  +L ASLDEPS  L MHRT  + LQ  AL+LA+K++ L E NE++ + 
Sbjct:  263 KMFAKDQEINHEAVVKKLYEIVAARGKKGTDRSQMIDMLVELKNVSDANNLGPAMHVKILFNIMAAIFDYNPNIAT-CMRNEMWEMCLETMTTLMDMLTRR-EEINVGEKILEENENFETVPYRVRGCILTVMERVDEEFTKMLQACDAHS---TEFVERLKDEQKVCKLLEDLEIYVEKHGTSEE-ICRCYLRRIEHLYFKFDPTAFDVPADKSVTSEKLMDKLCKFIYAKDLTDRLRTRAILCQIYHHALHDRWFQARDLMLMSHLQDNIQHSDVPTQILYNRTLVQLGLCAFRQGHVRDAHNALVDIQSSNRAKELLAQGLVPQRQHERTPEQEKIEKRRLLPYHMHINLELLECVYLVSAMLLEIPYMAAHELDVRRRMISKNFHHVMKMSERQTLTGPPESMREHVVAASKAMKAGDWRACKNFIINEKMNAKVWDLFHQADKVRDLIRSKIQEESLRTYLFCYSSVYDSISLPYLALMFELETPVVHSIISKMIIGEELMASLDEPSQVLSMHRTEPTRLQSLALQLAEKVASLVENNERIMEV 806          

HSP 2 Score: 113.62 bits (283), Expect = 6.751e-22
Identity = 76/159 (47.80%), Postives = 110/159 (69.18%), Query Frame = -2
Query: 2059 MSRFFHALXXXXXXXXXXXXXXXERPI----AFDDSSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWXX---XXXXXXXXXXXXXXLRQKIKKYNKDFEAQIADFREN 2514
            MSRFF A S     ++SEEEV  +RP     A+  S + ED RRIV+S ++K+YE+L+ I+K LKNHK I+D+  VL DFE L ++Y+KA K ++ +G+ +FY+R + ELE+F   SW +   +K +SKNNSK L  LRQK+KKY + FE +++ +REN
Sbjct:    1 MSRFFRAGSDSETETESEEEVQQQRPAIPARAYQLSDDEEDARRIVRSEKDKRYEELRDIIKTLKNHKKIKDMASVLTDFESLGRAYDKARKVVDKEGIPRFYLRCLVELEDFVTESWEDREWRKTISKNNSKGLTTLRQKLKKYCRTFEEEMSHYREN 159          
BLAST of SMED30004178 vs. TrEMBL
Match: A0A1S3INZ7 (Eukaryotic translation initiation factor 3 subunit C OS=Lingula unguis OX=7574 GN=LOC106166059 PE=3 SV=1)

HSP 1 Score: 445.277 bits (1144), Expect = 4.155e-139
Identity = 225/546 (41.21%), Postives = 354/546 (64.84%), Query Frame = -2
Query:   73 KLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKEEIPSYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNR-NEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQD 1707
            K+F  D EI  + +  K+   +  R  K   R  Q+++L +L  +      G  ++ KIM ++ + L  Y  + +  CM  E W+R +E   +++++L  N  +IS+     E+SE+ +  PY+V GCI+  +E +++E+TK+L   D  S    EY E+LR E K+  +   +  YL  ++  +++ CR Y+++++H+YY+++P V  + +  S + M  L  FI  KD+TDR+RT AILC IY+ A+HD W++ARD+M MS L + I  +D   QIL+NR  VQLGLCAFR+G IK+AH  L ++Q  GR KE+LAQG  L R +E TPE+   EK    PYH HIN++++EC YLVSAML ++ +    + D RR MIS+NFH+V++ S+RN L G P++++EH+VAASKA+  GDWK   D+  ++KM K VW LF+N  E   +IV KI+ ES++ +L + ++V++SLS+  + E++EL + +VH +ISKMI++ +L ASLDEP+  ++MHRT  + LQ  AL+LA+K++ L E NE++ +
Sbjct:  308 KMFGKDVEINHKVVCMKLIEIVAARGKKGTDRNEQINMLIELNSIASENNLGPAMEAKIMFNIAAALFDYNPNIAT-CMRAEMWERCIEFVLELLNLLITN-KEISVGEDITEESEQLEVAPYLVRGCILTVVERMDEEFTKMLQGCDAHS---TEYVERLRDEKKVCDIIDRLVVYLEGRS-SNEELCRAYLKKIQHLYYKYEP-VSPEGQKNSEEVMETLCRFIHTKDQTDRIRTNAILCQIYHHAIHDRWYQARDLMMMSHLQDTIHHSDVPLQILYNRAMVQLGLCAFRQGMIKDAHHCLVDIQSGGRAKELLAQGLLLQRQHERTPEQEKIEKRRQMPYHMHINLELLECVYLVSAMLMEIPYMAAHEFDARRRMISKNFHHVMRVSERNPLVGPPESMREHIVAASKAMKVGDWKACRDYAINEKMNKKVWDLFQNTAETCEMIVSKIQEESLRTYLFTYSSVYDSLSMDNMAEMFELPKATVHSIISKMIINEELMASLDEPTQTVVMHRTEPTRLQSLALQLAEKVATLVENNERIME 846          

HSP 2 Score: 119.783 bits (299), Expect = 8.082e-24
Identity = 66/128 (51.56%), Postives = 98/128 (76.56%), Query Frame = -2
Query: 2059 AFDDSSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSW---XXXXXXXXXXXXXXXXLRQKIKKYNKDFEAQIADFREN 2433
            AF  S + ED +R+V+SA++K+YE+++ I+K LKNHK I+D++ VL DFE+L ++Y+KA K +E +G+ +FY+R + ELE+F +  W     +K LSKNN+KSL  LRQK+KKYN+DFE  I+D+REN
Sbjct:   35 AFTFSDDEEDTKRVVRSAKDKRYEEIRNIIKQLKNHKKIKDMSNVLSDFEDLGRAYDKAKKVVEKEGIPRFYLRALVELEDFVSECWEDREARKQLSKNNAKSLTTLRQKLKKYNRDFEQGISDYREN 162          
BLAST of SMED30004178 vs. Ensembl Cavefish
Match: eif3c (eukaryotic translation initiation factor 3 subunit C [Source:NCBI gene;Acc:103023166])

HSP 1 Score: 403.675 bits (1036), Expect = 2.219e-126
Identity = 222/571 (38.88%), Postives = 348/571 (60.95%), Query Frame = -2
Query:   55 KLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFP--PYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFD-----PTVGIKEEIPSYKE------------MRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRL-NRNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1707
            K+FA   EI    ++ K+   L+ R  K   R +Q+++L  L  +      G G+ VKI  ++++ L  Y  + +   M  + WK+ L+   +++DIL  N N+I +  +  EDSE       P+ V GCI+  +E +++E+TKI+   D  S    EY + L+ E  + ++   + +YL  K    ++ CRVY+R++ H YY+FD      ++GI+ E  S ++            M +L  FI  KD TDR+RT AILCHIY+ ALH  W++ARD+M MS L ++I  AD   QIL+NR  VQLG+CAFR+G IK+AH AL ++Q SGR KE+L QG  + N  E   E+   EK    P+H HIN++++EC YLVSAML ++ +    + D RR MIS+ FH+ L+  +R  L G P++++EHVVAASKA+  GDW+T    I ++KM   VW LF   + ++ ++V KI+ ES++ +L + ++V++S+S++ L E+++L   +VH +ISKMI++ +L ASLD+P+  ++MHRT  + LQ  AL+LA+K+  L E NE++ D  +  Y
Sbjct:  317 KMFAKGTEINTTVVVKKLNEILQARGKKGTDRAAQIELLHALAAISEEHNLGQGISVKIKFNIIASLYDYNPNLAT-FMKPDMWKKCLDCINELLDILFGN-NNIFIGENIAEDSENLAVSEQPFRVRGCILTLVERMDEEFTKIMQNTDPHSQ---EYVDNLKDEGCVCNIIDRLLQYLESKG-STEEVCRVYLRRIMHTYYKFDYKTHRRSMGIQGESKSEQDQEESEGEDSAVIMDRLCKFIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGMIKDAHNALLDIQSSGRAKELLGQGLLMRNMQERNAEQEKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWRTCHSFIINEKMNSKVWDLFPEAQRVREMLVRKIQEESLRTYLFTYSSVYDSISMETLSEMFQLELPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTSLQNMALQLAEKLGGLVENNERVFDLKQGVY 881          

HSP 2 Score: 98.5969 bits (244), Expect = 1.259e-20
Identity = 50/124 (40.32%), Postives = 89/124 (71.77%), Query Frame = -2
Query: 2059 SSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWXXXXXXXXXXXXXX---XXLRQKIKKYNKDFEAQIADFREN 2421
            S + ED +R+V+SA++K++E+L  ++K ++N   I+D+ K LE+FE+L +++ K+   ++ +GV +FYIR++A+LE++ N  W +K+   K N  +    + LRQKI+KYN+DFE  IA+++EN
Sbjct:   39 SDDEEDTKRVVRSAKDKRFEELTNLIKTIRNAMKIRDMAKCLEEFEQLCRAFLKSKAIVDKEGVPQFYIRLLADLEDYLNQLWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFETDIANYKEN 162          
BLAST of SMED30004178 vs. Ensembl Cavefish
Match: eif3c (eukaryotic translation initiation factor 3 subunit C [Source:NCBI gene;Acc:103023166])

HSP 1 Score: 403.675 bits (1036), Expect = 2.219e-126
Identity = 222/571 (38.88%), Postives = 348/571 (60.95%), Query Frame = -2
Query:   55 KLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFP--PYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFD-----PTVGIKEEIPSYKE------------MRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRL-NRNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1707
            K+FA   EI    ++ K+   L+ R  K   R +Q+++L  L  +      G G+ VKI  ++++ L  Y  + +   M  + WK+ L+   +++DIL  N N+I +  +  EDSE       P+ V GCI+  +E +++E+TKI+   D  S    EY + L+ E  + ++   + +YL  K    ++ CRVY+R++ H YY+FD      ++GI+ E  S ++            M +L  FI  KD TDR+RT AILCHIY+ ALH  W++ARD+M MS L ++I  AD   QIL+NR  VQLG+CAFR+G IK+AH AL ++Q SGR KE+L QG  + N  E   E+   EK    P+H HIN++++EC YLVSAML ++ +    + D RR MIS+ FH+ L+  +R  L G P++++EHVVAASKA+  GDW+T    I ++KM   VW LF   + ++ ++V KI+ ES++ +L + ++V++S+S++ L E+++L   +VH +ISKMI++ +L ASLD+P+  ++MHRT  + LQ  AL+LA+K+  L E NE++ D  +  Y
Sbjct:  317 KMFAKGTEINTTVVVKKLNEILQARGKKGTDRAAQIELLHALAAISEEHNLGQGISVKIKFNIIASLYDYNPNLAT-FMKPDMWKKCLDCINELLDILFGN-NNIFIGENIAEDSENLAVSEQPFRVRGCILTLVERMDEEFTKIMQNTDPHSQ---EYVDNLKDEGCVCNIIDRLLQYLESKG-STEEVCRVYLRRIMHTYYKFDYKTHRRSMGIQGESKSEQDQEESEGEDSAVIMDRLCKFIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGMIKDAHNALLDIQSSGRAKELLGQGLLMRNMQERNAEQEKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWRTCHSFIINEKMNSKVWDLFPEAQRVREMLVRKIQEESLRTYLFTYSSVYDSISMETLSEMFQLELPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTSLQNMALQLAEKLGGLVENNERVFDLKQGVY 881          

HSP 2 Score: 98.5969 bits (244), Expect = 1.259e-20
Identity = 50/124 (40.32%), Postives = 89/124 (71.77%), Query Frame = -2
Query: 2059 SSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWXXXXXXXXXXXXXX---XXLRQKIKKYNKDFEAQIADFREN 2421
            S + ED +R+V+SA++K++E+L  ++K ++N   I+D+ K LE+FE+L +++ K+   ++ +GV +FYIR++A+LE++ N  W +K+   K N  +    + LRQKI+KYN+DFE  IA+++EN
Sbjct:   39 SDDEEDTKRVVRSAKDKRFEELTNLIKTIRNAMKIRDMAKCLEEFEQLCRAFLKSKAIVDKEGVPQFYIRLLADLEDYLNQLWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFETDIANYKEN 162          
BLAST of SMED30004178 vs. Ensembl Cavefish
Match: eif3c (eukaryotic translation initiation factor 3 subunit C [Source:NCBI gene;Acc:103023166])

HSP 1 Score: 403.29 bits (1035), Expect = 3.996e-126
Identity = 222/571 (38.88%), Postives = 348/571 (60.95%), Query Frame = -2
Query:   55 KLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFP--PYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFD-----PTVGIKEEIPSYKE------------MRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRL-NRNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1707
            K+FA   EI    ++ K+   L+ R  K   R +Q+++L  L  +      G G+ VKI  ++++ L  Y  + +   M  + WK+ L+   +++DIL  N N+I +  +  EDSE       P+ V GCI+  +E +++E+TKI+   D  S    EY + L+ E  + ++   + +YL  K    ++ CRVY+R++ H YY+FD      ++GI+ E  S ++            M +L  FI  KD TDR+RT AILCHIY+ ALH  W++ARD+M MS L ++I  AD   QIL+NR  VQLG+CAFR+G IK+AH AL ++Q SGR KE+L QG  + N  E   E+   EK    P+H HIN++++EC YLVSAML ++ +    + D RR MIS+ FH+ L+  +R  L G P++++EHVVAASKA+  GDW+T    I ++KM   VW LF   + ++ ++V KI+ ES++ +L + ++V++S+S++ L E+++L   +VH +ISKMI++ +L ASLD+P+  ++MHRT  + LQ  AL+LA+K+  L E NE++ D  +  Y
Sbjct:  317 KMFAKGTEINTTVVVKKLNEILQARGKKGTDRAAQIELLHALAAISEEHNLGQGISVKIKFNIIASLYDYNPNLAT-FMKPDMWKKCLDCINELLDILFGN-NNIFIGENIAEDSENLAVSEQPFRVRGCILTLVERMDEEFTKIMQNTDPHSQ---EYVDNLKDEGCVCNIIDRLLQYLESKG-STEEVCRVYLRRIMHTYYKFDYKTHRRSMGIQGESKSEQDQEESEGEDSAVIMDRLCKFIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGMIKDAHNALLDIQSSGRAKELLGQGLLMRNMQERNAEQEKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWRTCHSFIINEKMNSKVWDLFPEAQRVREMLVRKIQEESLRTYLFTYSSVYDSISMETLSEMFQLELPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTSLQNMALQLAEKLGGLVENNERVFDLKQGVY 881          

HSP 2 Score: 98.9821 bits (245), Expect = 8.782e-21
Identity = 54/124 (43.55%), Postives = 94/124 (75.81%), Query Frame = -2
Query: 2059 SSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSW---XXXXXXXXXXXXXXXXLRQKIKKYNKDFEAQIADFREN 2421
            S + ED +R+V+SA++K++E+L  ++K ++N   I+D+ K LE+FE+L +++ K+   ++ +GV +FYIR++A+LE++ N  W     KK ++KNN+K+L+ LRQKI+KYN+DFE  IA+++EN
Sbjct:   39 SDDEEDTKRVVRSAKDKRFEELTNLIKTIRNAMKIRDMAKCLEEFEQLCRAFLKSKAIVDKEGVPQFYIRLLADLEDYLNQLWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFETDIANYKEN 162          
BLAST of SMED30004178 vs. Ensembl Cavefish
Match: eif3c (eukaryotic translation initiation factor 3 subunit C [Source:NCBI gene;Acc:103023166])

HSP 1 Score: 403.675 bits (1036), Expect = 4.116e-126
Identity = 222/571 (38.88%), Postives = 348/571 (60.95%), Query Frame = -2
Query:   55 KLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFP--PYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFD-----PTVGIKEEIPSYKE------------MRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRL-NRNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1707
            K+FA   EI    ++ K+   L+ R  K   R +Q+++L  L  +      G G+ VKI  ++++ L  Y  + +   M  + WK+ L+   +++DIL  N N+I +  +  EDSE       P+ V GCI+  +E +++E+TKI+   D  S    EY + L+ E  + ++   + +YL  K    ++ CRVY+R++ H YY+FD      ++GI+ E  S ++            M +L  FI  KD TDR+RT AILCHIY+ ALH  W++ARD+M MS L ++I  AD   QIL+NR  VQLG+CAFR+G IK+AH AL ++Q SGR KE+L QG  + N  E   E+   EK    P+H HIN++++EC YLVSAML ++ +    + D RR MIS+ FH+ L+  +R  L G P++++EHVVAASKA+  GDW+T    I ++KM   VW LF   + ++ ++V KI+ ES++ +L + ++V++S+S++ L E+++L   +VH +ISKMI++ +L ASLD+P+  ++MHRT  + LQ  AL+LA+K+  L E NE++ D  +  Y
Sbjct:  317 KMFAKGTEINTTVVVKKLNEILQARGKKGTDRAAQIELLHALAAISEEHNLGQGISVKIKFNIIASLYDYNPNLAT-FMKPDMWKKCLDCINELLDILFGN-NNIFIGENIAEDSENLAVSEQPFRVRGCILTLVERMDEEFTKIMQNTDPHSQ---EYVDNLKDEGCVCNIIDRLLQYLESKG-STEEVCRVYLRRIMHTYYKFDYKTHRRSMGIQGESKSEQDQEESEGEDSAVIMDRLCKFIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGMIKDAHNALLDIQSSGRAKELLGQGLLMRNMQERNAEQEKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWRTCHSFIINEKMNSKVWDLFPEAQRVREMLVRKIQEESLRTYLFTYSSVYDSISMETLSEMFQLELPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTSLQNMALQLAEKLGGLVENNERVFDLKQGVY 881          

HSP 2 Score: 98.9821 bits (245), Expect = 9.904e-21
Identity = 54/124 (43.55%), Postives = 94/124 (75.81%), Query Frame = -2
Query: 2059 SSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSW---XXXXXXXXXXXXXXXXLRQKIKKYNKDFEAQIADFREN 2421
            S + ED +R+V+SA++K++E+L  ++K ++N   I+D+ K LE+FE+L +++ K+   ++ +GV +FYIR++A+LE++ N  W     KK ++KNN+K+L+ LRQKI+KYN+DFE  IA+++EN
Sbjct:   39 SDDEEDTKRVVRSAKDKRFEELTNLIKTIRNAMKIRDMAKCLEEFEQLCRAFLKSKAIVDKEGVPQFYIRLLADLEDYLNQLWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFETDIANYKEN 162          
BLAST of SMED30004178 vs. Ensembl Yeast
Match: NIP1 (eIF3c subunit of the eukaryotic translation initiation factor 3 (eIF3); involved in the assembly of preinitiation complex and start codon selection; eIF3 is also involved in programmed stop codon readthrough [Source:SGD;Acc:S000004926])

HSP 1 Score: 179.874 bits (455), Expect = 2.167e-47
Identity = 153/590 (25.93%), Postives = 288/590 (48.81%), Query Frame = -2
Query:  121 NGWTTVDMYGRPEVKLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWK-------RILEITFDIVDILNRN----PNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTK-ILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNK--KNYGDDDKC--RVYMRQLEHIYYRFDPTVGIKEEIPSYKEMRKLSGFITLKDETDR----------------------LRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGT----RLN-RNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNH--CHMQQADGRRVMIS-RNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRT-RTSGLQIAALKL 1749
            NG+T     G         +++  +E   T++++ ++ R  K   ++S +  L++L+  V  + +       IM  L  +  ++  SA+     ++ WK       ++L I    +D    N    P D  +     EDS+        + G I  F+E L+DE+ K +L     SSD    Y  +LR E  I +L      Y     K+  D ++   R ++++L+HIYY+ +  + I E         +     T KD+ D                       ++ RAIL +IYY AL+  +  A+DM+  S +  +I++ D+S QILFNRV VQLGL AF+   I+E HQ L +L  S  ++EIL Q +     LN  N A+ +E  R+ +   PYH+HIN+D+I+  +L  ++L ++            +R+  S ++    L++ D+ +  G P+ L+++V+ A+K++  G+W+ +  ++ + K     WAL  N E +   + +++++ES+K +  S    ++S S+  L E+++L ++ V +++  +I + ++ A L++     ++ +    + L+ A +KL
Sbjct:  236 NGFTISSSQG---------NDQAVQEDFFTRLQTIIDSRGKKTVNQQSLISTLEELL-TVAEKPYEF-----IMAYLTLIPSRFDASANLSYQPIDQWKSSFNDISKLLSILDQTIDTYQVNEFADPIDF-IEDEPKEDSDGVK----RILGSIFSFVERLDDEFMKSLLNIDPHSSD----YLIRLRDEQSIYNLILRTQLYFEATLKDEHDLERALTRPFVKRLDHIYYKSENLIKIMETAAWNIIPAQFKSKFTSKDQLDSADYVDNLIDGLSTILSKQNNIAVQKRAILYNIYYTALNKDFQTAKDMLLTSQVQTNINQFDSSLQILFNRVVVQLGLSAFKLCLIEECHQILNDLLSSSHLREILGQQSLHRISLNSSNNASADERARQCL---PYHQHINLDLIDVVFLTCSLLIEIPRMTAFYSGIKVKRIPYSPKSIRRSLEHYDKLSFQGPPETLRDYVLFAAKSMQKGNWRDSVKYLREIKS----WALLPNMETVLNSLTERVQVESLKTYFFSFKRFYSSFSVAKLAELFDLPENKVVEVLQSVIAELEIPAKLNDEKTIFVVEKGDEITKLEEAMVKL 794          
BLAST of SMED30004178 vs. Ensembl Nematostella
Match: EDO41901 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S347])

HSP 1 Score: 389.423 bits (999), Expect = 1.590e-122
Identity = 223/580 (38.45%), Postives = 336/580 (57.93%), Query Frame = -2
Query:   79 GWTTVDMYGRPEVKLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRI-LEITFDIVDILNRNPNDISMRSSDMEDSEKFDFPPYM--VSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKEEIPSYKE-------------------MRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNRN-EATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGL-QIAALKLADKISQLAELNEKL 1746
            GWT V         LF  D EIT   +L K+   L  R  K   R  Q++ L +L  +      G  + VK+M +++S +  Y  + +  CM  + W++  L+   +++ IL  N + I +    ME++E FD       + GC++  +E +++E+TK+L   D  S    EY E+L+ E  +  +   +  YL +KN   ++ CR+Y+R++EHIYY+       K+++   K+                   M  L  +I  KD +DR+RTRA++CH+Y+ ALH+ WF ARD+M MS L   I  +D  TQIL+NR  VQLGLCAFR G IK+AH AL ++Q SGR KE+LAQG    R  E TPE+   EK    P+H HIN++++EC YL SAML ++        D RR +IS++FHY L+ SD+ TL G P++++EHVVAASKA+  GDW+   D+I   K    VW LF   +++K ++  KI+ ES++ +L +  +V++SLSL  L E+++L    VH  ISKMI++ +L+AS DEP+  ++MHR     L Q  AL+LADK+  L E NE++
Sbjct:  248 GWTEVKGITEKAKHLFPKDTEITVPVVLKKLHEILSARGKKGTDRTDQIEFLMELRKVAEEAKLGEAMTVKLMFNIISSIFDYNPNVAT-CMKADMWQQYRLKAISELIAILENN-SGIFVGEHVMEENETFDMKENQQRIRGCVLSVIERMDNEFTKMLQGCDCHS---TEYVERLKDEKTVTDIIKRLQAYL-EKNGTREELCRIYLRRIEHIYYKMVQKDKEKQDVEKEKQDNEKESEEKKSEDEDSKNTMDFLCKYIYSKDTSDRIRTRAMMCHVYHHALHNRWFAARDLMLMSHLQETIQHSDILTQILYNRTMVQLGLCAFRHGMIKDAHNALHDVQSSGRAKELLAQGLMQQRQFERTPEQEKIEKRRQVPFHMHINLELLECVYLTSAMLLEIPFMAAHAYDHRRRVISKSFHYQLRQSDKQTLVGPPESMREHVVAASKAMKTGDWRKCKDYILAVK----VWKLFSCADQVKEMLTRKIQEESLRTYLFTYNSVYDSLSLHTLAEMFDLPPSVVHSTISKMIINEELQASWDEPTQTVVMHRGAEPTLVQNLALQLADKVGNLVENNERI 817          

HSP 2 Score: 96.2857 bits (238), Expect = 2.272e-20
Identity = 50/124 (40.32%), Postives = 86/124 (69.35%), Query Frame = -2
Query: 2059 SSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWXXXXXXXXXX---XXXXXXLRQKIKKYNKDFEAQIADFREN 2421
            S E E+ +R+V+S ++K++++L  ++K LKNHK I+D+ K L +FE L K++ KA   ++ +G+  F+IR ++ELE+F   +W + +   K +   +++LA LRQK++KY+KDFE  I  +REN
Sbjct:    3 SDEEEETKRVVRSQKDKRFDELSNVIKQLKNHKKIKDMAKCLTEFENLGKAFTKAKAVVDKEGIPPFFIRALSELEDFVKENWEDAEGRKKLSKINARALATLRQKLRKYSKDFEDDIEKYREN 126          
BLAST of SMED30004178 vs. Ensembl Medaka
Match: eif3c (eukaryotic translation initiation factor 3 subunit C [Source:NCBI gene;Acc:101174301])

HSP 1 Score: 400.208 bits (1027), Expect = 9.133e-126
Identity = 224/581 (38.55%), Postives = 351/581 (60.41%), Query Frame = -2
Query:   55 YGRPEVK----LFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFP--PYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFD-----PTVGIKEEIPSYKE------------MRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRL-NRNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1725
            YG P VK    +FA   EI    ++ K+   L+ R  K   R +Q+++L  L  +      G G+ VKI  ++++ L  Y  + +   M  + WK+ LE   +++DIL  N N+I +  +  EDSE       P+ V GC++  +E +++E+TKI+   D  S    EY + L+ E ++  +   +  YL  K    ++ CRVY+R++ H YY+FD      ++G++ E  S ++            M +L  FI  KD TDR+RT AILCHIY+ ALH  W++ARD+M MS L ++I  +D   QIL+NR  VQLG+CAFR+G IK+AH AL ++Q SGR KE+L QG  + N  E   E+   EK    P+H HIN++++EC YLVSAML ++ +    + D RR MIS+ FH+ L+  +R  L G P++++EHVVAASKA+  GDW+T    I ++KM   VW LF   + ++ ++V KI+ ES++ +L + ++V++S+S++ L E+++L   +VH +ISKMI++ +L ASLD+P+  ++MHRT  + LQ  AL+LA+K+  L E NE++ D  +  Y
Sbjct:  271 YGVPLVKEKPKMFAKGTEINTTVVVKKLNEILQARGKKGTDRAAQIELLHALAAIAAEHNLGQGILVKIKFNIIASLYDYNPNLA-AFMKADMWKKCLECIDELLDILFEN-NNIFIGENIAEDSENLAVSDQPFRVRGCVLTLVERMDEEFTKIMQNTDPHSQ---EYVDNLKDEGRVCGIVDRLLTYLENKG-STEEICRVYLRRIMHTYYKFDYKAHRRSLGLQGETKSEQDQEESEGEDSALIMDRLCKFIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIHHSDPPVQILYNRTMVQLGICAFRQGMIKDAHNALLDIQSSGRAKELLGQGLLMRNMQERNAEQEKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWRTCHSFIINEKMNSKVWDLFPETQRVREMLVRKIQEESLRTYLFTYSSVYDSISMEILSEMFQLEMPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTSLQNMALQLAEKLGSLVENNERVFDLKQGVY 845          

HSP 2 Score: 98.5969 bits (244), Expect = 1.067e-20
Identity = 55/128 (42.97%), Postives = 95/128 (74.22%), Query Frame = -2
Query: 2047 SSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWX---XXXXXXXXXXXXXXXLRQKIKKYNKDFEAQIADFRENSDLY 2421
            S + ED +R+V+SA++K++E+L  ++K ++N   I+D+ K LE+FE+L +++ K+   ++ +GV  FYIR++A+LE++ N  W     KK ++KNN+K+L+ LRQKI+KYN+DFE +IA ++E S L+
Sbjct:   38 SDDEEDTKRVVRSAKDKRFEELTNLIKTIRNAMKIRDMAKCLEEFEQLCRAFLKSKNIVDKEGVPSFYIRLLADLEDYLNQLWEDKDGKKKMNKNNAKALSTLRQKIRKYNRDFETEIAAYKETSLLH 165          
BLAST of SMED30004178 vs. Ensembl Medaka
Match: eif3c (eukaryotic translation initiation factor 3 subunit C [Source:NCBI gene;Acc:101174301])

HSP 1 Score: 400.979 bits (1029), Expect = 4.776e-125
Identity = 224/581 (38.55%), Postives = 351/581 (60.41%), Query Frame = -2
Query:   55 YGRPEVK----LFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFP--PYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFD-----PTVGIKEEIPSYKE------------MRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRL-NRNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 1725
            YG P VK    +FA   EI    ++ K+   L+ R  K   R +Q+++L  L  +      G G+ VKI  ++++ L  Y  + +   M  + WK+ LE   +++DIL  N N+I +  +  EDSE       P+ V GC++  +E +++E+TKI+   D  S    EY + L+ E ++  +   +  YL  K    ++ CRVY+R++ H YY+FD      ++G++ E  S ++            M +L  FI  KD TDR+RT AILCHIY+ ALH  W++ARD+M MS L ++I  +D   QIL+NR  VQLG+CAFR+G IK+AH AL ++Q SGR KE+L QG  + N  E   E+   EK    P+H HIN++++EC YLVSAML ++ +    + D RR MIS+ FH+ L+  +R  L G P++++EHVVAASKA+  GDW+T    I ++KM   VW LF   + ++ ++V KI+ ES++ +L + ++V++S+S++ L E+++L   +VH +ISKMI++ +L ASLD+P+  ++MHRT  + LQ  AL+LA+K+  L E NE++ D  +  Y
Sbjct:  301 YGVPLVKEKPKMFAKGTEINTTVVVKKLNEILQARGKKGTDRAAQIELLHALAAIAAEHNLGQGILVKIKFNIIASLYDYNPNLA-AFMKADMWKKCLECIDELLDILFEN-NNIFIGENIAEDSENLAVSDQPFRVRGCVLTLVERMDEEFTKIMQNTDPHSQ---EYVDNLKDEGRVCGIVDRLLTYLENKG-STEEICRVYLRRIMHTYYKFDYKAHRRSLGLQGETKSEQDQEESEGEDSALIMDRLCKFIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIHHSDPPVQILYNRTMVQLGICAFRQGMIKDAHNALLDIQSSGRAKELLGQGLLMRNMQERNAEQEKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWRTCHSFIINEKMNSKVWDLFPETQRVREMLVRKIQEESLRTYLFTYSSVYDSISMEILSEMFQLEMPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTSLQNMALQLAEKLGSLVENNERVFDLKQGVY 875          

HSP 2 Score: 97.8265 bits (242), Expect = 2.289e-20
Identity = 54/124 (43.55%), Postives = 93/124 (75.00%), Query Frame = -2
Query: 2059 SSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWX---XXXXXXXXXXXXXXXLRQKIKKYNKDFEAQIADFREN 2421
            S + ED +R+V+SA++K++E+L  ++K ++N   I+D+ K LE+FE+L +++ K+   ++ +GV  FYIR++A+LE++ N  W     KK ++KNN+K+L+ LRQKI+KYN+DFE +IA ++EN
Sbjct:   38 SDDEEDTKRVVRSAKDKRFEELTNLIKTIRNAMKIRDMAKCLEEFEQLCRAFLKSKNIVDKEGVPSFYIRLLADLEDYLNQLWEDKDGKKKMNKNNAKALSTLRQKIRKYNRDFETEIAAYKEN 161          
BLAST of SMED30004178 vs. Planmine SMEST
Match: SMESG000025475.1 (SMESG000025475.1)

HSP 1 Score: 1445.64 bits (3741), Expect = 0.000e+0
Identity = 820/820 (100.00%), Postives = 820/820 (100.00%), Query Frame = -2
Query:   55 MSRFFHALXXXXXXXXXXXXXXXERPIAFDDSSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWXXXXXXXXXXXXXXXXLRQKIKKYNKDFEAQIADFRENSDLYXXXXXXXXXXXXXXXXXXXEDPKKVSTLKDKXXXXXXXXXXXXXXXXXXXXXXXXXELYKNDPAARFLKSHTSXXXXXXXXXXXXXXXXXXXXXXXXXDNGWTTVDMYGRPEVKLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKEEIPSYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNRNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 2514
            MSRFFHALSSDSDSSDSEEEVVVERPIAFDDSSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWANKKNLSKNNSKSLAALRQKIKKYNKDFEAQIADFRENSDLYPLELVPEVIEEEKAVEKKQEDPKKVSTLKDKSDSEDEMWDQDSSSESSTSEDEEEIELYKNDPAARFLKSHTSKQKDKKKKEKREKDQKEYKRKDKDDDNGWTTVDMYGRPEVKLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKEEIPSYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNRNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY
Sbjct:    1 MSRFFHALSSDSDSSDSEEEVVVERPIAFDDSSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWANKKNLSKNNSKSLAALRQKIKKYNKDFEAQIADFRENSDLYPLELVPEVIEEEKAVEKKQEDPKKVSTLKDKSDSEDEMWDQDSSSESSTSEDEEEIELYKNDPAARFLKSHTSKQKDKKKKEKREKDQKEYKRKDKDDDNGWTTVDMYGRPEVKLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKEEIPSYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNRNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKLQDASKPKY 820          
BLAST of SMED30004178 vs. Planmine SMEST
Match: SMESG000025491.1 (SMESG000025491.1)

HSP 1 Score: 703.745 bits (1815), Expect = 0.000e+0
Identity = 392/805 (48.70%), Postives = 558/805 (69.32%), Query Frame = -2
Query:   79 AFDDSSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWXXXXXXXXXXX-XXXXXLRQKIKKYNKDFEAQIADFRENSDLYXXXXXXXXXXXXXXXXXXX---EDPKKVSTLKDKXXXXXXXXXXXXXXXXXXXXXXXXXELYKNDPAARFLK--------SHTSXXXXXXXXXXXXXXXXXXXXXXXXXDNGWTTVDMYGRPE--VKLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKEEIP------SYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNRNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKL 2433
             F+ S   EDE+R+V+S + K+YE+L+ I+KNLKNHK  +DI  VL DFE LTK ++KA K ++ +GV KFYIR +AELE+F N  W N K     N+ KSLA LRQ+++KYNK++E  I  FREN ++YP +L+ E+  E       +    + +K      K +  +   D   +S +S+SED+E  ELYKN+PAARFLK            ++K+K+K+E++++ +++     + D +GWT VD  G+PE   ++F  +EEIT ES+L K+   ++GR  K+ QR+ Q ++L+QL  +VV++ FG G Q+K+++S  S LLQY  + +N C+ +E W +I+     ++DIL  N N+++++ + +E+SE    PPY + GCII   EH++DEYTKIL   D  +    +Y EKL+FETK+  LC+ ++ YL  K Y  +D CR Y+R++EH+YYRFD      E +       SY+EM+ L  +I  KD+TDRLRTRA+LCHIYYLALHD+W+EARDMMAMS L N IDR+DASTQIL+NR TVQLGLCAFR+G IK++HQALA+LQGSGR+KE+LAQG   NR E T +E  REK  L PYH+HIN++++EC YLVSAML+DVNHC     DGRR MISRNFH+VLK+S+R TL G P+ +++HVVAASKALF GDW+    +I + KM   VW LF     +K ++++KIK+E+++ FLL  +++ +SLSL +L + ++L    +HQ+ISKMIL  +L ASL++P+NCLIMHR+  S LQ  AL+LA++++QL ELNE+L
Sbjct:   42 VFESSDSEEDEKRVVRSGKVKRYEELENIIKNLKNHKKNRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHKKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQEIKIEIDEEAAVECPHLEDRKHDQKYQKVEESESESDWGDNSTTSSSEDDEAKELYKNNPAARFLKRTDEKSTEKKKKEKKEKEKEERKKEKKRKQLSAGESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYN-NKTNSCLKIEQWNKIMCNVSALLDILLNNVNNVTLKINVLEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAP---DYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEIKIIHQIISKMILMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERL 842          
BLAST of SMED30004178 vs. Planmine SMEST
Match: SMESG000025491.1 (SMESG000025491.1)

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 392/805 (48.70%), Postives = 558/805 (69.32%), Query Frame = -2
Query:   79 AFDDSSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWXXXXXXXXXXX-XXXXXLRQKIKKYNKDFEAQIADFRENSDLYXXXXXXXXXXXXXXXXXXX---EDPKKVSTLKDKXXXXXXXXXXXXXXXXXXXXXXXXXELYKNDPAARFLK--------SHTSXXXXXXXXXXXXXXXXXXXXXXXXXDNGWTTVDMYGRPE--VKLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKEEIP------SYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNRNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKL 2433
             F+ S   EDE+R+V+S + K+YE+L+ I+KNLKNHK  +DI  VL DFE LTK ++KA K ++ +GV KFYIR +AELE+F N  W N K     N+ KSLA LRQ+++KYNK++E  I  FREN ++YP +L+ E+  E       +    + +K      K +  +   D   +S +S+SED+E  ELYKN+PAARFLK            ++K+K+K+E++++ +++     + D +GWT VD  G+PE   ++F  +EEIT ES+L K+   ++GR  K+ QR+ Q ++L+QL  +VV++ FG G Q+K+++S  S LLQY  + +N C+ +E W +I+     ++DIL  N N+++++ + +E+SE    PPY + GCII   EH++DEYTKIL   D  +    +Y EKL+FETK+  LC+ ++ YL  K Y  +D CR Y+R++EH+YYRFD      E +       SY+EM+ L  +I  KD+TDRLRTRA+LCHIYYLALHD+W+EARDMMAMS L N IDR+DASTQIL+NR TVQLGLCAFR+G IK++HQALA+LQGSGR+KE+LAQG   NR E T +E  REK  L PYH+HIN++++EC YLVSAML+DVNHC     DGRR MISRNFH+VLK+S+R TL G P+ +++HVVAASKALF GDW+    +I + KM   VW LF     +K ++++KIK+E+++ FLL  +++ +SLSL +L + ++L    +HQ+ISKMIL  +L ASL++P+NCLIMHR+  S LQ  AL+LA++++QL ELNE+L
Sbjct:   69 VFESSDSEEDEKRVVRSGKVKRYEELENIIKNLKNHKKNRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHKKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQEIKIEIDEEAAVECPHLEDRKHDQKYQKVEESESESDWGDNSTTSSSEDDEAKELYKNNPAARFLKRTDEKSTEKKKKEKKEKEKEERKKEKKRKQLSAGESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYN-NKTNSCLKIEQWNKIMCNVSALLDILLNNVNNVTLKINVLEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAP---DYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEIKIIHQIISKMILMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERL 869          
BLAST of SMED30004178 vs. Planmine SMEST
Match: SMESG000025491.1 (SMESG000025491.1)

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 392/805 (48.70%), Postives = 558/805 (69.32%), Query Frame = -2
Query:   79 AFDDSSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWXXXXXXXXXXX-XXXXXLRQKIKKYNKDFEAQIADFRENSDLYXXXXXXXXXXXXXXXXXXX---EDPKKVSTLKDKXXXXXXXXXXXXXXXXXXXXXXXXXELYKNDPAARFLK--------SHTSXXXXXXXXXXXXXXXXXXXXXXXXXDNGWTTVDMYGRPE--VKLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKEEIP------SYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNRNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKL 2433
             F+ S   EDE+R+V+S + K+YE+L+ I+KNLKNHK  +DI  VL DFE LTK ++KA K ++ +GV KFYIR +AELE+F N  W N K     N+ KSLA LRQ+++KYNK++E  I  FREN ++YP +L+ E+  E       +    + +K      K +  +   D   +S +S+SED+E  ELYKN+PAARFLK            ++K+K+K+E++++ +++     + D +GWT VD  G+PE   ++F  +EEIT ES+L K+   ++GR  K+ QR+ Q ++L+QL  +VV++ FG G Q+K+++S  S LLQY  + +N C+ +E W +I+     ++DIL  N N+++++ + +E+SE    PPY + GCII   EH++DEYTKIL   D  +    +Y EKL+FETK+  LC+ ++ YL  K Y  +D CR Y+R++EH+YYRFD      E +       SY+EM+ L  +I  KD+TDRLRTRA+LCHIYYLALHD+W+EARDMMAMS L N IDR+DASTQIL+NR TVQLGLCAFR+G IK++HQALA+LQGSGR+KE+LAQG   NR E T +E  REK  L PYH+HIN++++EC YLVSAML+DVNHC     DGRR MISRNFH+VLK+S+R TL G P+ +++HVVAASKALF GDW+    +I + KM   VW LF     +K ++++KIK+E+++ FLL  +++ +SLSL +L + ++L    +HQ+ISKMIL  +L ASL++P+NCLIMHR+  S LQ  AL+LA++++QL ELNE+L
Sbjct:   56 VFESSDSEEDEKRVVRSGKVKRYEELENIIKNLKNHKKNRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHKKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQEIKIEIDEEAAVECPHLEDRKHDQKYQKVEESESESDWGDNSTTSSSEDDEAKELYKNNPAARFLKRTDEKSTEKKKKEKKEKEKEERKKEKKRKQLSAGESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYN-NKTNSCLKIEQWNKIMCNVSALLDILLNNVNNVTLKINVLEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAP---DYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEIKIIHQIISKMILMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERL 856          
BLAST of SMED30004178 vs. Planmine SMEST
Match: SMESG000025491.1 (SMESG000025491.1)

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 392/805 (48.70%), Postives = 558/805 (69.32%), Query Frame = -2
Query:   79 AFDDSSESEDERRIVKSAREKKYEDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYIRVIAELEEFTNTSWXXXXXXXXXXX-XXXXXLRQKIKKYNKDFEAQIADFRENSDLYXXXXXXXXXXXXXXXXXXX---EDPKKVSTLKDKXXXXXXXXXXXXXXXXXXXXXXXXXELYKNDPAARFLK--------SHTSXXXXXXXXXXXXXXXXXXXXXXXXXDNGWTTVDMYGRPE--VKLFADDEEITKESILTKMRSELEGRTSKKDQRKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSLENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIGFLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKKNYGDDDKCRVYMRQLEHIYYRFDPTVGIKEEIP------SYKEMRKLSGFITLKDETDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFNRVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNRNEATPEELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMISRNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKMKKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIYELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLADKISQLAELNEKL 2433
             F+ S   EDE+R+V+S + K+YE+L+ I+KNLKNHK  +DI  VL DFE LTK ++KA K ++ +GV KFYIR +AELE+F N  W N K     N+ KSLA LRQ+++KYNK++E  I  FREN ++YP +L+ E+  E       +    + +K      K +  +   D   +S +S+SED+E  ELYKN+PAARFLK            ++K+K+K+E++++ +++     + D +GWT VD  G+PE   ++F  +EEIT ES+L K+   ++GR  K+ QR+ Q ++L+QL  +VV++ FG G Q+K+++S  S LLQY  + +N C+ +E W +I+     ++DIL  N N+++++ + +E+SE    PPY + GCII   EH++DEYTKIL   D  +    +Y EKL+FETK+  LC+ ++ YL  K Y  +D CR Y+R++EH+YYRFD      E +       SY+EM+ L  +I  KD+TDRLRTRA+LCHIYYLALHD+W+EARDMMAMS L N IDR+DASTQIL+NR TVQLGLCAFR+G IK++HQALA+LQGSGR+KE+LAQG   NR E T +E  REK  L PYH+HIN++++EC YLVSAML+DVNHC     DGRR MISRNFH+VLK+S+R TL G P+ +++HVVAASKALF GDW+    +I + KM   VW LF     +K ++++KIK+E+++ FLL  +++ +SLSL +L + ++L    +HQ+ISKMIL  +L ASL++P+NCLIMHR+  S LQ  AL+LA++++QL ELNE+L
Sbjct:   41 VFESSDSEEDEKRVVRSGKVKRYEELENIIKNLKNHKKNRDINNVLIDFEILTKCFDKAKKIIDIEGVPKFYIRTVAELEDFINDLWDNHKKTLNKNNCKSLATLRQRLRKYNKEYETDIKLFRENPEVYPEDLIQEIKIEIDEEAAVECPHLEDRKHDQKYQKVEESESESDWGDNSTTSSSEDDEAKELYKNNPAARFLKRTDEKSTEKKKKEKKEKEKEERKKEKKRKQLSAGESDVDGWTAVDGSGKPEKLTRVFEKNEEITAESVLKKIDDIIQGRVVKRGQRQIQFEMLEQLHKIVVDQNFGPGFQIKLIISCTSFLLQYN-NKTNSCLKIEQWNKIMCNVSALLDILLNNVNNVTLKINVLEESENLLDPPYRLHGCIINLFEHMDDEYTKILQNIDARAP---DYIEKLQFETKVFELCTKLNRYLEMKEYSSNDICRAYLRKVEHMYYRFDYNFKWDESLSDHALSESYQEMKSLCRYILSKDQTDRLRTRAMLCHIYYLALHDHWYEARDMMAMSALQNSIDRSDASTQILYNRATVQLGLCAFRKGFIKDSHQALADLQGSGRLKELLAQGIAPNRYERTKDEENREKARLLPYHQHINLELMECVYLVSAMLSDVNHCLTHYPDGRRRMISRNFHHVLKSSERQTLVGSPETVRDHVVAASKALFVGDWQNTVKNIVNPKMNSKVWDLFHESSAVKQMLIEKIKMEALRTFLLGHSSICDSLSLSFLEKQFDLEIKIIHQIISKMILMDELMASLNDPTNCLIMHRSEPSKLQAMALRLAERVNQLGELNERL 841          
The following BLAST results are available for this feature:
BLAST of SMED30004178 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EIF3C6.878e-12738.46eukaryotic translation initiation factor 3 subunit... [more]
EIF3C9.898e-12738.46eukaryotic translation initiation factor 3 subunit... [more]
EIF3C9.898e-12738.46eukaryotic translation initiation factor 3 subunit... [more]
EIF3C9.898e-12738.46eukaryotic translation initiation factor 3 subunit... [more]
EIF3C9.898e-12738.46eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of SMED30004178 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
eif-3.C4.452e-12639.32Eukaryotic translation initiation factor 3 subunit... [more]
eif-3.C4.452e-12639.32Eukaryotic translation initiation factor 3 subunit... [more]
eif-3.C4.452e-12639.32Eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of SMED30004178 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eIF3c1.922e-13239.30gene:FBgn0034258 transcript:FBtr0086836[more]
eIF3c1.922e-13239.30gene:FBgn0034258 transcript:FBtr0340269[more]
back to top
BLAST of SMED30004178 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eif3c2.210e-12738.88eukaryotic translation initiation factor 3, subuni... [more]
back to top
BLAST of SMED30004178 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tnip14.496e-12538.15TNFAIP3 interacting protein 1 [Source:Xenbase;Acc:... [more]
tnip18.917e-12437.41TNFAIP3 interacting protein 1 [Source:Xenbase;Acc:... [more]
back to top
BLAST of SMED30004178 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Eif3c4.636e-12538.22eukaryotic translation initiation factor 3, subuni... [more]
Eif3c4.565e-2337.20eukaryotic translation initiation factor 3, subuni... [more]
back to top
BLAST of SMED30004178 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B4MRZ8|EIF3C_DROWI6.496e-13739.76Eukaryotic translation initiation factor 3 subunit... [more]
sp|Q17Q06|EIF3C_AEDAE8.320e-13539.26Eukaryotic translation initiation factor 3 subunit... [more]
sp|B4LNA1|EIF3C_DROVI1.584e-13439.69Eukaryotic translation initiation factor 3 subunit... [more]
sp|B4KN00|EIF3C_DROMO1.915e-13439.69Eukaryotic translation initiation factor 3 subunit... [more]
sp|B4J789|EIF3C_DROGR8.732e-13439.18Eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of SMED30004178 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E2F3W61.932e-16756.41Eukaryotic translation initiation factor 3 subunit... [more]
K1P5V73.166e-14341.79Eukaryotic translation initiation factor 3 subunit... [more]
A0A1J1IYL21.190e-14141.54Eukaryotic translation initiation factor 3 subunit... [more]
A0A2T7PD492.009e-14142.73Eukaryotic translation initiation factor 3 subunit... [more]
A0A1S3INZ74.155e-13941.21Eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of SMED30004178 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
eif3c2.219e-12638.88eukaryotic translation initiation factor 3 subunit... [more]
eif3c2.219e-12638.88eukaryotic translation initiation factor 3 subunit... [more]
eif3c3.996e-12638.88eukaryotic translation initiation factor 3 subunit... [more]
eif3c4.116e-12638.88eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of SMED30004178 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004178 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NIP12.167e-4725.93eIF3c subunit of the eukaryotic translation initia... [more]
back to top
BLAST of SMED30004178 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO419011.590e-12238.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30004178 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eif3c9.133e-12638.55eukaryotic translation initiation factor 3 subunit... [more]
eif3c4.776e-12538.55eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of SMED30004178 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025475.10.000e+0100.00SMESG000025475.1[more]
SMESG000025491.10.000e+048.70SMESG000025491.1[more]
SMESG000025491.10.000e+048.70SMESG000025491.1[more]
SMESG000025491.10.000e+048.70SMESG000025491.1[more]
SMESG000025491.10.000e+048.70SMESG000025491.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004178 ID=SMED30004178|Name=SMED30004178|organism=Schmidtea mediterranea sexual|type=transcript|length=2596bp
TTTTTTTTCAAAAACCAAAATTTTATTAAAGAACACCAACTTGAATAACT
ATCAGTATTTCGGTTTCGAAGCATCTTGCAATTTCTCGTTTAACTCGGCC
AATTGAGAAATTTTGTCTGCGAGTTTCAGCGCTGCAATTTGTAAACCAGA
AGTTCGAGTTCTGTGCATTATTAGACAATTTGATGGCTCATCGAGAGAGG
CTTTTAATTTGCCATCGAGAATCATTTTGCTTATTAATTGATGGACTGAA
TGTTGACTCAATTCATAAATTTCCACAAGGTATTTTAGACTCAACGAGTT
AAATACATTGGCCTTGCTTAATAAAAAAGCTTTCATTGATTCCAACTTTA
TTTTATCGACTATTATTGTCTTAAGCTCTTCAAAATTTCTAAAAAGAGCC
CATACGGACTTTTTCATTTTATCGTCAAATATATGATCTGCAGCAGTTTT
CCAGTCGCCGTTAAACAAAGCTTTTGAGGCAGCAACAACATGTTCCTTCA
AGTTATCTGGTCGCCCATTAAGAGTGTTTCTGTCACTATTTTTCAATACG
TAGTGGAAATTTCTGCTGATCATCACTCGCCGACCATCAGCTTGTTGCAT
GTGACAATGATTCACATCTGTTAACATTGCAGATACAAGATAAGCACACT
CAATCACATCGACATTTATGTGTTTGTGATAGGGCTGGAGAAACATTTTC
TCTCGAAATAATTCCTCTGGTGTAGCTTCATTTCTGTTTAATCGAGTTCC
TTGGGCTAAAATTTCCTTAACTCTACCAGACCCTTGGAGTTCGGCCAAAG
CTTGATGAGCTTCCTTGATGCACCCACGTCGGAAAGCACACAGTCCTAAC
TGCACAGTCACCCGATTGAACAATATCTGAGTTGATGCATCTGCCCGGTC
TATATGATTAGTGAGTCCAGACATGGCCATCATGTCCCGCGCCTCAAACC
AATAATCGTGAAGGGCGAGATAGTATATATGACACAAAATCGCTCTAGTT
CTCAATCGATCGGTTTCGTCTTTCAATGTTATAAATCCTGACAATTTTCT
CATTTCCTTATAACTAGGAATTTCCTCTTTAATTCCTACCGTGGGATCGA
ATCTATAATAAATATGTTCCAATTGTCGCATATACACTCGACATTTGTCA
TCATCACCGTAATTTTTCTTATTCAGATATTCACTAACTAAACTACAAAG
AGACATAATTTTTGTTTCAAAGCGCAACTTTTCTCGATATTCGACTTCTT
TGTCTGATGAGAAATCATGACACGTAAGAATTTTTGTGTATTCATCCTCT
AAATGCTCGAGAAATCCGATAATACATCCACTGACCATATAAGGTGGGAA
ATCAAATTTTTCACTATCTTCCATATCACTAGATCTCATAGAAATGTCGT
TGGGATTCCTGTTCAATATATCCACAATGTCGAATGTGATCTCAAGAATT
CTTTTCCAATTTTCAAGACTCATGCACGGATTTGATGCACTACATTTGTA
TTGCAACAACAGAGAAACGAGTGAAACCATAATCTTGACTTGCAAACCTA
TTCCAAATCCTCGATTGACAACAAGATCGATTAATTGTTGCAAAATATCG
ACTTGAGATTTTCGCTGGTCCTTTTTACTTGTTCTACCTTCAAGTTCAGA
TCTCATTTTGGTGAGAATAGATTCTTTTGTTATTTCTTCATCGTCTGCAA
ATAATTTTACCTCTGGTCGACCGTACATGTCTACAGTTGTCCATCCATTG
TCATCGTCTTTATCTTTCCTCTTATACTCTTTTTGATCTTTTTCCCGTTT
CTCTTTTTTCTTTTTATCTTTCTGTTTACTAGTATGAGATTTCAAAAAGC
GAGCAGCTGGATCGTTTTTATATAATTCGATTTCTTCTTCGTCTTCTGAC
GTAGAAGATTCACTAGAACTATCCTGATCCCACATTTCATCCTCAGAATC
GGATTTATCTTTAAGAGTTGAAACCTTTTTAGGGTCTTCTTGTTTCTTTT
CAACAGCTTTTTCTTCCTCAATTACCTCCGGAACTAATTCTAATGGATAT
AAATCACTATTTTCACGAAAATCAGCAATCTGAGCTTCGAAATCTTTGTT
GTATTTCTTGATTTTTTGACGAAGCGCCGCTAAACTTTTTGAATTATTTT
TGCTAAGATTTTTCTTATTTGCCCAAGAGGTATTAGTAAACTCTTCCAAC
TCAGCAATCACTCTGATGTAAAATTTTAAAACGCCATCAGCCTCCATTGT
TTTATGAGCTTTCTCGTAACTCTTTGTTAATTCTTCAAAATCCTCTAAAA
CCTTAGTAATATCTTGGATATTTTTGTGATTTTTTAAATTTTTAACAATC
CCTTGCAAATCTTCATACTTTTTTTCTCTAGCGGATTTTACTATTCGTCT
CTCGTCCTCGCTTTCACTTGAATCGTCAAAAGCAATAGGCCTTTCAACTA
CAACTTCTTCCTCAGAATCACTAGAATCCGAATCGCTGCTTAGAGCATGA
AAAAATCGACTCATCGTGTGTGAAAATTTAAATTAAAAATTAATATTAAC
AGTTAAAACAAATCATAACGTAAATCATAAAAAAATTCACTTTTCG
back to top

protein sequence of SMED30004178-orf-1

>SMED30004178-orf-1 ID=SMED30004178-orf-1|Name=SMED30004178-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=821bp
MSRFFHALSSDSDSSDSEEEVVVERPIAFDDSSESEDERRIVKSAREKKY
EDLQGIVKNLKNHKNIQDITKVLEDFEELTKSYEKAHKTMEADGVLKFYI
RVIAELEEFTNTSWANKKNLSKNNSKSLAALRQKIKKYNKDFEAQIADFR
ENSDLYPLELVPEVIEEEKAVEKKQEDPKKVSTLKDKSDSEDEMWDQDSS
SESSTSEDEEEIELYKNDPAARFLKSHTSKQKDKKKKEKREKDQKEYKRK
DKDDDNGWTTVDMYGRPEVKLFADDEEITKESILTKMRSELEGRTSKKDQ
RKSQVDILQQLIDLVVNRGFGIGLQVKIMVSLVSLLLQYKCSASNPCMSL
ENWKRILEITFDIVDILNRNPNDISMRSSDMEDSEKFDFPPYMVSGCIIG
FLEHLEDEYTKILTCHDFSSDKEVEYREKLRFETKIMSLCSLVSEYLNKK
NYGDDDKCRVYMRQLEHIYYRFDPTVGIKEEIPSYKEMRKLSGFITLKDE
TDRLRTRAILCHIYYLALHDYWFEARDMMAMSGLTNHIDRADASTQILFN
RVTVQLGLCAFRRGCIKEAHQALAELQGSGRVKEILAQGTRLNRNEATPE
ELFREKMFLQPYHKHINVDVIECAYLVSAMLTDVNHCHMQQADGRRVMIS
RNFHYVLKNSDRNTLNGRPDNLKEHVVAASKALFNGDWKTAADHIFDDKM
KKSVWALFRNFEELKTIIVDKIKLESMKAFLLSKANVFNSLSLKYLVEIY
ELSQHSVHQLISKMILDGKLKASLDEPSNCLIMHRTRTSGLQIAALKLAD
KISQLAELNEKLQDASKPKY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR027516EIF3C
IPR036390WH_DNA-bd_sf
IPR000717PCI_dom
IPR011991WHTH_DNA-bd_dom
IPR008905EIF3C_N_dom
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0005515protein binding
GO:0031369translation initiation factor binding
GO:0003743translation initiation factor activity
Vocabulary: biological process
TermDefinition
GO:0006413translational initiation
Vocabulary: cellular component
TermDefinition
GO:0005852eukaryotic translation initiation factor 3 complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 73..93
NoneNo IPR availableCOILSCoilCoilcoord: 791..815
NoneNo IPR availableCOILSCoilCoilcoord: 128..148
NoneNo IPR availableSMARTSM00753PINTcoord: 717..805
e-value: 1.5E-4
score: 31.1
NoneNo IPR availableGENE3DG3DSA:1.25.40.570coord: 718..817
e-value: 3.3E-7
score: 31.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 195..214
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 169..252
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..38
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 236..252
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 169..194
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 19..38
NoneNo IPR availablePANTHERPTHR13937:SF0EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT C-RELATEDcoord: 1..816
IPR000717Proteasome component (PCI) domainSMARTSM00088PINT_4coord: 717..805
e-value: 1.5E-4
score: 31.1
IPR000717Proteasome component (PCI) domainPFAMPF01399PCIcoord: 652..785
e-value: 5.5E-10
score: 39.7
IPR000717Proteasome component (PCI) domainPROSITEPS50250PCIcoord: 612..788
score: 14.509
IPR008905Eukaryotic translation initiation factor 3 subunit C, N-terminal domainPFAMPF05470eIF-3c_Ncoord: 29..636
e-value: 2.1E-133
score: 445.8
IPR027516Eukaryotic translation initiation factor 3 subunit CPANTHERPTHR13937EUKARYOTIC TRANSLATION INITATION FACTOR 3, SUBUNIT 8 EIF3S8 -RELATEDcoord: 1..816
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 726..787