Nuclear receptor 2DBD gamma

Overview
NameNuclear receptor 2DBD gamma
Smed IDSMED30004154
Length (bp)3153
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nuclear receptor 2DBD gamma (SMED30004154) t-SNE clustered cells

Violin plots show distribution of expression levels for Nuclear receptor 2DBD gamma (SMED30004154) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004154

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
ovarySMED30004154SMESG000020242.1 SMED30004154smed_20140614PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
oviductSMED30004154SMESG000020242.1 SMED30004154smed_20140614PMID:279364
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testisSMED30004154SMESG000020242.1 SMED30004154smed_20140614PMID:279364
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testisSMED30004154SMESG000020242.1 SMED30004154smed_20140614PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
cement glandSMED30004154SMESG000020242.1 SMED30004154smed_20140614PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
copulatory apparatusSMED30004154SMESG000020242.1 SMED30004154smed_20140614PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
oviductSMED30004154SMESG000020242.1 SMED30004154smed_20140614PMID:25278423
Tharp et al., 2014
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
penis papillaSMED30004154SMESG000020242.1 SMED30004154smed_20140614PMID:25278423
Tharp et al., 2014
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
sperm ductSMED30004154SMESG000020242.1 SMED30004154smed_20140614PMID:25278423
Tharp et al., 2014
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
seminal vesicleSMED30004154SMESG000020242.1 SMED30004154smed_20140614PMID:25278423
Tharp et al., 2014
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
tubaSMED30004154SMESG000020242.1 SMED30004154smed_20140614PMID:25278423
Tharp et al., 2014
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
copulatory bursaSMED30004154SMESG000020242.1 SMED30004154smed_20140614PMID:25278423
Tharp et al., 2014
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
Smed sexual biotypeSMED30004154SMESG000020242.1 Contig14371newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004154SMESG000020242.1 Contig14371uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004154SMESG000020242.1 Contig40695newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004154SMESG000020242.1 Contig40695uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Human
Match: RORA (RAR related orphan receptor A [Source:HGNC Symbol;Acc:HGNC:10258])

HSP 1 Score: 103.219 bits (256), Expect = 7.398e-25
Identity = 43/82 (52.44%), Postives = 61/82 (74.39%), Query Frame = 1
Query: 1279 ISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
            I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+  +RN C+ CR +KCLA+GMS++  + GR
Sbjct:   70 IEIIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGR 149          

HSP 2 Score: 74.7146 bits (182), Expect = 6.390e-15
Identity = 32/69 (46.38%), Postives = 43/69 (62.32%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I + +R  CQ+CR QKCL +GM+
Sbjct:   75 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNA--TYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMS 141          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Human
Match: RORA (RAR related orphan receptor A [Source:HGNC Symbol;Acc:HGNC:10258])

HSP 1 Score: 107.842 bits (268), Expect = 1.920e-23
Identity = 44/85 (51.76%), Postives = 62/85 (72.94%), Query Frame = 1
Query: 1270 NTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
            N  I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+  +RN C+ CR +KCLA+GMS++  + GR
Sbjct:   98 NAQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGR 180          

HSP 2 Score: 73.9442 bits (180), Expect = 7.953e-13
Identity = 32/69 (46.38%), Postives = 43/69 (62.32%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I + +R  CQ+CR QKCL +GM+
Sbjct:  106 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNA--TYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMS 172          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Human
Match: RORB (RAR related orphan receptor B [Source:HGNC Symbol;Acc:HGNC:10259])

HSP 1 Score: 106.301 bits (264), Expect = 2.395e-23
Identity = 43/82 (52.44%), Postives = 60/82 (73.17%), Query Frame = 1
Query: 1279 ISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
            I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+   RN C+ CR +KCLA+GMS++  + GR
Sbjct:    5 IEVIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQNNASYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGR 84          

HSP 2 Score: 76.6406 bits (187), Expect = 8.128e-14
Identity = 35/77 (45.45%), Postives = 44/77 (57.14%), Query Frame = 1
Query: 1015 REMKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            R   E   C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I +  R  CQ+CR QKCL LGM+
Sbjct:    2 RAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNA--SYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMS 76          

HSP 3 Score: 53.5286 bits (127), Expect = 1.517e-6
Identity = 41/186 (22.04%), Postives = 84/186 (45.16%), Query Frame = 1
Query: 2395 HAIQ-VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLK---FPNLYTQMF 2940
            HAIQ V++FAK + GF EL  ND  +L++ G   ++LV++ R FN      N   F  K   + + +    + + +      + +    L +   +L     L+  +   + +  KV ++ +    AL+  + +       +  ++   P ++ + + H E + + + S P +    FP LY ++F
Sbjct:  268 HAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLN---NTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNLCSLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYKELF 450          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Human
Match: RORB (RAR related orphan receptor B [Source:HGNC Symbol;Acc:HGNC:10259])

HSP 1 Score: 106.301 bits (264), Expect = 2.485e-23
Identity = 43/82 (52.44%), Postives = 60/82 (73.17%), Query Frame = 1
Query: 1279 ISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
            I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+   RN C+ CR +KCLA+GMS++  + GR
Sbjct:   16 IEVIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQNNASYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGR 95          

HSP 2 Score: 76.2554 bits (186), Expect = 1.150e-13
Identity = 33/69 (47.83%), Postives = 42/69 (60.87%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I +  R  CQ+CR QKCL LGM+
Sbjct:   21 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNA--SYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMS 87          

HSP 3 Score: 53.9138 bits (128), Expect = 1.215e-6
Identity = 41/186 (22.04%), Postives = 84/186 (45.16%), Query Frame = 1
Query: 2395 HAIQ-VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLK---FPNLYTQMF 2940
            HAIQ V++FAK + GF EL  ND  +L++ G   ++LV++ R FN      N   F  K   + + +    + + +      + +    L +   +L     L+  +   + +  KV ++ +    AL+  + +       +  ++   P ++ + + H E + + + S P +    FP LY ++F
Sbjct:  279 HAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLN---NTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNLCSLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYKELF 461          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Human
Match: RORA (RAR related orphan receptor A [Source:HGNC Symbol;Acc:HGNC:10258])

HSP 1 Score: 106.301 bits (264), Expect = 2.573e-23
Identity = 43/82 (52.44%), Postives = 61/82 (74.39%), Query Frame = 1
Query: 1279 ISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
            I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+  +RN C+ CR +KCLA+GMS++  + GR
Sbjct:   13 IEIIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGR 92          

HSP 2 Score: 73.559 bits (179), Expect = 8.877e-13
Identity = 32/69 (46.38%), Postives = 43/69 (62.32%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I + +R  CQ+CR QKCL +GM+
Sbjct:   18 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNA--TYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMS 84          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Celegans
Match: nhr-23 (Nuclear hormone receptor family member nhr-23 [Source:UniProtKB/Swiss-Prot;Acc:P41828])

HSP 1 Score: 102.834 bits (255), Expect = 1.061e-22
Identity = 46/105 (43.81%), Postives = 65/105 (61.90%), Query Frame = 1
Query: 1261 LNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIR 1575
            +  +  I +IPC+VCG +SSG H+G ITCEGCKGFFRR+ +   N  Y C    NCV++   RN C+ CR KKC+ +GMS++  + GR     +     E+ Q+R
Sbjct:    1 MRVSAQIEVIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSIVN--YQCPRQKNCVVDRVNRNRCQYCRLKKCIELGMSRDAVKFGRMSKKQREKVEDEV-QVR 102          

HSP 2 Score: 73.9442 bits (180), Expect = 2.464e-13
Identity = 33/73 (45.21%), Postives = 40/73 (54.79%), Query Frame = 1
Query: 1027 EKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            E   C VCGD S+G H     CE CK FF RS    S   Y C +  NC + +  R  CQYCR +KC+ LGM+
Sbjct:    8 EVIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQ--SSIVNYQCPRQKNCVVDRVNRNRCQYCRLKKCIELGMS 78          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Celegans
Match: nhr-23 (Nuclear hormone receptor family member nhr-23 [Source:UniProtKB/Swiss-Prot;Acc:P41828])

HSP 1 Score: 102.064 bits (253), Expect = 1.876e-22
Identity = 43/88 (48.86%), Postives = 59/88 (67.05%), Query Frame = 1
Query: 1261 LNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
            +  +  I +IPC+VCG +SSG H+G ITCEGCKGFFRR+ +   N  Y C    NCV++   RN C+ CR KKC+ +GMS++  + GR
Sbjct:    1 MRVSAQIEVIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSIVN--YQCPRQKNCVVDRVNRNRCQYCRLKKCIELGMSRDAVKFGR 86          

HSP 2 Score: 73.559 bits (179), Expect = 2.528e-13
Identity = 33/73 (45.21%), Postives = 40/73 (54.79%), Query Frame = 1
Query: 1027 EKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            E   C VCGD S+G H     CE CK FF RS    S   Y C +  NC + +  R  CQYCR +KC+ LGM+
Sbjct:    8 EVIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQ--SSIVNYQCPRQKNCVVDRVNRNRCQYCRLKKCIELGMS 78          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Celegans
Match: nhr-23 (Nuclear hormone receptor family member nhr-23 [Source:UniProtKB/Swiss-Prot;Acc:P41828])

HSP 1 Score: 102.834 bits (255), Expect = 2.534e-22
Identity = 47/106 (44.34%), Postives = 66/106 (62.26%), Query Frame = 1
Query: 1258 NLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIR 1575
            +L  +  I +IPC+VCG +SSG H+G ITCEGCKGFFRR+ +   N  Y C    NCV++   RN C+ CR KKC+ +GMS++  + GR     +     E+ Q+R
Sbjct:  116 SLLVSAQIEVIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSIVN--YQCPRQKNCVVDRVNRNRCQYCRLKKCIELGMSRDAVKFGRMSKKQREKVEDEV-QVR 218          

HSP 2 Score: 73.9442 bits (180), Expect = 3.501e-13
Identity = 32/69 (46.38%), Postives = 39/69 (56.52%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C VCGD S+G H     CE CK FF RS    S   Y C +  NC + +  R  CQYCR +KC+ LGM+
Sbjct:  128 CKVCGDKSSGVHYGVITCEGCKGFFRRSQ--SSIVNYQCPRQKNCVVDRVNRNRCQYCRLKKCIELGMS 194          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Celegans
Match: nhr-23 (Nuclear hormone receptor family member nhr-23 [Source:UniProtKB/Swiss-Prot;Acc:P41828])

HSP 1 Score: 102.064 bits (253), Expect = 4.571e-22
Identity = 45/102 (44.12%), Postives = 63/102 (61.76%), Query Frame = 1
Query: 1258 NLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEI 1563
            +L  +  I +IPC+VCG +SSG H+G ITCEGCKGFFRR+ +   N  Y C    NCV++   RN C+ CR KKC+ +GMS++  + GR     +     E+
Sbjct:  116 SLLVSAQIEVIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSIVN--YQCPRQKNCVVDRVNRNRCQYCRLKKCIELGMSRDAVKFGRMSKKQREKVEDEV 215          

HSP 2 Score: 73.9442 bits (180), Expect = 3.396e-13
Identity = 32/69 (46.38%), Postives = 39/69 (56.52%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C VCGD S+G H     CE CK FF RS    S   Y C +  NC + +  R  CQYCR +KC+ LGM+
Sbjct:  128 CKVCGDKSSGVHYGVITCEGCKGFFRRSQS--SIVNYQCPRQKNCVVDRVNRNRCQYCRLKKCIELGMS 194          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Celegans
Match: nhr-23 (Nuclear hormone receptor family member nhr-23 [Source:UniProtKB/Swiss-Prot;Acc:P41828])

HSP 1 Score: 102.064 bits (253), Expect = 5.925e-22
Identity = 48/112 (42.86%), Postives = 68/112 (60.71%), Query Frame = 1
Query: 1258 NLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLALN 1593
            +L  +  I +IPC+VCG +SSG H+G ITCEGCKGFFRR+ +   N  Y C    NCV++   RN C+ CR KKC+ +GMS++  + GR     +     E+ ++   LA N
Sbjct:  151 SLLVSAQIEVIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSIVN--YQCPRQKNCVVDRVNRNRCQYCRLKKCIELGMSRDAVKFGRMSKKQREKVEDEV-RMHKELAAN 259          

HSP 2 Score: 73.9442 bits (180), Expect = 3.939e-13
Identity = 33/73 (45.21%), Postives = 40/73 (54.79%), Query Frame = 1
Query: 1027 EKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            E   C VCGD S+G H     CE CK FF RS    S   Y C +  NC + +  R  CQYCR +KC+ LGM+
Sbjct:  159 EVIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQ--SSIVNYQCPRQKNCVVDRVNRNRCQYCRLKKCIELGMS 229          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Fly
Match: Hr3 (gene:FBgn0000448 transcript:FBtr0112799)

HSP 1 Score: 104.375 bits (259), Expect = 4.665e-23
Identity = 46/104 (44.23%), Postives = 64/104 (61.54%), Query Frame = 1
Query: 1279 ISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEI----SQIRA 1578
            I +IPC+VCG +SSG H+G ITCEGCKGFFRR+ +   N  Y C     CV++   RN C+ CR +KCL +GMS++  + GR     +     E+    +Q+RA
Sbjct:   17 IEIIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVVN--YQCPRNKQCVVDRVNRNRCQYCRLQKCLKLGMSRDAVKFGRMSKKQREKVEDEVRFHRAQMRA 118          

HSP 2 Score: 78.5666 bits (192), Expect = 9.044e-15
Identity = 34/69 (49.28%), Postives = 39/69 (56.52%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C VCGD S+G H     CE CK FF RS    S   Y C +N  C + +  R  CQYCR QKCL LGM+
Sbjct:   22 CKVCGDKSSGVHYGVITCEGCKGFFRRSQS--SVVNYQCPRNKQCVVDRVNRNRCQYCRLQKCLKLGMS 88          

HSP 3 Score: 65.855 bits (159), Expect = 1.125e-10
Identity = 42/191 (21.99%), Postives = 93/191 (48.69%), Query Frame = 1
Query: 2407 VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFN------KIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYM----TEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLKFPNLYTQMFLID 2949
            +I+FAK +PGF  L  +D  +L++ G + + +V++SR  +L+ +   Y        +++L + A +       ++   + ++ + I    L +T  +L   + L+  E   V    ++ +++  SMNA++  +      +      +D++L   P    ++  H E++   +   P++ FP LY ++F ID
Sbjct:  267 IIEFAKLIPGFMRLSQDDQILLLKTGSFELAIVRMSRLLDLSQNAVLY-------GDVMLPQEAFYTSDSEEMRLVSRIFQTAKSIAELKLTETELALYQSLVLLWPERNGVRGNTEIQRLFNLSMNAIRQELETNHAPLKGDVTVLDTLLNNIPNFRDISILHMESLSKFKLQHPNVVFPALYKELFSID 450          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Fly
Match: Hr3 (gene:FBgn0000448 transcript:FBtr0088368)

HSP 1 Score: 104.375 bits (259), Expect = 6.261e-23
Identity = 46/104 (44.23%), Postives = 64/104 (61.54%), Query Frame = 1
Query: 1279 ISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEI----SQIRA 1578
            I +IPC+VCG +SSG H+G ITCEGCKGFFRR+ +   N  Y C     CV++   RN C+ CR +KCL +GMS++  + GR     +     E+    +Q+RA
Sbjct:   46 IEIIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVVN--YQCPRNKQCVVDRVNRNRCQYCRLQKCLKLGMSRDAVKFGRMSKKQREKVEDEVRFHRAQMRA 147          

HSP 2 Score: 78.5666 bits (192), Expect = 1.067e-14
Identity = 34/69 (49.28%), Postives = 39/69 (56.52%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C VCGD S+G H     CE CK FF RS    S   Y C +N  C + +  R  CQYCR QKCL LGM+
Sbjct:   51 CKVCGDKSSGVHYGVITCEGCKGFFRRSQS--SVVNYQCPRNKQCVVDRVNRNRCQYCRLQKCLKLGMS 117          

HSP 3 Score: 66.2402 bits (160), Expect = 8.513e-11
Identity = 42/191 (21.99%), Postives = 93/191 (48.69%), Query Frame = 1
Query: 2407 VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFN------KIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYM----TEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLKFPNLYTQMFLID 2949
            +I+FAK +PGF  L  +D  +L++ G + + +V++SR  +L+ +   Y        +++L + A +       ++   + ++ + I    L +T  +L   + L+  E   V    ++ +++  SMNA++  +      +      +D++L   P    ++  H E++   +   P++ FP LY ++F ID
Sbjct:  298 IIEFAKLIPGFMRLSQDDQILLLKTGSFELAIVRMSRLLDLSQNAVLY-------GDVMLPQEAFYTSDSEEMRLVSRIFQTAKSIAELKLTETELALYQSLVLLWPERNGVRGNTEIQRLFNLSMNAIRQELETNHAPLKGDVTVLDTLLNNIPNFRDISILHMESLSKFKLQHPNVVFPALYKELFSID 481          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Fly
Match: Hr3 (gene:FBgn0000448 transcript:FBtr0306345)

HSP 1 Score: 104.375 bits (259), Expect = 6.261e-23
Identity = 46/104 (44.23%), Postives = 64/104 (61.54%), Query Frame = 1
Query: 1279 ISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEI----SQIRA 1578
            I +IPC+VCG +SSG H+G ITCEGCKGFFRR+ +   N  Y C     CV++   RN C+ CR +KCL +GMS++  + GR     +     E+    +Q+RA
Sbjct:   46 IEIIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVVN--YQCPRNKQCVVDRVNRNRCQYCRLQKCLKLGMSRDAVKFGRMSKKQREKVEDEVRFHRAQMRA 147          

HSP 2 Score: 78.5666 bits (192), Expect = 1.067e-14
Identity = 34/69 (49.28%), Postives = 39/69 (56.52%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C VCGD S+G H     CE CK FF RS    S   Y C +N  C + +  R  CQYCR QKCL LGM+
Sbjct:   51 CKVCGDKSSGVHYGVITCEGCKGFFRRSQS--SVVNYQCPRNKQCVVDRVNRNRCQYCRLQKCLKLGMS 117          

HSP 3 Score: 66.2402 bits (160), Expect = 8.513e-11
Identity = 42/191 (21.99%), Postives = 93/191 (48.69%), Query Frame = 1
Query: 2407 VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFN------KIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYM----TEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLKFPNLYTQMFLID 2949
            +I+FAK +PGF  L  +D  +L++ G + + +V++SR  +L+ +   Y        +++L + A +       ++   + ++ + I    L +T  +L   + L+  E   V    ++ +++  SMNA++  +      +      +D++L   P    ++  H E++   +   P++ FP LY ++F ID
Sbjct:  298 IIEFAKLIPGFMRLSQDDQILLLKTGSFELAIVRMSRLLDLSQNAVLY-------GDVMLPQEAFYTSDSEEMRLVSRIFQTAKSIAELKLTETELALYQSLVLLWPERNGVRGNTEIQRLFNLSMNAIRQELETNHAPLKGDVTVLDTLLNNIPNFRDISILHMESLSKFKLQHPNVVFPALYKELFSID 481          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Fly
Match: Hr3 (gene:FBgn0000448 transcript:FBtr0330609)

HSP 1 Score: 104.375 bits (259), Expect = 8.074e-23
Identity = 46/104 (44.23%), Postives = 64/104 (61.54%), Query Frame = 1
Query: 1279 ISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEI----SQIRA 1578
            I +IPC+VCG +SSG H+G ITCEGCKGFFRR+ +   N  Y C     CV++   RN C+ CR +KCL +GMS++  + GR     +     E+    +Q+RA
Sbjct:   46 IEIIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVVN--YQCPRNKQCVVDRVNRNRCQYCRLQKCLKLGMSRDAVKFGRMSKKQREKVEDEVRFHRAQMRA 147          

HSP 2 Score: 78.9518 bits (193), Expect = 1.003e-14
Identity = 34/69 (49.28%), Postives = 39/69 (56.52%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C VCGD S+G H     CE CK FF RS    S   Y C +N  C + +  R  CQYCR QKCL LGM+
Sbjct:   51 CKVCGDKSSGVHYGVITCEGCKGFFRRSQS--SVVNYQCPRNKQCVVDRVNRNRCQYCRLQKCLKLGMS 117          

HSP 3 Score: 66.6254 bits (161), Expect = 7.666e-11
Identity = 42/191 (21.99%), Postives = 93/191 (48.69%), Query Frame = 1
Query: 2407 VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFN------KIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYM----TEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLKFPNLYTQMFLID 2949
            +I+FAK +PGF  L  +D  +L++ G + + +V++SR  +L+ +   Y        +++L + A +       ++   + ++ + I    L +T  +L   + L+  E   V    ++ +++  SMNA++  +      +      +D++L   P    ++  H E++   +   P++ FP LY ++F ID
Sbjct:  298 IIEFAKLIPGFMRLSQDDQILLLKTGSFELAIVRMSRLLDLSQNAVLY-------GDVMLPQEAFYTSDSEEMRLVSRIFQTAKSIAELKLTETELALYQSLVLLWPERNGVRGNTEIQRLFNLSMNAIRQELETNHAPLKGDVTVLDTLLNNIPNFRDISILHMESLSKFKLQHPNVVFPALYKELFSID 481          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Fly
Match: eg (gene:FBgn0000560 transcript:FBtr0078437)

HSP 1 Score: 101.293 bits (251), Expect = 1.735e-22
Identity = 47/86 (54.65%), Postives = 57/86 (66.28%), Query Frame = 1
Query: 1294 CRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMC 1551
            C+VCG  ++GFHFGA TCEGCK FF RT N        C++ G+CVIN   R  CK+CR +KCL +GMSK GSR GR+ N  K  C
Sbjct:    5 CKVCGEPAAGFHFGAFTCEGCKSFFGRTYNNIA-AIAGCKHNGDCVINKKNRTACKACRLRKCLLVGMSKSGSRYGRRSNWFKIHC 89          

HSP 2 Score: 72.0182 bits (175), Expect = 8.871e-13
Identity = 35/86 (40.70%), Postives = 48/86 (55.81%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMTLPGANLNQNTDISLIPC 1296
            C VCG+ +AGFH  AF CE CK FF R+    +     C  N +C I K  RT C+ CR +KCL +GM+  G+   + ++   I C
Sbjct:    5 CKVCGEPAAGFHFGAFTCEGCKSFFGRTYNNIAAIA-GCKHNGDCVINKKNRTACKACRLRKCLLVGMSKSGSRYGRRSNWFKIHC 89          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Zebrafish
Match: rorca (RAR-related orphan receptor C a [Source:ZFIN;Acc:ZDB-GENE-990415-250])

HSP 1 Score: 117.087 bits (292), Expect = 5.337e-27
Identity = 61/157 (38.85%), Postives = 90/157 (57.32%), Query Frame = 1
Query: 1267 QNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEI-----SQIRAGLALNHFSNNNSHSIGHTDSGMIQAYLPNHLSSAIMSTMNLDFNLTNG 1722
            + T I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+   RN C+ CR +KCLA+GMS++  + GR     +     E+     SQ RAG   N  S++     G   +G  +AY  +  SS  +S ++    L +G
Sbjct:    2 RETQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQNNAMYSCSRQRNCIIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQSQERAGGLGNGISSHTGDEAGENGNGHSRAY--SRGSSTTLSDLDDITTLPDG 154          

HSP 2 Score: 77.411 bits (189), Expect = 3.711e-14
Identity = 33/69 (47.83%), Postives = 43/69 (62.32%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC++  NC I +  R  CQ+CR QKCL LGM+
Sbjct:   11 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNAM--YSCSRQRNCIIDRTNRNRCQHCRLQKCLALGMS 77          

HSP 3 Score: 55.8398 bits (133), Expect = 1.941e-7
Identity = 41/184 (22.28%), Postives = 84/184 (45.65%), Query Frame = 1
Query: 2398 AIQ-VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLK--FPNLYTQMF 2940
            AIQ V++FAK + GF +L  ND  +L++ G   ++L+++ R +N      N   F  K     L +    + +   V +  + +    L +   +L     L+  +   + D  KV ++ +    AL+ Y+ + G  + ++  ++   P++  + + H + +   R   P     FP LY ++F
Sbjct:  288 AIQYVVEFAKRISGFMDLSQNDQIILLKAGCLDVLLIRMCRAYNPIN---NTLLFDGKFASPQLFKALGCDDLVSAVFEMAKTLSRLQLSEEEMALFTATVLLSPDRPWLTDAQKVQKLQEKVYVALQHYLHKSGVHEEKLAKMVSKLPMMKSICNLHIDKLEFFRLLHPETAYNFPALYREVF 468          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Zebrafish
Match: rorca (RAR-related orphan receptor C a [Source:ZFIN;Acc:ZDB-GENE-990415-250])

HSP 1 Score: 115.161 bits (287), Expect = 2.392e-26
Identity = 60/153 (39.22%), Postives = 88/153 (57.52%), Query Frame = 1
Query: 1279 ISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEI-----SQIRAGLALNHFSNNNSHSIGHTDSGMIQAYLPNHLSSAIMSTMNLDFNLTNG 1722
            I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+   RN C+ CR +KCLA+GMS++  + GR     +     E+     SQ RAG   N  S++     G   +G  +AY  +  SS  +S ++    L +G
Sbjct:    5 IEVIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQNNAMYSCSRQRNCIIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQSQERAGGLGNGISSHTGDEAGENGNGHSRAY--SRGSSTTLSDLDDITTLPDG 153          

HSP 2 Score: 77.411 bits (189), Expect = 3.696e-14
Identity = 35/77 (45.45%), Postives = 45/77 (58.44%), Query Frame = 1
Query: 1015 REMKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            R   E   C +CGD S+G H     CE CK FF RS + ++   YSC++  NC I +  R  CQ+CR QKCL LGM+
Sbjct:    2 RAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNAM--YSCSRQRNCIIDRTNRNRCQHCRLQKCLALGMS 76          

HSP 3 Score: 55.8398 bits (133), Expect = 1.921e-7
Identity = 41/184 (22.28%), Postives = 84/184 (45.65%), Query Frame = 1
Query: 2398 AIQ-VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLK--FPNLYTQMF 2940
            AIQ V++FAK + GF +L  ND  +L++ G   ++L+++ R +N      N   F  K     L +    + +   V +  + +    L +   +L     L+  +   + D  KV ++ +    AL+ Y+ + G  + ++  ++   P++  + + H + +   R   P     FP LY ++F
Sbjct:  287 AIQYVVEFAKRISGFMDLSQNDQIILLKAGCLDVLLIRMCRAYNPIN---NTLLFDGKFASPQLFKALGCDDLVSAVFEMAKTLSRLQLSEEEMALFTATVLLSPDRPWLTDAQKVQKLQEKVYVALQHYLHKSGVHEEKLAKMVSKLPMMKSICNLHIDKLEFFRLLHPETAYNFPALYREVF 467          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Zebrafish
Match: rorc (RAR-related orphan receptor C [Source:ZFIN;Acc:ZDB-GENE-110411-42])

HSP 1 Score: 104.375 bits (259), Expect = 2.726e-24
Identity = 52/134 (38.81%), Postives = 74/134 (55.22%), Query Frame = 1
Query: 1270 NTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLALNHFSNNNSHSIGHTDSGMIQAYLPNHL 1671
               I +IPC++CG +SSG H+G ITCEGCKGFFRR+  +  + +Y+C    NC I+ A+RN C+SCR KKC+A GMS++  + GR     +     E+ + R    L   S      +    S       P+HL
Sbjct:    2 RAQIEVIPCKICGDKSSGVHYGVITCEGCKGFFRRS--QSSSVQYSCSRQSNCPIDRASRNRCQSCRLKKCVAQGMSRDAVKFGRMSKRQRDSLFAEVERHRQHQRLQANSVQEPQPLQAYRSSKDTREQPSHL 133          

HSP 2 Score: 70.4774 bits (171), Expect = 9.451e-13
Identity = 33/77 (42.86%), Postives = 44/77 (57.14%), Query Frame = 1
Query: 1015 REMKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            R   E   C +CGD S+G H     CE CK FF RS    S  +YSC++ +NC I + +R  CQ CR +KC+  GM+
Sbjct:    2 RAQIEVIPCKICGDKSSGVHYGVITCEGCKGFFRRSQ--SSSVQYSCSRQSNCPIDRASRNRCQSCRLKKCVAQGMS 76          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Zebrafish
Match: rorc (RAR-related orphan receptor C [Source:ZFIN;Acc:ZDB-GENE-110411-42])

HSP 1 Score: 107.457 bits (267), Expect = 6.913e-24
Identity = 44/85 (51.76%), Postives = 61/85 (71.76%), Query Frame = 1
Query: 1270 NTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
               I +IPC++CG +SSG H+G ITCEGCKGFFRR+  +  + +Y+C    NC I+ A+RN C+SCR KKC+A GMS++  + GR
Sbjct:    2 RAQIEVIPCKICGDKSSGVHYGVITCEGCKGFFRRS--QSSSVQYSCSRQSNCPIDRASRNRCQSCRLKKCVAQGMSRDAVKFGR 84          

HSP 2 Score: 72.7886 bits (177), Expect = 1.122e-12
Identity = 31/69 (44.93%), Postives = 42/69 (60.87%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS    S  +YSC++ +NC I + +R  CQ CR +KC+  GM+
Sbjct:   10 CKICGDKSSGVHYGVITCEGCKGFFRRSQ--SSSVQYSCSRQSNCPIDRASRNRCQSCRLKKCVAQGMS 76          

HSP 3 Score: 58.5362 bits (140), Expect = 2.894e-8
Identity = 48/185 (25.95%), Postives = 92/185 (49.73%), Query Frame = 1
Query: 2398 AIQ-VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKP---HLKFPNLYTQMF 2940
            A+Q V++FAK +PGF++L  ND   L++ G   ++LV+++R FN A +   +F+      E+  +  A  + IA     +  L  L+ L++   ++   + L+  +   + DR +V ++      AL+ ++    + ++ +  + +  PVL  M   H E +   R   P   H  FP LY ++F
Sbjct:  287 AVQYVVEFAKRIPGFRQLCQNDQIALLKSGSMEVVLVRMTRMFNTANNTV-FFDGKYAGTELFKS-LACSDLIAAVFEFANNLCALR-LNEQQMAVFTAMILINPDRPCLEDRERVQRVRTEVELALR-HILHRDNQESLLQKLYQRVPVLRSMCALHIEKLQWFRQLYPLTVHSLFPPLYKELF 467          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Zebrafish
Match: rorcb (RAR-related orphan receptor C b [Source:ZFIN;Acc:ZDB-GENE-040724-215])

HSP 1 Score: 107.457 bits (267), Expect = 8.512e-24
Identity = 43/82 (52.44%), Postives = 60/82 (73.17%), Query Frame = 1
Query: 1279 ISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
            I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+   RN C+ CR +KCLA+GMS++  + GR
Sbjct:    5 IEVIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQNNAMYSCSRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGR 84          

HSP 2 Score: 77.411 bits (189), Expect = 4.051e-14
Identity = 35/77 (45.45%), Postives = 45/77 (58.44%), Query Frame = 1
Query: 1015 REMKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            R   E   C +CGD S+G H     CE CK FF RS + ++   YSC++  NC I +  R  CQ+CR QKCL LGM+
Sbjct:    2 RAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNAM--YSCSRQRNCLIDRTNRNRCQHCRLQKCLALGMS 76          

HSP 3 Score: 52.7582 bits (125), Expect = 2.048e-6
Identity = 41/184 (22.28%), Postives = 85/184 (46.20%), Query Frame = 1
Query: 2398 AIQ-VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPH--LKFPNLYTQMF 2940
            AIQ V++FAK + GF EL  ND  +L++ G   ++L+++ R +N +    N   F  K     L +    + + + V +  + +    L +   +L     L+  +   + +  +V ++ +    AL+  +   G+T  ++D ++   P +  + + H + +   R   P     FP LY ++F
Sbjct:  288 AIQYVVEFAKRISGFMELCQNDQIILLKAGCLEVLLIRMCRAYNSSN---NTMFFDGKFASPQLFKALGCDDLVNAVFELAKSLSRLQLSEEEMALYSAAVLLAPDRPWLTESQQVQKLQEKVYVALQHSLHMNGATIEKLDKMVSKLPQMKSICNLHIDKLEFFRLVHPETAYSFPPLYREVF 468          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Xenopus
Match: kcnk4 (potassium channel, two pore domain subfamily K, member 4 [Source:Xenbase;Acc:XB-GENE-994204])

HSP 1 Score: 107.842 bits (268), Expect = 6.074e-24
Identity = 46/108 (42.59%), Postives = 69/108 (63.89%), Query Frame = 1
Query: 1273 TDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLALNH 1596
            + I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+  +RN C+ CR +KCLA+GMS++  + GR     +     E+ + R     +H
Sbjct:    4 SQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQRDH 109          

HSP 2 Score: 75.485 bits (184), Expect = 1.760e-13
Identity = 32/69 (46.38%), Postives = 43/69 (62.32%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I + +R  CQ+CR QKCL +GM+
Sbjct:   11 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNA--TYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMS 77          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Xenopus
Match: kcnk4 (potassium channel, two pore domain subfamily K, member 4 [Source:Xenbase;Acc:XB-GENE-994204])

HSP 1 Score: 107.842 bits (268), Expect = 6.279e-24
Identity = 46/108 (42.59%), Postives = 69/108 (63.89%), Query Frame = 1
Query: 1273 TDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLALNH 1596
            + I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+  +RN C+ CR +KCLA+GMS++  + GR     +     E+ + R     +H
Sbjct:    2 SQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQRDH 107          

HSP 2 Score: 75.485 bits (184), Expect = 1.684e-13
Identity = 32/69 (46.38%), Postives = 43/69 (62.32%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I + +R  CQ+CR QKCL +GM+
Sbjct:    9 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNA--TYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMS 75          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Xenopus
Match: kcnk4 (potassium channel, two pore domain subfamily K, member 4 [Source:Xenbase;Acc:XB-GENE-994204])

HSP 1 Score: 107.842 bits (268), Expect = 6.394e-24
Identity = 46/108 (42.59%), Postives = 69/108 (63.89%), Query Frame = 1
Query: 1273 TDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLALNH 1596
            + I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+  +RN C+ CR +KCLA+GMS++  + GR     +     E+ + R     +H
Sbjct:    2 SQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQRDH 107          

HSP 2 Score: 75.485 bits (184), Expect = 1.684e-13
Identity = 32/69 (46.38%), Postives = 43/69 (62.32%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I + +R  CQ+CR QKCL +GM+
Sbjct:    9 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNA--TYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMS 75          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Xenopus
Match: kcnk4 (potassium channel, two pore domain subfamily K, member 4 [Source:Xenbase;Acc:XB-GENE-994204])

HSP 1 Score: 107.842 bits (268), Expect = 6.713e-24
Identity = 46/108 (42.59%), Postives = 69/108 (63.89%), Query Frame = 1
Query: 1273 TDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLALNH 1596
            + I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+  +RN C+ CR +KCLA+GMS++  + GR     +     E+ + R     +H
Sbjct:    4 SQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQRDH 109          

HSP 2 Score: 75.485 bits (184), Expect = 1.745e-13
Identity = 32/69 (46.38%), Postives = 43/69 (62.32%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I + +R  CQ+CR QKCL +GM+
Sbjct:   11 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNA--TYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMS 77          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Xenopus
Match: kcnk4 (potassium channel, two pore domain subfamily K, member 4 [Source:Xenbase;Acc:XB-GENE-994204])

HSP 1 Score: 107.457 bits (267), Expect = 8.296e-24
Identity = 46/110 (41.82%), Postives = 69/110 (62.73%), Query Frame = 1
Query: 1267 QNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLALNH 1596
            +   I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+  +RN C+ CR +KCLA+GMS++  + GR     +     E+ + R     +H
Sbjct:    4 RRAQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQRDH 111          

HSP 2 Score: 75.485 bits (184), Expect = 1.889e-13
Identity = 32/69 (46.38%), Postives = 43/69 (62.32%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I + +R  CQ+CR QKCL +GM+
Sbjct:   13 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNA--TYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMS 79          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Mouse
Match: Rorb (RAR-related orphan receptor beta [Source:MGI Symbol;Acc:MGI:1343464])

HSP 1 Score: 107.842 bits (268), Expect = 5.552e-24
Identity = 44/92 (47.83%), Postives = 62/92 (67.39%), Query Frame = 1
Query: 1249 PGANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
            P    +    I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+   RN C+ CR +KCLA+GMS++  + GR
Sbjct:    6 PKTKADGTAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQNNASYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGR 95          

HSP 2 Score: 76.2554 bits (186), Expect = 7.893e-14
Identity = 33/69 (47.83%), Postives = 42/69 (60.87%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I +  R  CQ+CR QKCL LGM+
Sbjct:   21 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNA--SYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMS 87          

HSP 3 Score: 53.5286 bits (127), Expect = 1.017e-6
Identity = 41/186 (22.04%), Postives = 84/186 (45.16%), Query Frame = 1
Query: 2395 HAIQ-VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLK---FPNLYTQMF 2940
            HAIQ V++FAK + GF EL  ND  +L++ G   ++LV++ R FN      N   F  K   + + +    + + +      + +    L +   +L     L+  +   + +  KV ++ +    AL+  + +       +  ++   P ++ + + H E + + + S P +    FP LY ++F
Sbjct:  279 HAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLN---NTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNLCSLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPDIVNTLFPPLYKELF 461          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Mouse
Match: Rorb (RAR-related orphan receptor beta [Source:MGI Symbol;Acc:MGI:1343464])

HSP 1 Score: 106.301 bits (264), Expect = 1.557e-23
Identity = 43/82 (52.44%), Postives = 60/82 (73.17%), Query Frame = 1
Query: 1279 ISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
            I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+   RN C+ CR +KCLA+GMS++  + GR
Sbjct:    5 IEVIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQNNASYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGR 84          

HSP 2 Score: 76.6406 bits (187), Expect = 5.679e-14
Identity = 35/77 (45.45%), Postives = 44/77 (57.14%), Query Frame = 1
Query: 1015 REMKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            R   E   C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I +  R  CQ+CR QKCL LGM+
Sbjct:    2 RAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNA--SYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMS 76          

HSP 3 Score: 53.1434 bits (126), Expect = 1.537e-6
Identity = 41/186 (22.04%), Postives = 84/186 (45.16%), Query Frame = 1
Query: 2395 HAIQ-VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLK---FPNLYTQMF 2940
            HAIQ V++FAK + GF EL  ND  +L++ G   ++LV++ R FN      N   F  K   + + +    + + +      + +    L +   +L     L+  +   + +  KV ++ +    AL+  + +       +  ++   P ++ + + H E + + + S P +    FP LY ++F
Sbjct:  268 HAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLN---NTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNLCSLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPDIVNTLFPPLYKELF 450          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Mouse
Match: Rora (RAR-related orphan receptor alpha [Source:MGI Symbol;Acc:MGI:104661])

HSP 1 Score: 106.301 bits (264), Expect = 1.703e-23
Identity = 43/85 (50.59%), Postives = 61/85 (71.76%), Query Frame = 1
Query: 1270 NTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
               I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+  +RN C+ CR +KCLA+GMS++  + GR
Sbjct:    9 KAQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGR 91          

HSP 2 Score: 73.559 bits (179), Expect = 6.287e-13
Identity = 32/69 (46.38%), Postives = 43/69 (62.32%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I + +R  CQ+CR QKCL +GM+
Sbjct:   17 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNA--TYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMS 83          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Mouse
Match: Rora (RAR-related orphan receptor alpha [Source:MGI Symbol;Acc:MGI:104661])

HSP 1 Score: 106.301 bits (264), Expect = 2.689e-23
Identity = 43/85 (50.59%), Postives = 62/85 (72.94%), Query Frame = 1
Query: 1270 NTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
             + I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+  +RN C+ CR +KCLA+GMS++  + GR
Sbjct:   65 TSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGR 147          

HSP 2 Score: 74.3294 bits (181), Expect = 4.162e-13
Identity = 32/69 (46.38%), Postives = 43/69 (62.32%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I + +R  CQ+CR QKCL +GM+
Sbjct:   73 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNA--TYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMS 139          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Mouse
Match: Pparg (peroxisome proliferator activated receptor gamma [Source:MGI Symbol;Acc:MGI:97747])

HSP 1 Score: 99.7525 bits (247), Expect = 4.421e-23
Identity = 50/93 (53.76%), Postives = 59/93 (63.44%), Query Frame = 1
Query: 1288 IPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEIS 1566
            I CRVCG ++SGFH+G   CEGCKGFFRRTI  R    Y  R   NC I+  +RN C+ CR++KCLA+GMS    R GR P A K     EIS
Sbjct:  107 IECRVCGDKASGFHYGVHACEGCKGFFRRTI--RLKLIYD-RCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEIS 196          

HSP 2 Score: 66.6254 bits (161), Expect = 1.109e-11
Identity = 33/70 (47.14%), Postives = 42/70 (60.00%), Query Frame = 1
Query: 1036 KCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            +C VCGD ++GFH     CE CK FF R+ +        C  + NC I K +R  CQYCRFQKCL +GM+
Sbjct:  108 ECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYD-RC--DLNCRIHKKSRNKCQYCRFQKCLAVGMS 174          
BLAST of Nuclear receptor 2DBD gamma vs. UniProt/SwissProt
Match: sp|Q8R1B8|RORB_MOUSE (Nuclear receptor ROR-beta OS=Mus musculus OX=10090 GN=Rorb PE=1 SV=3)

HSP 1 Score: 107.842 bits (268), Expect = 3.884e-23
Identity = 44/92 (47.83%), Postives = 62/92 (67.39%), Query Frame = 1
Query: 1249 PGANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
            P    +    I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+   RN C+ CR +KCLA+GMS++  + GR
Sbjct:    6 PKTKADGTAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQNNASYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGR 95          

HSP 2 Score: 76.2554 bits (186), Expect = 5.521e-13
Identity = 33/69 (47.83%), Postives = 42/69 (60.87%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I +  R  CQ+CR QKCL LGM+
Sbjct:   21 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNA--SYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMS 87          

HSP 3 Score: 53.5286 bits (127), Expect = 7.116e-6
Identity = 41/186 (22.04%), Postives = 84/186 (45.16%), Query Frame = 1
Query: 2395 HAIQ-VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLK---FPNLYTQMF 2940
            HAIQ V++FAK + GF EL  ND  +L++ G   ++LV++ R FN      N   F  K   + + +    + + +      + +    L +   +L     L+  +   + +  KV ++ +    AL+  + +       +  ++   P ++ + + H E + + + S P +    FP LY ++F
Sbjct:  279 HAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLN---NTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNLCSLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPDIVNTLFPPLYKELF 461          
BLAST of Nuclear receptor 2DBD gamma vs. UniProt/SwissProt
Match: sp|Q92753|RORB_HUMAN (Nuclear receptor ROR-beta OS=Homo sapiens OX=9606 GN=RORB PE=1 SV=3)

HSP 1 Score: 106.301 bits (264), Expect = 1.193e-22
Identity = 43/82 (52.44%), Postives = 60/82 (73.17%), Query Frame = 1
Query: 1279 ISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
            I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+   RN C+ CR +KCLA+GMS++  + GR
Sbjct:   16 IEVIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQNNASYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGR 95          

HSP 2 Score: 76.2554 bits (186), Expect = 5.521e-13
Identity = 33/69 (47.83%), Postives = 42/69 (60.87%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I +  R  CQ+CR QKCL LGM+
Sbjct:   21 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNA--SYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMS 87          

HSP 3 Score: 53.9138 bits (128), Expect = 5.834e-6
Identity = 41/186 (22.04%), Postives = 84/186 (45.16%), Query Frame = 1
Query: 2395 HAIQ-VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLK---FPNLYTQMF 2940
            HAIQ V++FAK + GF EL  ND  +L++ G   ++LV++ R FN      N   F  K   + + +    + + +      + +    L +   +L     L+  +   + +  KV ++ +    AL+  + +       +  ++   P ++ + + H E + + + S P +    FP LY ++F
Sbjct:  279 HAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLN---NTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNLCSLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYKELF 461          
BLAST of Nuclear receptor 2DBD gamma vs. UniProt/SwissProt
Match: sp|P45446|RORB_RAT (Nuclear receptor ROR-beta OS=Rattus norvegicus OX=10116 GN=Rorb PE=1 SV=3)

HSP 1 Score: 106.301 bits (264), Expect = 1.260e-22
Identity = 61/172 (35.47%), Postives = 89/172 (51.74%), Query Frame = 1
Query: 1279 ISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLALNHFSNNNSHSIGHTDSGMIQAYLPNHLSSAIMSTMNLDFNLTNGQTRYQQTTAPLPTSEFYLNSNSSK 1794
            I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+   RN C+ CR +KCLA+GMS++  + GR     +     E+ +                      SG  +A L    SS+I + ++ + N   G T        LP SE Y N +S +
Sbjct:   16 IEVIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQNNASYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQK----------HQQRLQEQRQQQSGEAEA-LARVYSSSISNGLS-NLNTETGGTYANGHVIDLPKSEGYYNIDSGQ 173          

HSP 2 Score: 76.2554 bits (186), Expect = 6.028e-13
Identity = 33/69 (47.83%), Postives = 42/69 (60.87%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I +  R  CQ+CR QKCL LGM+
Sbjct:   21 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNA--SYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMS 87          

HSP 3 Score: 53.5286 bits (127), Expect = 7.495e-6
Identity = 41/186 (22.04%), Postives = 84/186 (45.16%), Query Frame = 1
Query: 2395 HAIQ-VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLK---FPNLYTQMF 2940
            HAIQ V++FAK + GF EL  ND  +L++ G   ++LV++ R FN      N   F  K   + + +    + + +      + +    L +   +L     L+  +   + +  KV ++ +    AL+  + +       +  ++   P ++ + + H E + + + S P +    FP LY ++F
Sbjct:  279 HAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLN---NTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNLCSLQLTEEEIALFSSAVLISPDRAWLLEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPDIVNTLFPPLYKELF 461          
BLAST of Nuclear receptor 2DBD gamma vs. UniProt/SwissProt
Match: sp|P35398|RORA_HUMAN (Nuclear receptor ROR-alpha OS=Homo sapiens OX=9606 GN=RORA PE=1 SV=2)

HSP 1 Score: 106.686 bits (265), Expect = 1.376e-22
Identity = 43/85 (50.59%), Postives = 62/85 (72.94%), Query Frame = 1
Query: 1270 NTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
             + I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+  +RN C+ CR +KCLA+GMS++  + GR
Sbjct:   65 TSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGR 147          

HSP 2 Score: 74.3294 bits (181), Expect = 2.512e-12
Identity = 32/69 (46.38%), Postives = 43/69 (62.32%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I + +R  CQ+CR QKCL +GM+
Sbjct:   73 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNA--TYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMS 139          
BLAST of Nuclear receptor 2DBD gamma vs. UniProt/SwissProt
Match: sp|F1QLY4|RORAA_DANRE (Nuclear receptor ROR-alpha A OS=Danio rerio OX=7955 GN=roraa PE=2 SV=2)

HSP 1 Score: 106.301 bits (264), Expect = 1.415e-22
Identity = 43/82 (52.44%), Postives = 61/82 (74.39%), Query Frame = 1
Query: 1279 ISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
            I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+  +RN C+ CR +KCLA+GMS++  + GR
Sbjct:   13 IEIIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQSNAAYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGR 92          

HSP 2 Score: 73.9442 bits (180), Expect = 3.249e-12
Identity = 32/69 (46.38%), Postives = 43/69 (62.32%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I + +R  CQ+CR QKCL +GM+
Sbjct:   18 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNA--AYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMS 84          
BLAST of Nuclear receptor 2DBD gamma vs. TrEMBL
Match: A0A0R3W958 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS6957 PE=3 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 5.971e-96
Identity = 146/189 (77.25%), Postives = 168/189 (88.89%), Query Frame = 1
Query: 1021 MKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMTLPGANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLA 1587
            MKEK  CD+CGDVSAGFHC+A+VCEACKKFFIRSSK ++YTKYSC+K N CE+ KDTRTHCQ CRF KCL +GM LPGA +    DIS+IPCRVCGAQSSGFHFGAITCEGCKGFFRRTI+ER+NQ+YTCRNGG C+I LATRNNCKSCRY+KCL++GMSK+GSRIGRQPNA+KHMCA EI +I++ L 
Sbjct:  229 MKEKTPCDICGDVSAGFHCNAYVCEACKKFFIRSSKNENYTKYSCSKVNACEVNKDTRTHCQRCRFYKCLRIGMVLPGAAVCPANDISIIPCRVCGAQSSGFHFGAITCEGCKGFFRRTISERDNQRYTCRNGGTCLITLATRNNCKSCRYRKCLSVGMSKDGSRIGRQPNAVKHMCAIEIERIKSKLG 417          

HSP 2 Score: 178.718 bits (452), Expect = 8.220e-42
Identity = 86/237 (36.29%), Postives = 138/237 (58.23%), Query Frame = 1
Query: 2236 FSVDMPLHKFISTVNLAAKALCNCRRRVTRQINLLTNTNETYVWDVMMQHFQAHAIQVIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLKFPNLYTQMFLI 2946
            F+  M L  F   +  A+  L NCR+RVT    L +      +W  +M  F+AHA Q+I+FA+A+PGF++L   D K LVQ  MYPI+LVQLSR+  L   +FN++NFS +E+  +L  F   N + DH  +    +   NLD+T  +L C +  ++G +  + +  K+ ++Y ++ +AL+ Y+T   S+      ++++ P LS M   H+ A+  LR S+P L FP+L+ QMF +
Sbjct:  840 FTTQMSLEAFADYIAEASIHLDNCRQRVTGNFLLESEVTAATMWAHVMAQFEAHAHQIIRFARAIPGFRDLPRADTKFLVQASMYPIVLVQLSRE-PLPGGDFNFYNFSPRERRHLLAEFPQINPLVDHFYELTGFLGPLNLDNTEAALFCSIIFLRGSNQKLLEAGKIYEIYNHAASALQQYITVRYSSDERFTHLIKLLPSLSSMNEAHRAAMQDLRQSRPELHFPDLFVQMFQL 1075          
BLAST of Nuclear receptor 2DBD gamma vs. TrEMBL
Match: A0A0X3Q577 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR97737 PE=4 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 1.388e-95
Identity = 146/186 (78.49%), Postives = 168/186 (90.32%), Query Frame = 1
Query: 1021 MKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMTLPGANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRA 1578
            MKEK  CD+CGDVSAGFHC+A+VCEACKKFFIRSSK ++Y KYSC+K N+CE+ KDTRTHCQ CR+QKCL +GM LPGA +    DIS+IPCRVCGAQSSGFHFGAITCEGCKGFFRRTI+ER+NQ+YTCRNGG C+I LATRNNCKSCRY+KCL++GMSK+GSRIGRQPNA+KHMCA EI +IRA
Sbjct:  348 MKEKTPCDICGDVSAGFHCNAYVCEACKKFFIRSSKNENYAKYSCSKVNSCEVNKDTRTHCQRCRYQKCLRIGMVLPGAAVCPANDISIIPCRVCGAQSSGFHFGAITCEGCKGFFRRTISERDNQRYTCRNGGACLITLATRNNCKSCRYRKCLSVGMSKDGSRIGRQPNAVKHMCAMEIERIRA 533          
BLAST of Nuclear receptor 2DBD gamma vs. TrEMBL
Match: A0A4S2LHQ9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008806 PE=3 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 1.876e-95
Identity = 146/188 (77.66%), Postives = 170/188 (90.43%), Query Frame = 1
Query: 1024 KEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMTLPGANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLA 1587
            K++R CD+CGDVSAGFHC+A+VCEACKKFFIRSSKGD+++KY+CTK+N CEI KDTRTHCQ CR+QKCL LGM LPGA +   TDIS IPCRVCGA+SSGFHFGAITCEGCKGFFRRTINERE+Q+YTCRNGGNC +  ATRNNCKSCRY++C+A+GMSK+GSRIGRQPNA+KH CA EI QIR+ +A
Sbjct:  234 KDRRPCDICGDVSAGFHCNAYVCEACKKFFIRSSKGDNFSKYTCTKSNACEINKDTRTHCQRCRYQKCLRLGMVLPGAAVFPATDISEIPCRVCGAKSSGFHFGAITCEGCKGFFRRTINERESQRYTCRNGGNCAVTGATRNNCKSCRYRRCVAVGMSKDGSRIGRQPNAVKHRCAIEIEQIRSAVA 421          

HSP 2 Score: 193.356 bits (490), Expect = 3.867e-46
Identity = 100/257 (38.91%), Postives = 148/257 (57.59%), Query Frame = 1
Query: 2206 IDQLNIVESKFSV---------DMPLHKFISTVNLAAKALCNCRRRVTRQINLLTNTNETYVWDVMMQHFQAHAIQVIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLKFPNLYTQMFLID 2949
            IDQ NI ++   V          M L  +I  + LAA+ L  C+        +        VW  MM+HF+AHA QVI+FA+AVPGF+EL    MK LVQEGMYPI ++QLS+DF  +  E+NYFNF+ +E+EIIL  F  F  +AD +  +G ++   NLD+T  +L+C ++L  G      + +KV  MYQ +++A++ Y       +    ++L +  +L+ M  EH+  V  L+  +P LKFP+LY QMF +D
Sbjct: 1383 IDQKNISDTVTDVIYSHLAARGAMSLDMYIERITLAARNLGRCKSWGFSSFEMAPILTTDIVWSHMMEHFEAHAHQVIQFARAVPGFRELPSVVMKKLVQEGMYPITVIQLSKDFQPSNMEYNYFNFTAQEREIILRHFPDFLPVADQLRVAGTVLHPFNLDETETALLCCIQLFHGGGERFGETSKVETMYQRTVSAIRTYEETRQMAEVRTQNILAVTSLLTDMNQEHRAIVKTLKRDRPSLKFPDLYVQMFELD 1639          
BLAST of Nuclear receptor 2DBD gamma vs. TrEMBL
Match: A0A0X3Q5B2 (Putative nuclear hormone receptor HR3 (Fragment) OS=Schistocephalus solidus OX=70667 GN=HR3 PE=4 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 4.774e-95
Identity = 146/186 (78.49%), Postives = 168/186 (90.32%), Query Frame = 1
Query: 1021 MKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMTLPGANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRA 1578
            MKEK  CD+CGDVSAGFHC+A+VCEACKKFFIRSSK ++Y KYSC+K N+CE+ KDTRTHCQ CR+QKCL +GM LPGA +    DIS+IPCRVCGAQSSGFHFGAITCEGCKGFFRRTI+ER+NQ+YTCRNGG C+I LATRNNCKSCRY+KCL++GMSK+GSRIGRQPNA+KHMCA EI +IRA
Sbjct:  360 MKEKTPCDICGDVSAGFHCNAYVCEACKKFFIRSSKNENYAKYSCSKVNSCEVNKDTRTHCQRCRYQKCLRIGMVLPGAAVCPANDISIIPCRVCGAQSSGFHFGAITCEGCKGFFRRTISERDNQRYTCRNGGACLITLATRNNCKSCRYRKCLSVGMSKDGSRIGRQPNAVKHMCAMEIERIRA 545          
BLAST of Nuclear receptor 2DBD gamma vs. TrEMBL
Match: A0A0V0J8N0 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR97737 PE=4 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 4.782e-95
Identity = 146/186 (78.49%), Postives = 168/186 (90.32%), Query Frame = 1
Query: 1021 MKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMTLPGANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRA 1578
            MKEK  CD+CGDVSAGFHC+A+VCEACKKFFIRSSK ++Y KYSC+K N+CE+ KDTRTHCQ CR+QKCL +GM LPGA +    DIS+IPCRVCGAQSSGFHFGAITCEGCKGFFRRTI+ER+NQ+YTCRNGG C+I LATRNNCKSCRY+KCL++GMSK+GSRIGRQPNA+KHMCA EI +IRA
Sbjct:  348 MKEKTPCDICGDVSAGFHCNAYVCEACKKFFIRSSKNENYAKYSCSKVNSCEVNKDTRTHCQRCRYQKCLRIGMVLPGAAVCPANDISIIPCRVCGAQSSGFHFGAITCEGCKGFFRRTISERDNQRYTCRNGGACLITLATRNNCKSCRYRKCLSVGMSKDGSRIGRQPNAVKHMCAMEIERIRA 533          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Cavefish
Match: rorc (nuclear receptor ROR-alpha-like [Source:NCBI gene;Acc:103035430])

HSP 1 Score: 108.612 bits (270), Expect = 3.961e-24
Identity = 45/84 (53.57%), Postives = 62/84 (73.81%), Query Frame = 1
Query: 1273 TDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
            T I +IPC++CG +SSG H+G ITCEGCKGFFRR+  +  + +Y+C    NC I+ A+RN C+SCR KKC+A GMS++  + GR
Sbjct:   31 TQIEVIPCKICGDKSSGVHYGVITCEGCKGFFRRS--QSSSVQYSCSRQSNCPIDRASRNRCQSCRLKKCVAQGMSRDAVKFGR 112          

HSP 2 Score: 72.0182 bits (175), Expect = 1.431e-12
Identity = 31/69 (44.93%), Postives = 42/69 (60.87%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS    S  +YSC++ +NC I + +R  CQ CR +KC+  GM+
Sbjct:   38 CKICGDKSSGVHYGVITCEGCKGFFRRSQ--SSSVQYSCSRQSNCPIDRASRNRCQSCRLKKCVAQGMS 104          

HSP 3 Score: 50.8322 bits (120), Expect = 6.727e-6
Identity = 52/192 (27.08%), Postives = 86/192 (44.79%), Query Frame = 1
Query: 2398 AIQ-VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYF---NFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVL-EIFPVLSKMTHEHQEAVMMLRTSKP---HLKFPNLYTQMFLID 2949
            A+Q V++FAK +PGF++L  ND   L++ G   ++LV++SR FN  T+    F    F+  E   +    A  + IA  V      I    L +   +L   + L+  +   + DR++V ++ +    AL L +      Q  +   L +    L  +   H E +   R   P   H  FP LY ++F  D
Sbjct:  315 AVQYVVEFAKRIPGFRQLGQNDQIALLKSGSMEVVLVRMSRMFN--TENSTVFFDGKFAGSE---LFKSLACGDFIAA-VFDFAHSICALRLTEQQVALFSALVLINADRPCLEDRDRVLRVRKDMELALSLILHR--DNQESLQHKLYQKITALKSLCALHIEKLRWFRQLYPLTVHSLFPPLYKELFGSD 498          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Cavefish
Match: rorca (nuclear receptor ROR-beta-like [Source:NCBI gene;Acc:103032914])

HSP 1 Score: 107.842 bits (268), Expect = 5.858e-24
Identity = 44/85 (51.76%), Postives = 61/85 (71.76%), Query Frame = 1
Query: 1270 NTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
             T I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+   RN C+ CR +KCLA+GMS++  + GR
Sbjct:   17 KTQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQNNAMYSCSRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGR 99          

HSP 2 Score: 77.0258 bits (188), Expect = 3.738e-14
Identity = 33/69 (47.83%), Postives = 43/69 (62.32%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC++  NC I +  R  CQ+CR QKCL LGM+
Sbjct:   25 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNAM--YSCSRQRNCLIDRTNRNRCQHCRLQKCLALGMS 91          

HSP 3 Score: 53.9138 bits (128), Expect = 6.450e-7
Identity = 44/207 (21.26%), Postives = 94/207 (45.41%), Query Frame = 1
Query: 2341 TNTNETYVWDVMMQHFQAH---AIQ-VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNY-FNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPH--LKFPNLYTQMF 2940
            T T +    +VM Q    H   AIQ V++FAK + GF +L  ND  +L++ G   ++L+++ R +N      N+   F  K     L +    + + + V +  + +    + +   +L     L+  +   + D  +V ++ +    AL+  +   G+++ ++  ++   P++  + + H + +   R   P     FP LY ++F
Sbjct:  284 TRTYQNKPSEVMWQQCAVHLTNAIQYVVEFAKRITGFMDLCQNDQIILLKAGCLDVLLIRMCRAYN----PLNHTLLFDGKFASPQLFKALGCDDLVNAVYELAKTMSRLQMTEEEMALFSAAVLLSPDRPWLSDSQRVQRLQEKVYLALQRCLNRGGTSEEKLTKMVAKLPIMKSICNLHIDKLEFFRLLHPETAYSFPPLYREVF 486          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Cavefish
Match: rorb (RAR related orphan receptor B [Source:NCBI gene;Acc:103038205])

HSP 1 Score: 107.071 bits (266), Expect = 8.116e-24
Identity = 43/85 (50.59%), Postives = 61/85 (71.76%), Query Frame = 1
Query: 1270 NTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
             + I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+   RN C+ CR +KCLA+GMS++  + GR
Sbjct:   17 QSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQNNASYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGR 99          

HSP 2 Score: 76.6406 bits (187), Expect = 4.786e-14
Identity = 33/69 (47.83%), Postives = 42/69 (60.87%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I +  R  CQ+CR QKCL LGM+
Sbjct:   25 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNA--SYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMS 91          

HSP 3 Score: 53.9138 bits (128), Expect = 8.010e-7
Identity = 43/186 (23.12%), Postives = 83/186 (44.62%), Query Frame = 1
Query: 2395 HAIQ-VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPH---LKFPNLYTQMF 2940
            HAIQ V++FAK + GF EL  ND  +L++ G   ++LV++ R FN      N   F  K   + + +    + +   V    + +    L +   +L     L+  +   + +  KV ++ +    AL+  M +    ++ +  ++   P L+ +   H E +   +   P    + FP LY ++F
Sbjct:  290 HAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLN---NTVLFEGKYGGMQMFKALGCDDLVSAVFDFAKSLCSLQLTEEEIALFSAAVLISTDRPWLMEPRKVQKLQEKIYFALQHIMQKNHMDEDALAKLIGRIPTLAALCTLHTEELQAFQQLHPETVNVLFPPLYKELF 472          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Cavefish
Match: rorcb (nuclear receptor ROR-beta-like [Source:NCBI gene;Acc:103024206])

HSP 1 Score: 107.071 bits (266), Expect = 9.632e-24
Identity = 43/82 (52.44%), Postives = 60/82 (73.17%), Query Frame = 1
Query: 1279 ISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
            I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+   RN C+ CR +KCLA+GMS++  + GR
Sbjct:    4 IEVIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQNNAMYSCSRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGR 83          

HSP 2 Score: 76.6406 bits (187), Expect = 5.595e-14
Identity = 33/69 (47.83%), Postives = 43/69 (62.32%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC++  NC I +  R  CQ+CR QKCL LGM+
Sbjct:    9 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNAM--YSCSRQRNCLIDRTNRNRCQHCRLQKCLALGMS 75          

HSP 3 Score: 53.1434 bits (126), Expect = 1.098e-6
Identity = 43/197 (21.83%), Postives = 89/197 (45.18%), Query Frame = 1
Query: 2359 YVWDVMMQHFQAHAIQ-VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPH--LKFPNLYTQMF 2940
            ++W     H   +AIQ V++FAK + GF +L  ND  +L++ G   ++L+++ R +N A    N   F  K     L +    + + + V +  + +    L +   +L     L+  +   + D  +V ++ +    AL+  +   G+   ++D ++   P +  + + H + +   R   P     FP LY ++F
Sbjct:  287 WMWQQCALHI-TNAIQYVVEFAKRISGFMDLCQNDQIILLKAGCLEVLLIRMCRAYNSAN---NTMFFDGKFASPQLFKALGCDDLVNAVFELAKNLCRLQLSEEEMALFSAAILLSPDRPWLTDSQQVQKLQEKVYVALQHSLHMSGANPEKLDKMVSKLPQMKSICNLHIDKLEFFRLVHPETAYSFPPLYREVF 479          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Cavefish
Match: rorb (RAR related orphan receptor B [Source:NCBI gene;Acc:103038205])

HSP 1 Score: 106.686 bits (265), Expect = 9.767e-24
Identity = 43/84 (51.19%), Postives = 60/84 (71.43%), Query Frame = 1
Query: 1273 TDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
              I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+   RN C+ CR +KCLA+GMS++  + GR
Sbjct:    7 AQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQNNASYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGR 88          

HSP 2 Score: 76.6406 bits (187), Expect = 4.618e-14
Identity = 33/69 (47.83%), Postives = 42/69 (60.87%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I +  R  CQ+CR QKCL LGM+
Sbjct:   14 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNA--SYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMS 80          

HSP 3 Score: 53.5286 bits (127), Expect = 8.649e-7
Identity = 43/186 (23.12%), Postives = 83/186 (44.62%), Query Frame = 1
Query: 2395 HAIQ-VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPH---LKFPNLYTQMF 2940
            HAIQ V++FAK + GF EL  ND  +L++ G   ++LV++ R FN      N   F  K   + + +    + +   V    + +    L +   +L     L+  +   + +  KV ++ +    AL+  M +    ++ +  ++   P L+ +   H E +   +   P    + FP LY ++F
Sbjct:  279 HAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLN---NTVLFEGKYGGMQMFKALGCDDLVSAVFDFAKSLCSLQLTEEEIALFSAAVLISTDRPWLMEPRKVQKLQEKIYFALQHIMQKNHMDEDALAKLIGRIPTLAALCTLHTEELQAFQQLHPETVNVLFPPLYKELF 461          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Sea Lamprey
Match: rorb (RAR-related orphan receptor B [Source:ZFIN;Acc:ZDB-GENE-061204-2])

HSP 1 Score: 106.686 bits (265), Expect = 2.580e-24
Identity = 45/90 (50.00%), Postives = 63/90 (70.00%), Query Frame = 1
Query: 1255 ANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
            A L  +  I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+   RN C+ CR +KCLA+GMS++  + GR
Sbjct:    8 AGLCVSAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQNNASYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGR 95          

HSP 2 Score: 74.7146 bits (182), Expect = 4.437e-14
Identity = 33/69 (47.83%), Postives = 42/69 (60.87%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I +  R  CQ+CR QKCL LGM+
Sbjct:   21 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNA--SYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMS 87          

HSP 3 Score: 48.1358 bits (113), Expect = 9.221e-6
Identity = 52/196 (26.53%), Postives = 86/196 (43.88%), Query Frame = 1
Query: 2398 AIQ-VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTR--------FAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKP---HLKFPNLYTQMFLID 2949
            AIQ V++FAK + GF +L  ND  +L++ G   ++L+++ R FN      N   F  K   I L +         A+F+     + KS   ++LK  D  +FS      LV  +   + D  KV ++ +    A +  + +     N ++ +L    VL ++   H E     R       H  FP LY ++F  D
Sbjct:  284 AIQYVVEFAKRIDGFMDLCQNDQIILLKAGCLEVVLIRMCRVFNPHN---NTVLFDGKYGGIQLFKSLGCDDLITAMFD-----LAKSLCAMQLKEEDIALFSA---SVLVSSDRQWLQDSIKVEKLAEKINLAFRHVVCKHRMNDNMLNKLLPKVGVLRQVCALHMEKFQEFREGHQEIVHSHFPPLYKELFSSD 468          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Sea Lamprey
Match: thrb (thyroid hormone receptor beta [Source:NCBI gene;Acc:30607])

HSP 1 Score: 98.9821 bits (245), Expect = 3.377e-22
Identity = 43/92 (46.74%), Postives = 64/92 (69.57%), Query Frame = 1
Query: 1231 HLGMTLPGANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKE 1506
            H G  +P + L++N      PC VCG +++G+H+  ITCEGCKGFFRRTI +  +  Y C+  G+C+I+  TRN C+ CRY+KC+A+GM+ +
Sbjct:   25 HKGAYMP-SYLDKNE-----PCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYACKYEGSCIIDRITRNQCQECRYQKCIAVGMASD 110          

HSP 2 Score: 69.3218 bits (168), Expect = 1.369e-12
Identity = 34/98 (34.69%), Postives = 51/98 (52.04%), Query Frame = 1
Query:  952 NCSVPTPLSADQLSNGYDYNYREMKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            +C  P    + +    Y  +Y +  E   C VCGD + G+H     CE CK FF R+ + + +  Y+C    +C I + TR  CQ CR+QKC+ +GM 
Sbjct:   13 SCDAPKRDGSKKHKGAYMPSYLDKNEP--CVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYACKYEGSCIIDRITRNQCQECRYQKCIAVGMA 108          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Sea Lamprey
Match: nr1d2a (nuclear receptor subfamily 1, group D, member 2a [Source:ZFIN;Acc:ZDB-GENE-040504-1])

HSP 1 Score: 94.7449 bits (234), Expect = 3.294e-20
Identity = 46/94 (48.94%), Postives = 60/94 (63.83%), Query Frame = 1
Query: 1285 LIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYT-CRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEI 1563
            ++ C+VCG  +SGFH+G   CEGCKGFFRR+I   +N KY  C     C I  A RN C+ CR+KKCL++GMSK+  R GR P   K    +E+
Sbjct:  119 VLLCKVCGDAASGFHYGVHACEGCKGFFRRSIQ--QNIKYKPCLKNETCPIVRANRNRCQHCRFKKCLSVGMSKDAVRFGRIPKREKLRLMEEV 210          

HSP 2 Score: 77.0258 bits (188), Expect = 1.105e-14
Identity = 35/70 (50.00%), Postives = 44/70 (62.86%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYS-CTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C VCGD ++GFH     CE CK FF RS + +   KY  C KN  C IV+  R  CQ+CRF+KCL +GM+
Sbjct:  122 CKVCGDAASGFHYGVHACEGCKGFFRRSIQQN--IKYKPCLKNETCPIVRANRNRCQHCRFKKCLSVGMS 189          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006803.1 (pep scaffold:Pmarinus_7.0:GL479639:153667:156574:-1 gene:ENSPMAG00000006138.1 transcript:ENSPMAT00000006803.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 4.293e-20
Identity = 39/71 (54.93%), Postives = 52/71 (73.24%), Query Frame = 1
Query: 1294 CRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKE 1506
            C VCG ++SG H+GA++CEGCKGFF+R++  R+N KYTCR   +CVIN   RN C+ CR +KC  +GM  E
Sbjct:  127 CVVCGDRASGRHYGAVSCEGCKGFFKRSV--RKNLKYTCRGSQDCVINKHHRNRCQYCRLQKCFNVGMKTE 195          

HSP 2 Score: 69.707 bits (169), Expect = 1.064e-13
Identity = 33/68 (48.53%), Postives = 42/68 (61.76%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGM 1242
            C VCGD ++G H  A  CE CK FF RS + +   KY+C  + +C I K  R  CQYCR QKC ++GM
Sbjct:  127 CVVCGDRASGRHYGAVSCEGCKGFFKRSVRKN--LKYTCRGSQDCVINKHHRNRCQYCRLQKCFNVGM 192          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Sea Lamprey
Match: thrb (thyroid hormone receptor beta [Source:NCBI gene;Acc:30607])

HSP 1 Score: 92.0485 bits (227), Expect = 5.934e-20
Identity = 36/69 (52.17%), Postives = 49/69 (71.01%), Query Frame = 1
Query: 1291 PCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGM 1497
            PC VCG +++G+H+  ITCEGCKGFFRRTI +  +  Y C+    C ++   RN C+ CR+KKCLA+GM
Sbjct:   11 PCAVCGDKATGYHYHCITCEGCKGFFRRTIQKSLHVMYVCKFSETCTVDRINRNQCQECRFKKCLAVGM 79          

HSP 2 Score: 68.1662 bits (165), Expect = 3.943e-12
Identity = 29/75 (38.67%), Postives = 41/75 (54.67%), Query Frame = 1
Query: 1021 MKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            + E + C VCGD + G+H     CE CK FF R+ +   +  Y C  +  C + +  R  CQ CRF+KCL +GM 
Sbjct:    6 LLEGQPCAVCGDKATGYHYHCITCEGCKGFFRRTIQKSLHVMYVCKFSETCTVDRINRNQCQECRFKKCLAVGMV 80          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Nematostella
Match: EDO38995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBF2])

HSP 1 Score: 95.5153 bits (236), Expect = 6.239e-21
Identity = 40/89 (44.94%), Postives = 56/89 (62.92%), Query Frame = 1
Query: 1294 CRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKE 1560
            C+VCG   +G H+G + CEGCKGFF+RT+  R+N  YTCR   +C I+   RN C+ CR+ KCL  GM KE  +  R+P A   +  ++
Sbjct:   13 CKVCGDNGTGKHYGVVACEGCKGFFKRTV--RKNLIYTCRGSNDCFIDKVHRNRCQKCRFVKCLTAGMKKEAVQCERKPLAASQLVRQQ 99          

HSP 2 Score: 62.003 bits (149), Expect = 5.202e-10
Identity = 31/68 (45.59%), Postives = 37/68 (54.41%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGM 1242
            C VCGD   G H     CE CK FF R+ + +    Y+C  +N+C I K  R  CQ CRF KCL  GM
Sbjct:   13 CKVCGDNGTGKHYGVVACEGCKGFFKRTVRKNLI--YTCRGSNDCFIDKVHRNRCQKCRFVKCLTAGM 78          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Nematostella
Match: EDO42936 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S012])

HSP 1 Score: 93.9745 bits (232), Expect = 2.092e-20
Identity = 40/97 (41.24%), Postives = 63/97 (64.95%), Query Frame = 1
Query: 1285 LIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIR 1575
            ++ CRVCG ++SG H+G +TC+GC+GFF+R++  R N  Y C+   +C I++A RN C++CR +KC  M M++         +A++H  A   SQIR
Sbjct:    1 MVQCRVCGDRASGKHYGVMTCDGCRGFFKRSV--RRNLAYQCKEKNDCPIDVARRNQCQACRLRKCFEMNMNR---------DAVQHERAPRTSQIR 86          

HSP 2 Score: 60.077 bits (144), Expect = 1.948e-9
Identity = 26/69 (37.68%), Postives = 37/69 (53.62%), Query Frame = 1
Query: 1036 KCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGM 1242
            +C VCGD ++G H     C+ C+ FF RS + +    Y C + N+C I    R  CQ CR +KC  + M
Sbjct:    3 QCRVCGDRASGKHYGVMTCDGCRGFFKRSVRRN--LAYQCKEKNDCPIDVARRNQCQACRLRKCFEMNM 69          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Nematostella
Match: EDO37645 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF49])

HSP 1 Score: 92.8189 bits (229), Expect = 3.977e-20
Identity = 42/83 (50.60%), Postives = 54/83 (65.06%), Query Frame = 1
Query: 1288 IPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNA 1536
            + C VCG +SSG H+G  TCEGCK FF+R++  R N  YTCR   +C I+   RN C+ CR KKCL +GM +E  + GR P A
Sbjct:   26 VECAVCGDKSSGKHYGVFTCEGCKSFFKRSV--RRNLTYTCRASRDCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRIPAA 106          

HSP 2 Score: 71.633 bits (174), Expect = 4.491e-13
Identity = 32/69 (46.38%), Postives = 42/69 (60.87%), Query Frame = 1
Query: 1036 KCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGM 1242
            +C VCGD S+G H   F CE CK FF RS + +    Y+C  + +C I +  R  CQYCR +KCL +GM
Sbjct:   27 ECAVCGDKSSGKHYGVFTCEGCKSFFKRSVRRN--LTYTCRASRDCPIDQHHRNQCQYCRLKKCLKVGM 93          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Nematostella
Match: EDO42277 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1X4])

HSP 1 Score: 93.2041 bits (230), Expect = 4.265e-20
Identity = 43/95 (45.26%), Postives = 59/95 (62.11%), Query Frame = 1
Query: 1288 IPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQI 1572
            I C VCG +SSG H+G  TCEGCK FF+R+I  R +  Y+CR   NC +++  RN C+ CR KKCL +GM KE  + GR P+    +    +S +
Sbjct:   30 IDCAVCGDKSSGKHYGVYTCEGCKSFFKRSI--RRSLSYSCRGVRNCPVDIQNRNQCQYCRLKKCLKVGMRKEAVQKGRIPSTHPDVGPLSVSMV 122          

HSP 2 Score: 69.3218 bits (168), Expect = 2.460e-12
Identity = 32/68 (47.06%), Postives = 38/68 (55.88%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGM 1242
            C VCGD S+G H   + CE CK FF RS +      YSC    NC +    R  CQYCR +KCL +GM
Sbjct:   32 CAVCGDKSSGKHYGVYTCEGCKSFFKRSIRRS--LSYSCRGVRNCPVDIQNRNQCQYCRLKKCLKVGM 97          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Nematostella
Match: EDO32715 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUB6])

HSP 1 Score: 90.5077 bits (223), Expect = 1.714e-19
Identity = 38/84 (45.24%), Postives = 57/84 (67.86%), Query Frame = 1
Query: 1297 RVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHM 1548
            RVCG +SSG H+G  TC+GC+GFF+R+I  R N  Y C+  G CV+++A RN C++CR KKC  + M+K+  +  R P + + +
Sbjct:    2 RVCGDRSSGKHYGVFTCDGCRGFFKRSI--RRNLTYHCKELGKCVVDVARRNQCQACRLKKCFEVQMNKDAVQHERAPRSAQIL 83          

HSP 2 Score: 53.9138 bits (128), Expect = 1.421e-7
Identity = 25/66 (37.88%), Postives = 34/66 (51.52%), Query Frame = 1
Query: 1045 VCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGM 1242
            VCGD S+G H   F C+ C+ FF RS + +    Y C +   C +    R  CQ CR +KC  + M
Sbjct:    3 VCGDRSSGKHYGVFTCDGCRGFFKRSIRRN--LTYHCKELGKCVVDVARRNQCQACRLKKCFEVQM 66          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Medaka
Match: roraa (RAR related orphan receptor A [Source:NCBI gene;Acc:101167704])

HSP 1 Score: 112.079 bits (279), Expect = 2.281e-25
Identity = 47/105 (44.76%), Postives = 68/105 (64.76%), Query Frame = 1
Query: 1210 CRFQKCLHLGMTLPGANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
            C     LH+   +  A     + I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+  +RN C+ CR +KCLA+GMS++  + GR
Sbjct:   12 CSLLHVLHMKRRISVAKKTHTSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQSNAAYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGR 114          

HSP 2 Score: 73.559 bits (179), Expect = 5.095e-13
Identity = 32/69 (46.38%), Postives = 43/69 (62.32%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I + +R  CQ+CR QKCL +GM+
Sbjct:   40 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNA--AYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMS 106          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Medaka
Match: roraa (RAR related orphan receptor A [Source:NCBI gene;Acc:101167704])

HSP 1 Score: 108.997 bits (271), Expect = 3.226e-24
Identity = 48/109 (44.04%), Postives = 68/109 (62.39%), Query Frame = 1
Query: 1198 HCQYCRFQKCLHLGMTLPGANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
            H    R Q C      +  A     + I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+  +RN C+ CR +KCLA+GMS++  + GR
Sbjct:   37 HPAPVRRQTCSSTNRGISVAKKTHTSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQSNAAYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGR 143          

HSP 2 Score: 74.7146 bits (182), Expect = 2.563e-13
Identity = 32/69 (46.38%), Postives = 43/69 (62.32%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I + +R  CQ+CR QKCL +GM+
Sbjct:   69 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNA--AYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMS 135          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Medaka
Match: roraa (RAR related orphan receptor A [Source:NCBI gene;Acc:101167704])

HSP 1 Score: 108.227 bits (269), Expect = 3.269e-24
Identity = 45/95 (47.37%), Postives = 65/95 (68.42%), Query Frame = 1
Query: 1240 MTLPGANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGR 1524
            M +  A     + I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+  +RN C+ CR +KCLA+GMS++  + GR
Sbjct:    1 MGISVAKKTHTSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQSNAAYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGR 93          

HSP 2 Score: 73.9442 bits (180), Expect = 3.869e-13
Identity = 32/69 (46.38%), Postives = 43/69 (62.32%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I + +R  CQ+CR QKCL +GM+
Sbjct:   19 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNA--AYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMS 85          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Medaka
Match: rorb (RAR related orphan receptor B [Source:NCBI gene;Acc:101155775])

HSP 1 Score: 108.227 bits (269), Expect = 4.128e-24
Identity = 47/109 (43.12%), Postives = 69/109 (63.30%), Query Frame = 1
Query: 1258 NLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGL 1584
            N +    I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+   RN C+ CR +KCLA+GMS++  + GR     +     E+ + +A L
Sbjct:    4 NYHNTPQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQNNASYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQARL 110          

HSP 2 Score: 77.0258 bits (188), Expect = 3.444e-14
Identity = 33/69 (47.83%), Postives = 42/69 (60.87%), Query Frame = 1
Query: 1039 CDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I +  R  CQ+CR QKCL LGM+
Sbjct:   16 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNA--SYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMS 82          

HSP 3 Score: 55.0694 bits (131), Expect = 2.712e-7
Identity = 44/186 (23.66%), Postives = 83/186 (44.62%), Query Frame = 1
Query: 2395 HAIQ-VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPH---LKFPNLYTQMF 2940
            HAIQ V++FAK + GF EL  ND  +L++ G   ++LV++ R FN      N   F  K   + + +    + +   V    + +    L +   +L     L+  +   + +  KV ++ +    AL+  M +    ++ +  ++   P LS +   H E +   +   P    + FP LY ++F
Sbjct:  284 HAIQYVVEFAKRISGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLN---NTVLFEGKYGGMQMFKSLGCDDLVSAVFDFAKSLCSLQLTEEEIALFSAAVLISTDRPWLMEPRKVQKLQEKIYFALQHIMQKNHMDEDALAKLISRIPTLSALCTLHTEELQAFQQLHPETVNVLFPPLYKELF 466          
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Medaka
Match: rorb (RAR related orphan receptor B [Source:NCBI gene;Acc:101155775])

HSP 1 Score: 107.457 bits (267), Expect = 6.949e-24
Identity = 46/104 (44.23%), Postives = 67/104 (64.42%), Query Frame = 1
Query: 1273 TDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGL 1584
              I +IPC++CG +SSG H+G ITCEGCKGFFRR+  ++ N  Y+C    NC+I+   RN C+ CR +KCLA+GMS++  + GR     +     E+ + +A L
Sbjct:    3 AQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRS--QQNNASYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQARL 104          

HSP 2 Score: 77.411 bits (189), Expect = 2.971e-14
Identity = 35/77 (45.45%), Postives = 44/77 (57.14%), Query Frame = 1
Query: 1015 REMKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMT 1245
            R   E   C +CGD S+G H     CE CK FF RS + ++   YSC +  NC I +  R  CQ+CR QKCL LGM+
Sbjct:    2 RAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNA--SYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMS 76          

HSP 3 Score: 55.4546 bits (132), Expect = 2.592e-7
Identity = 44/186 (23.66%), Postives = 83/186 (44.62%), Query Frame = 1
Query: 2395 HAIQ-VIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPH---LKFPNLYTQMF 2940
            HAIQ V++FAK + GF EL  ND  +L++ G   ++LV++ R FN      N   F  K   + + +    + +   V    + +    L +   +L     L+  +   + +  KV ++ +    AL+  M +    ++ +  ++   P LS +   H E +   +   P    + FP LY ++F
Sbjct:  278 HAIQYVVEFAKRISGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLN---NTVLFEGKYGGMQMFKSLGCDDLVSAVFDFAKSLCSLQLTEEEIALFSAAVLISTDRPWLMEPRKVQKLQEKIYFALQHIMQKNHMDEDALAKLISRIPTLSALCTLHTEELQAFQQLHPETVNVLFPPLYKELF 460          
BLAST of Nuclear receptor 2DBD gamma vs. Planmine SMEST
Match: SMESG000020242.1 (SMESG000020242.1)

HSP 1 Score: 1851.25 bits (4794), Expect = 0.000e+0
Identity = 891/915 (97.38%), Postives = 892/915 (97.49%), Query Frame = 1
Query:  205 MQGYTNLANIAVINPLSTMDTTKNSHPLYNGYPNPKKARLIQHVVFSKTAAANGSELPGIDIDASNIGSMNNSSVPNKIQSHTPSEHNPYSTLMANNATTCFYSPGFLEPYVINTENLTQSAAQSFDLTRIPVSNKTYCSFPNPSSALSSIFLTGGGIEWSGAPLSTSNPFQCISSSTTDNMKLNNINYQGSYGDCNDITNSLLNNLKSRDVFQAQQEYNNRYSDNAPSYLKYDQSPVGWYKLKEETRPNCSVPTPLSADQLSNGYDYNYREMKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMTLPGANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLALNHFSNNNSHSIGHTDSGMIQAYLPNHLSSAIMSTMNLDFNLTNGQTRYQQTTAPLPTSEFYLNSNSSKYPLYNLQTQQENENICDIKTIIEEHSNGAYLERSQNKLMLQQYEDKIPSNVNNSKAEPTYYETTFNYNDKDIINRNDHAIEINSCSGSLTISDEKTDFRSSFTESNSREKSEDHCSDSGFMKEVDRNFNLEVPFLSSIDQLNIVESKFSVDMPLHKFISTVNLAAKALCNCRRRVTRQINLLTNTNETYVWDVMMQHFQAHAIQVIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLKFPNLYTQMFLID 2949
            MQGYTNLANIAVINPLSTMDTTKNSHPLYNGYPNPKKARLIQHVVFSKTAAANGSELPGIDIDASNIGSMNNSSVPNKIQSHTPSEHNPYSTLMANNATTCFYSPGFLEPYVINTENLTQSAAQSFDLTRIPVSNKTYCSFPNPSSALSSIFLTGGGIEWSGAPLSTSNPFQCISSSTTDNMKLNNINYQGSYGDCNDITNSLLNNLKSRDVFQAQQEYNNRYSDNAPSYLKYDQSPVGWYKLKEETRPNCSVPTPLSADQLSNGYDYNYREMKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMTLPGANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLALNHFSNNNSHSIGHTDSGMIQAYLPNHLSSAIMSTMNLDFNLTNGQTRYQQTTAPLPTSEFYLNSNSSKYPLYNLQTQQENENICDIKTIIEEHSNGAYLER+QNKLMLQQYEDKIPSNVNNSKAEPTYYETTFNYNDKDIINRNDHAIEINSCSGSLTISDEKTDFRSSFTESNSREKSEDHCSDSGFMKEVDRNFNLEVPFLSSIDQLNI                       ALCNCRRRVTRQINLLTNTNETYVWDVMMQHFQAHAIQVIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLKFPNLYTQMFLID
Sbjct:    1 MQGYTNLANIAVINPLSTMDTTKNSHPLYNGYPNPKKARLIQHVVFSKTAAANGSELPGIDIDASNIGSMNNSSVPNKIQSHTPSEHNPYSTLMANNATTCFYSPGFLEPYVINTENLTQSAAQSFDLTRIPVSNKTYCSFPNPSSALSSIFLTGGGIEWSGAPLSTSNPFQCISSSTTDNMKLNNINYQGSYGDCNDITNSLLNNLKSRDVFQAQQEYNNRYSDNAPSYLKYDQSPVGWYKLKEETRPNCSVPTPLSADQLSNGYDYNYREMKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMTLPGANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLALNHFSNNNSHSIGHTDSGMIQAYLPNHLSSAIMSTMNLDFNLTNGQTRYQQTTAPLPTSEFYLNSNSSKYPLYNLQTQQENENICDIKTIIEEHSNGAYLERTQNKLMLQQYEDKIPSNVNNSKAEPTYYETTFNYNDKDIINRNDHAIEINSCSGSLTISDEKTDFRSSFTESNSREKSEDHCSDSGFMKEVDRNFNLEVPFLSSIDQLNI-----------------------ALCNCRRRVTRQINLLTNTNETYVWDVMMQHFQAHAIQVIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLKFPNLYTQMFLID 892          
BLAST of Nuclear receptor 2DBD gamma vs. Planmine SMEST
Match: SMESG000020242.1 (SMESG000020242.1)

HSP 1 Score: 1829.3 bits (4737), Expect = 0.000e+0
Identity = 879/897 (97.99%), Postives = 880/897 (98.10%), Query Frame = 1
Query:  259 MDTTKNSHPLYNGYPNPKKARLIQHVVFSKTAAANGSELPGIDIDASNIGSMNNSSVPNKIQSHTPSEHNPYSTLMANNATTCFYSPGFLEPYVINTENLTQSAAQSFDLTRIPVSNKTYCSFPNPSSALSSIFLTGGGIEWSGAPLSTSNPFQCISSSTTDNMKLNNINYQGSYGDCNDITNSLLNNLKSRDVFQAQQEYNNRYSDNAPSYLKYDQSPVGWYKLKEETRPNCSVPTPLSADQLSNGYDYNYREMKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMTLPGANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLALNHFSNNNSHSIGHTDSGMIQAYLPNHLSSAIMSTMNLDFNLTNGQTRYQQTTAPLPTSEFYLNSNSSKYPLYNLQTQQENENICDIKTIIEEHSNGAYLERSQNKLMLQQYEDKIPSNVNNSKAEPTYYETTFNYNDKDIINRNDHAIEINSCSGSLTISDEKTDFRSSFTESNSREKSEDHCSDSGFMKEVDRNFNLEVPFLSSIDQLNIVESKFSVDMPLHKFISTVNLAAKALCNCRRRVTRQINLLTNTNETYVWDVMMQHFQAHAIQVIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLKFPNLYTQMFLID 2949
            MDTTKNSHPLYNGYPNPKKARLIQHVVFSKTAAANGSELPGIDIDASNIGSMNNSSVPNKIQSHTPSEHNPYSTLMANNATTCFYSPGFLEPYVINTENLTQSAAQSFDLTRIPVSNKTYCSFPNPSSALSSIFLTGGGIEWSGAPLSTSNPFQCISSSTTDNMKLNNINYQGSYGDCNDITNSLLNNLKSRDVFQAQQEYNNRYSDNAPSYLKYDQSPVGWYKLKEETRPNCSVPTPLSADQLSNGYDYNYREMKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMTLPGANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLALNHFSNNNSHSIGHTDSGMIQAYLPNHLSSAIMSTMNLDFNLTNGQTRYQQTTAPLPTSEFYLNSNSSKYPLYNLQTQQENENICDIKTIIEEHSNGAYLER+QNKLMLQQYEDKIPSNVNNSKAEPTYYETTFNYNDKDIINRNDHAIEINSCSGSLTISDEKTDFRSSFTESNSREKSEDHCSDSGFMKEVDRNFNLEVPFLSSIDQLNIVESKFS                 ALCNCRRRVTRQINLLTNTNETYVWDVMMQHFQAHAIQVIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLKFPNLYTQMFLID
Sbjct:    1 MDTTKNSHPLYNGYPNPKKARLIQHVVFSKTAAANGSELPGIDIDASNIGSMNNSSVPNKIQSHTPSEHNPYSTLMANNATTCFYSPGFLEPYVINTENLTQSAAQSFDLTRIPVSNKTYCSFPNPSSALSSIFLTGGGIEWSGAPLSTSNPFQCISSSTTDNMKLNNINYQGSYGDCNDITNSLLNNLKSRDVFQAQQEYNNRYSDNAPSYLKYDQSPVGWYKLKEETRPNCSVPTPLSADQLSNGYDYNYREMKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMTLPGANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLALNHFSNNNSHSIGHTDSGMIQAYLPNHLSSAIMSTMNLDFNLTNGQTRYQQTTAPLPTSEFYLNSNSSKYPLYNLQTQQENENICDIKTIIEEHSNGAYLERTQNKLMLQQYEDKIPSNVNNSKAEPTYYETTFNYNDKDIINRNDHAIEINSCSGSLTISDEKTDFRSSFTESNSREKSEDHCSDSGFMKEVDRNFNLEVPFLSSIDQLNIVESKFS-----------------ALCNCRRRVTRQINLLTNTNETYVWDVMMQHFQAHAIQVIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLKFPNLYTQMFLID 880          
BLAST of Nuclear receptor 2DBD gamma vs. Planmine SMEST
Match: SMESG000020242.1 (SMESG000020242.1)

HSP 1 Score: 1815.82 bits (4702), Expect = 0.000e+0
Identity = 873/897 (97.32%), Postives = 874/897 (97.44%), Query Frame = 1
Query:  259 MDTTKNSHPLYNGYPNPKKARLIQHVVFSKTAAANGSELPGIDIDASNIGSMNNSSVPNKIQSHTPSEHNPYSTLMANNATTCFYSPGFLEPYVINTENLTQSAAQSFDLTRIPVSNKTYCSFPNPSSALSSIFLTGGGIEWSGAPLSTSNPFQCISSSTTDNMKLNNINYQGSYGDCNDITNSLLNNLKSRDVFQAQQEYNNRYSDNAPSYLKYDQSPVGWYKLKEETRPNCSVPTPLSADQLSNGYDYNYREMKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMTLPGANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLALNHFSNNNSHSIGHTDSGMIQAYLPNHLSSAIMSTMNLDFNLTNGQTRYQQTTAPLPTSEFYLNSNSSKYPLYNLQTQQENENICDIKTIIEEHSNGAYLERSQNKLMLQQYEDKIPSNVNNSKAEPTYYETTFNYNDKDIINRNDHAIEINSCSGSLTISDEKTDFRSSFTESNSREKSEDHCSDSGFMKEVDRNFNLEVPFLSSIDQLNIVESKFSVDMPLHKFISTVNLAAKALCNCRRRVTRQINLLTNTNETYVWDVMMQHFQAHAIQVIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLKFPNLYTQMFLID 2949
            MDTTKNSHPLYNGYPNPKKARLIQHVVFSKTAAANGSELPGIDIDASNIGSMNNSSVPNKIQSHTPSEHNPYSTLMANNATTCFYSPGFLEPYVINTENLTQSAAQSFDLTRIPVSNKTYCSFPNPSSALSSIFLTGGGIEWSGAPLSTSNPFQCISSSTTDNMKLNNINYQGSYGDCNDITNSLLNNLKSRDVFQAQQEYNNRYSDNAPSYLKYDQSPVGWYKLKEETRPNCSVPTPLSADQLSNGYDYNYREMKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMTLPGANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLALNHFSNNNSHSIGHTDSGMIQAYLPNHLSSAIMSTMNLDFNLTNGQTRYQQTTAPLPTSEFYLNSNSSKYPLYNLQTQQENENICDIKTIIEEHSNGAYLER+QNKLMLQQYEDKIPSNVNNSKAEPTYYETTFNYNDKDIINRNDHAIEINSCSGSLTISDEKTDFRSSFTESNSREKSEDHCSDSGFMKEVDRNFNLEVPFLSSIDQLNI                       ALCNCRRRVTRQINLLTNTNETYVWDVMMQHFQAHAIQVIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLKFPNLYTQMFLID
Sbjct:    1 MDTTKNSHPLYNGYPNPKKARLIQHVVFSKTAAANGSELPGIDIDASNIGSMNNSSVPNKIQSHTPSEHNPYSTLMANNATTCFYSPGFLEPYVINTENLTQSAAQSFDLTRIPVSNKTYCSFPNPSSALSSIFLTGGGIEWSGAPLSTSNPFQCISSSTTDNMKLNNINYQGSYGDCNDITNSLLNNLKSRDVFQAQQEYNNRYSDNAPSYLKYDQSPVGWYKLKEETRPNCSVPTPLSADQLSNGYDYNYREMKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMTLPGANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLALNHFSNNNSHSIGHTDSGMIQAYLPNHLSSAIMSTMNLDFNLTNGQTRYQQTTAPLPTSEFYLNSNSSKYPLYNLQTQQENENICDIKTIIEEHSNGAYLERTQNKLMLQQYEDKIPSNVNNSKAEPTYYETTFNYNDKDIINRNDHAIEINSCSGSLTISDEKTDFRSSFTESNSREKSEDHCSDSGFMKEVDRNFNLEVPFLSSIDQLNI-----------------------ALCNCRRRVTRQINLLTNTNETYVWDVMMQHFQAHAIQVIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKPHLKFPNLYTQMFLID 874          
BLAST of Nuclear receptor 2DBD gamma vs. Planmine SMEST
Match: SMESG000008787.1 (SMESG000008787.1)

HSP 1 Score: 210.69 bits (535), Expect = 4.280e-57
Identity = 101/191 (52.88%), Postives = 125/191 (65.45%), Query Frame = 1
Query: 1006 YNYREMKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMTLPGAN-LNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGGN--CVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQ 1569
            Y+Y++  E + C VC + +AGFH  A+VCEACKKFF+R +   +     C     C  +K  R  CQ CRF+KC+ +GM L   N  N   DIS IPCRVCG +SSGFHFGA+TCEGCKGFFRRT  E   Q   C  G N  C+   ++RN CKSCR+ +CL +GMSK+GSRIGRQPNA+K  C  EI Q
Sbjct:  161 YDYQQKMESQLCQVCRESAAGFHHGAYVCEACKKFFMRHNLNSTKFTIPCPTGGQCAQLKTGRIKCQSCRFKKCVSIGMALQNPNNGNSKFDISKIPCRVCGGKSSGFHFGALTCEGCKGFFRRT--ESTKQHLACITGNNDCCLTGSSSRNLCKSCRFNRCLGVGMSKKGSRIGRQPNAVKFHCVLEIMQ 349          

HSP 2 Score: 118.627 bits (296), Expect = 4.750e-27
Identity = 66/216 (30.56%), Postives = 112/216 (51.85%), Query Frame = 1
Query: 2362 VWDVMMQHFQAHAIQVIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMYQYSMNALKLYM-------TEIGSTQNEID-------------SVLEIFP-VLSKMTHEHQEAVMMLRTSKPHLKFPNLYTQMFLI 2946
            +W+ MM +F  H+  +++F KA+PGF +      + LVQ+ MYPI+L++L++D+    DE+NYF+FS  ++E+IL  F  F +I DH++   R++    L     SL+C  EL+K     + D  +  ++   + + L L++         IG+   + +              + E  P +LS+M  EH + +  L+   P L FP LY  MF I
Sbjct:  456 LWNYMMNNFDVHSAMIVQFVKAIPGFNKFELKSRRSLVQDAMYPIMLLKLAQDYKPDVDEYNYFDFSLIDREVILNNFQSFKRITDHLLSISRMVHSLQLSSYPISLLCVTELMKNYHL-LSDEEEGKRILNQAKSLLWLFLENNEVEDNTIGNLTKQTEMLNLPPKNYQKYIKIFEEMPKLLSEMNSEHLKIIQELKYLHPELLFPELYIDMFNI 670          
BLAST of Nuclear receptor 2DBD gamma vs. Planmine SMEST
Match: SMESG000007787.1 (SMESG000007787.1)

HSP 1 Score: 206.838 bits (525), Expect = 8.591e-57
Identity = 118/245 (48.16%), Postives = 148/245 (60.41%), Query Frame = 1
Query:  889 SYLKYDQSPVGWYKLKEETRPN-CSVPTPLSADQLSNGYDYNYREMKEKRKCDVCGDVSAGFHCSAFVCEACKKFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMTLPGANLNQ-NTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKYTCRNGG-NCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCAKEISQIRAGLALNHFSNNNS 1614
            S+ K D++ V    LK  T  N  +  +P SA        Y Y+   E + C VC  ++AGFH  A+VCEACKKFF R S     +K  C KN  C++ K  R  C +CR+QKCL++GM   G   N+ N DIS IPCRVCG +SSGFHFG++TCEGCKGFFRR   E    K  C +G  NCVI+ + +  CK CRY +C+ +GMSK GSRIGRQPNA+KH CA EI          H+ N NS
Sbjct:    2 SFQKLDKNKVQSVILKTNTMLNNATFSSPESAF-------YEYQIKMENQLCQVCNCLAAGFHHGAYVCEACKKFFKRYSTNQLNSKVVCKKN--CDLEKIGRRKCSFCRYQKCLNVGMKFFGLRSNKSNIDISQIPCRVCGGKSSGFHFGSLTCEGCKGFFRRA--EPLKDKLECVSGKLNCVIDSSHKMPCKWCRYHRCIKVGMSKIGSRIGRQPNAVKHHCALEII---------HYQNRNS 226          

HSP 2 Score: 106.686 bits (265), Expect = 1.611e-23
Identity = 82/275 (29.82%), Postives = 124/275 (45.09%), Query Frame = 1
Query: 2260 KFISTVNLAAKALCNCRR--RVTRQINLLTNTNETYVWDVMMQHFQAHAIQVIKFAKAVPGFKELFHNDMKVLVQEGMYPIILVQLSRDFNLATDE-FNYFNFSNKEKEIILTRFAIFNKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKG-------ESCSVFDRNKVNQMYQYSMNAL--KLYMTEIGS-------------------------------TQNEIDSVLE-IFPVLSKMTH----EHQEAVMMLRTSKPHLKFPNLYTQMF 2940
            K I  + +  K L    +   +TR   +  N +   VW+ MM+HF  H   ++ FAK VPGF +L  +D + +VQ+ MY I+L+ L+R +    DE FNYF+FS  E E+IL  F    KI  HVM+  R+I   N+      L+C +EL K        ++     +  V   +   +  L  +  +TE G+                               T+N+    L  IF VL +       EHQ  +  L+ +KP L +P LYT+MF
Sbjct:  285 KLIEAIKILQKPLLEAEKLFHMTR-FPVHRNQSLLEVWNSMMRHFDVHTCILVYFAKKVPGFNDLSLSDKRTMVQDAMYSIMLLNLARSYEEDKDEFFNYFDFSKDEYEVILFHFPEMKKILAHVMEISRIIYKLNITKDQIGLLCIIELSKNYINLESFDAVRTIHKEVVRLFWISILKELDNEALLTEPGNPPSLPQMSVLLQVLNCPDDLISQIVFKIPKCTENKWCQKLHIIFKVLGEKLQEFNIEHQMIIDELKRNKPELPYPELYTEMF 558          
The following BLAST results are available for this feature:
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RORA7.398e-2552.44RAR related orphan receptor A [Source:HGNC Symbol;... [more]
RORA1.920e-2351.76RAR related orphan receptor A [Source:HGNC Symbol;... [more]
RORB2.395e-2352.44RAR related orphan receptor B [Source:HGNC Symbol;... [more]
RORB2.485e-2352.44RAR related orphan receptor B [Source:HGNC Symbol;... [more]
RORA2.573e-2352.44RAR related orphan receptor A [Source:HGNC Symbol;... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nhr-231.061e-2243.81Nuclear hormone receptor family member nhr-23 [So... [more]
nhr-231.876e-2248.86Nuclear hormone receptor family member nhr-23 [So... [more]
nhr-232.534e-2244.34Nuclear hormone receptor family member nhr-23 [So... [more]
nhr-234.571e-2244.12Nuclear hormone receptor family member nhr-23 [So... [more]
nhr-235.925e-2242.86Nuclear hormone receptor family member nhr-23 [So... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hr34.665e-2344.23gene:FBgn0000448 transcript:FBtr0112799[more]
Hr36.261e-2344.23gene:FBgn0000448 transcript:FBtr0088368[more]
Hr36.261e-2344.23gene:FBgn0000448 transcript:FBtr0306345[more]
Hr38.074e-2344.23gene:FBgn0000448 transcript:FBtr0330609[more]
eg1.735e-2254.65gene:FBgn0000560 transcript:FBtr0078437[more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rorca5.337e-2738.85RAR-related orphan receptor C a [Source:ZFIN;Acc:Z... [more]
rorca2.392e-2639.22RAR-related orphan receptor C a [Source:ZFIN;Acc:Z... [more]
rorc2.726e-2438.81RAR-related orphan receptor C [Source:ZFIN;Acc:ZDB... [more]
rorc6.913e-2451.76RAR-related orphan receptor C [Source:ZFIN;Acc:ZDB... [more]
rorcb8.512e-2452.44RAR-related orphan receptor C b [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnk46.074e-2442.59potassium channel, two pore domain subfamily K, me... [more]
kcnk46.279e-2442.59potassium channel, two pore domain subfamily K, me... [more]
kcnk46.394e-2442.59potassium channel, two pore domain subfamily K, me... [more]
kcnk46.713e-2442.59potassium channel, two pore domain subfamily K, me... [more]
kcnk48.296e-2441.82potassium channel, two pore domain subfamily K, me... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rorb5.552e-2447.83RAR-related orphan receptor beta [Source:MGI Symbo... [more]
Rorb1.557e-2352.44RAR-related orphan receptor beta [Source:MGI Symbo... [more]
Rora1.703e-2350.59RAR-related orphan receptor alpha [Source:MGI Symb... [more]
Rora2.689e-2350.59RAR-related orphan receptor alpha [Source:MGI Symb... [more]
Pparg4.421e-2353.76peroxisome proliferator activated receptor gamma [... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8R1B8|RORB_MOUSE3.884e-2347.83Nuclear receptor ROR-beta OS=Mus musculus OX=10090... [more]
sp|Q92753|RORB_HUMAN1.193e-2252.44Nuclear receptor ROR-beta OS=Homo sapiens OX=9606 ... [more]
sp|P45446|RORB_RAT1.260e-2235.47Nuclear receptor ROR-beta OS=Rattus norvegicus OX=... [more]
sp|P35398|RORA_HUMAN1.376e-2250.59Nuclear receptor ROR-alpha OS=Homo sapiens OX=9606... [more]
sp|F1QLY4|RORAA_DANRE1.415e-2252.44Nuclear receptor ROR-alpha A OS=Danio rerio OX=795... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3W9585.971e-9677.25Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A0X3Q5771.388e-9578.49Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A4S2LHQ91.876e-9577.66Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A0X3Q5B24.774e-9578.49Putative nuclear hormone receptor HR3 (Fragment) O... [more]
A0A0V0J8N04.782e-9578.49Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rorc3.961e-2453.57nuclear receptor ROR-alpha-like [Source:NCBI gene;... [more]
rorca5.858e-2451.76nuclear receptor ROR-beta-like [Source:NCBI gene;A... [more]
rorb8.116e-2450.59RAR related orphan receptor B [Source:NCBI gene;Ac... [more]
rorcb9.632e-2452.44nuclear receptor ROR-beta-like [Source:NCBI gene;A... [more]
rorb9.767e-2451.19RAR related orphan receptor B [Source:NCBI gene;Ac... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rorb2.580e-2450.00RAR-related orphan receptor B [Source:ZFIN;Acc:ZDB... [more]
thrb3.377e-2246.74thyroid hormone receptor beta [Source:NCBI gene;Ac... [more]
nr1d2a3.294e-2048.94nuclear receptor subfamily 1, group D, member 2a [... [more]
ENSPMAT00000006803.14.293e-2054.93pep scaffold:Pmarinus_7.0:GL479639:153667:156574:-... [more]
thrb5.934e-2052.17thyroid hormone receptor beta [Source:NCBI gene;Ac... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO389956.239e-2144.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429362.092e-2041.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376453.977e-2050.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422774.265e-2045.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327151.714e-1945.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
roraa2.281e-2544.76RAR related orphan receptor A [Source:NCBI gene;Ac... [more]
roraa3.226e-2444.04RAR related orphan receptor A [Source:NCBI gene;Ac... [more]
roraa3.269e-2447.37RAR related orphan receptor A [Source:NCBI gene;Ac... [more]
rorb4.128e-2443.12RAR related orphan receptor B [Source:NCBI gene;Ac... [more]
rorb6.949e-2444.23RAR related orphan receptor B [Source:NCBI gene;Ac... [more]
back to top
BLAST of Nuclear receptor 2DBD gamma vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020242.10.000e+097.38SMESG000020242.1[more]
SMESG000020242.10.000e+097.99SMESG000020242.1[more]
SMESG000020242.10.000e+097.32SMESG000020242.1[more]
SMESG000008787.14.280e-5752.88SMESG000008787.1[more]
SMESG000007787.18.591e-5748.16SMESG000007787.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004154 ID=SMED30004154|Name=Nuclear receptor 2DBD gamma|organism=Schmidtea mediterranea sexual|type=transcript|length=3153bp
CTTAAAGTTTTTTTCACTAAGATTGTCTCCAAAACTGTTTTTACTCAATT
ATTTTTATTATAGATCGCAATTATAAATGTGTTTTTTTGGTGTTATAATT
TATGTTGTGAGTATTTTGTCAAGAAATTTCAAGGAGTATGATTTATGCAA
GTTTGATAAAGATAATATACTACGTAAATCATCATCCATGAACAGCCGAG
CTAAATGCAAGGCTATACAAATCTCGCTAATATTGCTGTAATCAACCCAC
TCTCTACAATGGATACGACAAAGAATTCTCATCCTCTCTACAATGGTTAT
CCTAATCCAAAAAAAGCTCGCTTGATTCAACATGTTGTATTTTCTAAAAC
TGCAGCTGCGAACGGATCGGAATTACCGGGAATTGATATTGATGCAAGTA
ATATCGGGTCAATGAATAATAGCAGTGTTCCAAACAAAATTCAATCGCAT
ACCCCTTCAGAACACAATCCTTATTCTACTTTGATGGCAAACAATGCAAC
AACTTGCTTCTATTCTCCGGGATTTTTGGAACCTTATGTAATCAATACAG
AAAATCTTACCCAATCCGCCGCCCAGTCATTCGATTTAACAAGGATTCCT
GTTTCTAATAAAACTTATTGCTCATTTCCCAATCCAAGTTCAGCATTAAG
TAGCATATTTCTAACCGGAGGAGGCATTGAATGGTCTGGTGCACCATTAT
CCACTTCGAACCCATTTCAATGCATCTCAAGTTCAACAACAGACAATATG
AAACTGAATAACATAAACTACCAAGGTTCATATGGTGATTGCAACGATAT
CACTAATTCCCTACTAAATAACCTCAAATCAAGAGATGTATTTCAAGCCC
AACAAGAATACAACAACAGATATTCCGATAATGCTCCATCTTATTTGAAA
TATGATCAATCTCCAGTCGGTTGGTATAAATTGAAAGAAGAAACTCGACC
AAATTGTTCTGTTCCAACACCTCTCTCTGCGGATCAGCTTAGCAATGGCT
ATGATTACAACTATCGAGAGATGAAGGAGAAAAGAAAATGCGATGTCTGT
GGAGATGTTTCAGCTGGATTTCATTGTAGTGCATTCGTTTGTGAAGCGTG
TAAAAAATTTTTCATCCGAAGTTCTAAAGGAGACAGTTACACAAAATATT
CTTGTACAAAGAATAACAACTGTGAAATAGTAAAAGATACAAGAACACAT
TGTCAATATTGCCGATTTCAAAAATGTTTACATCTTGGAATGACATTGCC
TGGAGCCAATCTTAATCAAAATACTGATATTTCACTCATACCGTGTCGAG
TTTGTGGGGCGCAATCATCAGGATTTCATTTTGGAGCTATAACATGTGAA
GGTTGCAAAGGATTTTTTCGACGAACGATTAACGAAAGAGAAAACCAGAA
ATACACATGCCGAAATGGAGGAAATTGTGTAATAAATCTTGCGACAAGAA
ATAACTGCAAAAGCTGTCGATATAAAAAATGCCTAGCTATGGGAATGTCA
AAAGAAGGAAGTCGAATAGGTCGTCAACCGAATGCAATAAAACACATGTG
TGCCAAAGAGATCAGTCAGATTCGAGCTGGGCTTGCTTTGAATCATTTTA
GCAATAACAATTCTCATTCGATTGGCCATACTGATTCTGGAATGATTCAA
GCATATCTTCCCAATCATTTGTCTTCTGCGATCATGTCGACAATGAATCT
CGATTTCAATCTGACCAACGGTCAAACTCGATACCAACAAACTACAGCTC
CATTGCCAACATCTGAGTTCTATCTTAATTCTAACTCTTCCAAGTATCCT
CTTTATAACCTTCAAACTCAACAAGAGAATGAAAATATTTGTGATATCAA
GACAATAATCGAAGAGCATAGCAATGGGGCATATTTAGAGAGATCACAAA
ATAAACTGATGCTGCAACAATATGAAGATAAGATTCCATCGAACGTGAAC
AATTCCAAGGCTGAACCGACATATTATGAAACAACATTTAATTACAATGA
CAAAGATATTATCAACAGAAATGACCATGCCATTGAAATCAATTCTTGTT
CTGGTTCATTGACGATTTCTGATGAAAAAACTGATTTTCGAAGTTCCTTT
ACCGAAAGCAATTCCAGAGAGAAAAGCGAAGACCATTGCAGTGATTCGGG
ATTCATGAAAGAAGTCGATAGAAATTTCAATTTGGAAGTTCCATTTTTAT
CGTCGATTGATCAATTGAATATTGTTGAATCAAAATTTTCCGTTGATATG
CCACTTCATAAATTCATTTCTACTGTTAATTTGGCCGCGAAGGCATTGTG
CAATTGTCGACGAAGAGTAACAAGACAAATTAATCTTTTGACTAACACTA
ATGAGACATACGTTTGGGATGTAATGATGCAGCACTTTCAGGCACATGCA
ATACAGGTAATCAAATTTGCCAAAGCTGTTCCGGGATTTAAAGAACTATT
TCACAATGACATGAAAGTACTTGTTCAAGAAGGCATGTACCCAATTATTT
TAGTCCAACTGTCCAGGGATTTTAATTTGGCCACTGACGAATTTAATTAT
TTCAATTTTTCAAATAAAGAAAAAGAAATAATTCTTACAAGATTTGCGAT
TTTCAACAAAATTGCCGATCATGTCATGAAATCTGGCCGACTGATCAAGT
TAAAGAATCTTGATGATACGATTTTCTCACTAATATGCTATGTGGAATTG
GTTAAAGGAGAATCGTGTTCAGTATTTGACCGCAACAAAGTAAACCAAAT
GTATCAATATTCCATGAATGCACTTAAACTCTATATGACAGAAATCGGAA
GCACCCAAAATGAGATCGACAGTGTTCTGGAAATTTTTCCCGTCCTTTCG
AAAATGACTCACGAACATCAAGAAGCTGTCATGATGCTCAGAACTTCGAA
ACCGCATTTAAAATTTCCCAATCTTTATACGCAAATGTTTCTGATTGATT
AAATTGTGAAGCATTGGAGTCGTGATGAAATGTACAATTGTAAATATCCT
CTCCACATGGATTTCATATATTTTTATGCGTTTTTATAAAGAACATTGAG
ACAATAAAACTTTTTATTCTGGTTCTATGAAATAACATTTACGAATGAAA
CGATTTTTCATTGTTGTGGTTTTTTATTTCATAAATATGAATTTATTTAT
TTC
back to top

protein sequence of SMED30004154-orf-1

>SMED30004154-orf-1 ID=SMED30004154-orf-1|Name=SMED30004154-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=916bp
MQGYTNLANIAVINPLSTMDTTKNSHPLYNGYPNPKKARLIQHVVFSKTA
AANGSELPGIDIDASNIGSMNNSSVPNKIQSHTPSEHNPYSTLMANNATT
CFYSPGFLEPYVINTENLTQSAAQSFDLTRIPVSNKTYCSFPNPSSALSS
IFLTGGGIEWSGAPLSTSNPFQCISSSTTDNMKLNNINYQGSYGDCNDIT
NSLLNNLKSRDVFQAQQEYNNRYSDNAPSYLKYDQSPVGWYKLKEETRPN
CSVPTPLSADQLSNGYDYNYREMKEKRKCDVCGDVSAGFHCSAFVCEACK
KFFIRSSKGDSYTKYSCTKNNNCEIVKDTRTHCQYCRFQKCLHLGMTLPG
ANLNQNTDISLIPCRVCGAQSSGFHFGAITCEGCKGFFRRTINERENQKY
TCRNGGNCVINLATRNNCKSCRYKKCLAMGMSKEGSRIGRQPNAIKHMCA
KEISQIRAGLALNHFSNNNSHSIGHTDSGMIQAYLPNHLSSAIMSTMNLD
FNLTNGQTRYQQTTAPLPTSEFYLNSNSSKYPLYNLQTQQENENICDIKT
IIEEHSNGAYLERSQNKLMLQQYEDKIPSNVNNSKAEPTYYETTFNYNDK
DIINRNDHAIEINSCSGSLTISDEKTDFRSSFTESNSREKSEDHCSDSGF
MKEVDRNFNLEVPFLSSIDQLNIVESKFSVDMPLHKFISTVNLAAKALCN
CRRRVTRQINLLTNTNETYVWDVMMQHFQAHAIQVIKFAKAVPGFKELFH
NDMKVLVQEGMYPIILVQLSRDFNLATDEFNYFNFSNKEKEIILTRFAIF
NKIADHVMKSGRLIKLKNLDDTIFSLICYVELVKGESCSVFDRNKVNQMY
QYSMNALKLYMTEIGSTQNEIDSVLEIFPVLSKMTHEHQEAVMMLRTSKP
HLKFPNLYTQMFLID*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003707steroid hormone receptor activity
GO:0008270zinc ion binding
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000204ovary
PLANA:0000205oviduct
PLANA:0000206penis papilla
PLANA:0000207sperm duct
PLANA:0000208testis
PLANA:0000224cement gland
PLANA:0000230tuba
PLANA:0000232copulatory apparatus
PLANA:0000233copulatory bursa
PLANA:0000234seminal vesicle
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0043401steroid hormone mediated signaling pathway
GO:0006351transcription, DNA-templated
Vocabulary: INTERPRO
TermDefinition
IPR001628Znf_hrmn_rcpt
IPR000536Nucl_hrmn_rcpt_lig-bd
IPR013088Znf_NHR/GATA