General transcription factor 3C polypeptide 3

Overview
NameGeneral transcription factor 3C polypeptide 3
Smed IDSMED30004151
Length (bp)3017
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of General transcription factor 3C polypeptide 3 (SMED30004151) t-SNE clustered cells

Violin plots show distribution of expression levels for General transcription factor 3C polypeptide 3 (SMED30004151) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of General transcription factor 3C polypeptide 3 (SMED30004151) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for General transcription factor 3C polypeptide 3 (SMED30004151) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004151

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30004151h1SMcG0015671 dd_Smed_v4_13650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004151h1SMcG0015671 dd_Smed_v4_13650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004151h1SMcG0015671 dd_Smed_v4_13650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004151h1SMcG0015671 dd_Smed_v4_13650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Human
Match: GTF3C3 (general transcription factor IIIC subunit 3 [Source:HGNC Symbol;Acc:HGNC:4666])

HSP 1 Score: 83.5741 bits (205), Expect = 1.351e-15
Identity = 56/195 (28.72%), Postives = 89/195 (45.64%), Query Frame = 3
Query: 2157 LRILKNKYGENIQFWNLF-LIYTYIIGTSNERFVLRNLPVVKNNYPVEMINAGSILI-GSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCLSCPPVGNTDHEKSLNDLSREAAFNLVYIYKGRNQRKTVQHLTQKY 2735
            +RI+  +     Q WN+F  +  +     + RF LR +     N+ + ++N  +  + GS K +L    + F  H + P     + +T I+ A  +   +   L    F F+  Y  LRG CQE++YN GR  H++     AI+ Y+K L  PP+     E    DL R+ A+NL  IY+        Q L   Y
Sbjct:  689 IRIMVMENVNKPQLWNIFNQVTMHSQDVRHHRFCLRLMLKNPENHALCVLNGHNAFVSGSFKHALGQYVQAFRTHPDEPLYSFCIGLTFIHMASQKYVLRRHALIVQGFSFLNRYLSLRGPCQESFYNLGRGLHQLGLIHLAIHYYQKALELPPLVVEGIELDQLDLRRDIAYNLSLIYQSSGNTGMAQTLLYTY 883          

HSP 2 Score: 66.2402 bits (160), Expect = 2.395e-10
Identity = 55/226 (24.34%), Postives = 111/226 (49.12%), Query Frame = 3
Query:  483 KKKLSDECKGIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHKKASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQITKLAMNHCNTINIRE--KLAELLEKGGYEKEAM---KRKLTNFEMSASEKNPTVISDIVEELFYLSEKFYVRKDVKRSCKCLEIVNMKYPTLVTDEQRFSLLKQMFAVNR-YHGILDVVKNIKGVEID 1142
            + KL    +G+ G A + F  G+ +EA   C  II++ PL Y  +  L+ I+  +GD +K+ QF   +A  +P ++E+W+   E +   + +++AI     A+ +  T N+R   + + L E+ G  K AM   +R L     S  E+   +  D       +++ +Y   DV  +   ++    K+  LV+ E   ++  +++  N+ Y   L+++ +  G+ ++
Sbjct:  142 RSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNPSDTEEWVRLAEMSLEQDNIKQAIFCYTKALKYEPT-NVRYLWERSSLYEQMGDHKMAMDGYRRILNLLSPSDGERFMQLARD-------MAKSYYEANDVTSAINIIDEAFSKHQGLVSMED-VNIAAELYISNKQYDKALEIITDFSGIVLE 358          
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Human
Match: GTF3C3 (general transcription factor IIIC subunit 3 [Source:HGNC Symbol;Acc:HGNC:4666])

HSP 1 Score: 63.929 bits (154), Expect = 7.347e-10
Identity = 55/223 (24.66%), Postives = 109/223 (48.88%), Query Frame = 3
Query:  483 KKKLSDECKGIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHKKASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQITKLAMNHCNTINIRE--KLAELLEKGGYEKEAM---KRKLTNFEMSASEKNPTVISDIVEELFYLSEKFYVRKDVKRSCKCLEIVNMKYPTLVTDEQRFSLLKQMFAVNR-YHGILDVVKNIKGV 1133
            + KL    +G+ G A + F  G+ +EA   C  II++ PL Y  +  L+ I+  +GD +K+ QF   +A  +P ++E+W+   E +   + +++AI     A+ +  T N+R   + + L E+ G  K AM   +R L     S  E+   +  D       +++ +Y   DV  +   ++    K+  LV+ E   ++  +++  N+ Y   L+++ +  G+
Sbjct:  142 RSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNPSDTEEWVRLAEMSLEQDNIKQAIFCYTKALKYEPT-NVRYLWERSSLYEQMGDHKMAMDGYRRILNLLSPSDGERFMQLARD-------MAKSYYEANDVTSAINIIDEAFSKHQGLVSMED-VNIAAELYISNKQYDKALEIITDFSGI 355          
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Human
Match: GTF3C3 (general transcription factor IIIC subunit 3 [Source:HGNC Symbol;Acc:HGNC:4666])

HSP 1 Score: 64.3142 bits (155), Expect = 9.806e-10
Identity = 78/357 (21.85%), Postives = 156/357 (43.70%), Query Frame = 3
Query:  483 KKKLSDECKGIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHKKASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQITKLAMNHCNTINIRE--KLAELLEKGGYEKEAM---KRKLTNFEMSASEKNPTVISDIVEELFYLSEKFYVRKDVKRSCKCLEIVNMKYPTLVTDEQRFSLLKQMFAVNR-YHGILDVVKNIKGVEIDL-----------NYPSNLLSFTTEISYDNRRQIIYYALFASIHLEMTVFIESPRFILFMKDIMDKSDWYLNICLKLYAMKHYKISLNLLENPGDMVDKLASLKLF----GKCQEALGFDNDALCTYDNIIN 1490
            + KL    +G+ G A + F  G+ +EA   C  II++ PL Y  +  L+ I+  +GD +K+ QF   +A  +P ++E+W+   E +   + +++AI     A+ +  T N+R   + + L E+ G  K AM   +R L     S  E+   +  D       +++ +Y   DV  +   ++    K+  LV+ E   ++  +++  N+ Y   L+++ +  G+ ++              P N+   T  I       I    +   +HL +   +      L  ++  D  D YL++      +  Y  +L LL     +  +  +L +      +C +ALG+   A  +Y  +++
Sbjct:  142 RSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNPSDTEEWVRLAEMSLEQDNIKQAIFCYTKALKYEPT-NVRYLWERSSLYEQMGDHKMAMDGYRRILNLLSPSDGERFMQLARD-------MAKSYYEANDVTSAINIIDEAFSKHQGLVSMED-VNIAAELYISNKQYDKALEIITDFSGIVLEKKTSEEGTSEENKAPENV---TCTIPDGVPIDITVKLMVCLVHLNILEPLNPLLTTLVEQNPEDMGDLYLDVAEAFLDVGEYNSALPLLS--ALVCSERYNLAVVWLRHAECLKALGYMERAAESYGKVVD 484          
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Celegans
Match: tftc-3 (Transcription Factor ThreeC subunit (GTF3C homolog) [Source:UniProtKB/TrEMBL;Acc:Q95PV7])

HSP 1 Score: 68.1662 bits (165), Expect = 2.490e-11
Identity = 44/175 (25.14%), Postives = 83/175 (47.43%), Query Frame = 3
Query: 2247 RFVLRNLPVVKNNYPVEMINAG-SILIGSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCLSCPPVGNTDHEKSLN---------DLSREAAFNLVYIYKGRNQRKTVQHLTQKYLT 2741
            RF++R L   K+N+ ++ I+   S++ G+ + ++    +++  +  NP +C+ L++T  + +  ++      +      FMK Y K R   QE +YN  R +H++     A + Y+K L   P    D ++  N         DL + AA NL  IY+        + + +KYL 
Sbjct:  862 RFIMRALVKAKDNHALQAISGNNSLITGTYRHAMGEYLRVWVANKRNPLICMLLALTFTHMSCKKDLSSRHLIGIRGIAFMKKYSKARACQQEVFYNIARMFHQMSILPLAKHFYDKVLEVDPPCVFDFDEDGNEVIIPAMKYDLRKMAAHNLALIYRTSGNNFAARKIYEKYLV 1036          
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Fly
Match: CG8950 (gene:FBgn0034186 transcript:FBtr0306810)

HSP 1 Score: 55.0694 bits (131), Expect = 3.829e-7
Identity = 58/212 (27.36%), Postives = 94/212 (44.34%), Query Frame = 3
Query: 2142 MIFQELRILKNKYGENIQFWNLFLIYTYIIGTSNERFVLRNLPVVKNNYPVEM----INAGSILIGSAKLSLAIN--SKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLR------GNC---QETYYNFGRFYHRIKCEERAINCYEKCLSCP--PVGNTDHEKSLNDLSREAAFNLVYIYKGR-NQRKTVQHL 2723
            + F  LR L  K       WN+    + +I   +E    R +  +   +PV+     I  G   +  A    A+N    +  E+  +P + L +++     +L +   +     + A  F + YK+LR       +C   QE +YN GR YH+      A++ YEK L+ P  P+   +HE +L  L  E AFNL  IY+   N+ K  Q+L
Sbjct:  657 IAFSYLRELIAKQPSQTTLWNML---SLMIQKGDEVRYYRYMRRLMQRHPVDTKPMRIFQGHYHLNCASFKYALNIYMPILREN-PDPLVALCIAVAFNQLSLQKKVLRKSASVAQAVAFGQRYKELRSAGHELADCAAQQEIFYNIGRIYHQANILHLAVDYYEKALAVPVHPL-IAEHESTLG-LQHEVAFNLHLIYRANGNKWKARQYL 862          
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Fly
Match: CG8950 (gene:FBgn0034186 transcript:FBtr0087013)

HSP 1 Score: 55.0694 bits (131), Expect = 3.829e-7
Identity = 58/212 (27.36%), Postives = 94/212 (44.34%), Query Frame = 3
Query: 2142 MIFQELRILKNKYGENIQFWNLFLIYTYIIGTSNERFVLRNLPVVKNNYPVEM----INAGSILIGSAKLSLAIN--SKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLR------GNC---QETYYNFGRFYHRIKCEERAINCYEKCLSCP--PVGNTDHEKSLNDLSREAAFNLVYIYKGR-NQRKTVQHL 2723
            + F  LR L  K       WN+    + +I   +E    R +  +   +PV+     I  G   +  A    A+N    +  E+  +P + L +++     +L +   +     + A  F + YK+LR       +C   QE +YN GR YH+      A++ YEK L+ P  P+   +HE +L  L  E AFNL  IY+   N+ K  Q+L
Sbjct:  657 IAFSYLRELIAKQPSQTTLWNML---SLMIQKGDEVRYYRYMRRLMQRHPVDTKPMRIFQGHYHLNCASFKYALNIYMPILREN-PDPLVALCIAVAFNQLSLQKKVLRKSASVAQAVAFGQRYKELRSAGHELADCAAQQEIFYNIGRIYHQANILHLAVDYYEKALAVPVHPL-IAEHESTLG-LQHEVAFNLHLIYRANGNKWKARQYL 862          
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Zebrafish
Match: gtf3c3 (general transcription factor IIIC, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-040914-80])

HSP 1 Score: 95.1301 bits (235), Expect = 2.431e-19
Identity = 59/197 (29.95%), Postives = 95/197 (48.22%), Query Frame = 3
Query: 2157 LRILKNKYGENIQFWNLF-LIYTYIIGTSNERFVLRNLPVVKNNYPVEMINAGSILI-GSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCLSCPPVGNTDHEKSLNDLSREAAFNLVYIYKGRNQRKTVQHLTQKYLT 2741
            +R++     E  Q WN+F  I  +     + RF LR +    +N+ + ++N  + L+ G+ K +L    + F    ++P   L + +T  + A  +   +   LT   F F+  Y  LRG CQE+ YN GR  H++     AI+ YEK L+ PP+     E    DL RE A+NL  IY+    +   +H+   Y T
Sbjct:  721 IRLMLMDSVERPQLWNVFNQITLHSQDARHHRFCLRLMLKHPDNHALYLLNGHTSLVSGTFKHALGQYMQAFRNEPDHPLHSLAIGLTFFHMACQKFVMKRHSLTVQGFSFLWRYVDLRGQCQESLYNLGRALHQLGLTHLAIHYYEKALTLPPLKMEGIEDDQVDLRREIAYNLSLIYQSSGNKDMARHIIYTYCT 917          

HSP 2 Score: 58.9214 bits (141), Expect = 3.156e-8
Identity = 49/213 (23.00%), Postives = 100/213 (46.95%), Query Frame = 3
Query:  471 RHVSKKKLSDECKGIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHKKASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQI-TKLAMNHCNTINIREKLAELLEKGGYEKEAM---KRKLTNFEMSASEKNPTVISDIVEELFYLSEKFYVRKDVKRSCKCLEIVNMKYPTLVTDEQRFSLLKQMFAVNRYH 1097
            RH  + KL    +G+ G A + +  G  ++A   C  II++ P+ Y  +  ++ I+  +GD +KA QF   +A  +P + E+W+   + +   + +++AI   TK      + +    + + L E+ G  K+AM   +R L+    +  E    +  D       +++ +Y   ++  +   +E    ++P LVT E   ++  ++F  N  H
Sbjct:  160 RH--RSKLPRALRGLMGEANIRYARGDKEDAILMCMEIIRQAPVAYEPFSTMAMIYEDQGDMEKALQFGLIAAHLNPSDCEEWVKLADMSLEQDNIKQAIICYTKAIKYDSSNVQYLWERSSLYEQVGEHKQAMDGYRRILSLLPPTDGEHFMQLSRD-------MAKSYYESSELPSAIGVMEEALERHPELVTHEC-VNMAAELFIANHQH 362          
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Xenopus
Match: GTF3C3 (general transcription factor IIIC subunit 3 [Source:NCBI gene;Acc:100488740])

HSP 1 Score: 127.487 bits (319), Expect = 2.614e-29
Identity = 177/784 (22.58%), Postives = 327/784 (41.71%), Query Frame = 3
Query:  480 SKKKLSDECKGIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHKKASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQITKLAMNHCNTINIR---EKLAELLEKGGYEKEAMK--RKLTNFEMSASEKNPTVISDIVEELFYLSEKFYVRKDVKRSCKCLEIVNMKYPTLVTDEQRFSLLKQMFAVNR-YHGILDVVKNIKGVEI---DLNYPSNLLSFTTEISYDNRRQIIYYALFASIHLEMTVFIESPRFILFMKDIMDKSDWYLNICLKLYAMKHYKISLNLLEN-PGDMVDKLASLKL-FGKCQEALGFDNDALCTYDNIINNVTGQDASIWELKANL-LYRLKREDDAIQVLGESQKFIYINLPQTN---LVSRCKPNKDSIQLLYKLCNLLYKEKRFEDFIKVSWKFLFIDSYEYFQINKVELCCEDIAFAKTRISEIQNNIWLGISRTLDANGHCVFATTHLKMGDG-STYDILKKLLDLFVTXXXXXXXXXXXXXQWGLVLTKILNWTQAIRLNLSVIYVSTAIR------NRIKNYRLRR-DISGNMI-------FQELRILKNKYGENIQFWNLF-LIYTYIIGTSNERFVLRNLPVVKNNYPVEMINAGSILI-GSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCLSCPPVGNTDHEKSLNDLSREAAFNLVYIYKGRNQRKTVQHLTQKY 2735
             + KL    +G+ G A + F  G+ +EA   C  II++ PL Y  +  L+ I+  +GD +K+ QF   +A  +P N+E+W+   E +   + +++AI     A+ + N  N+R   E+ + L E+ G  K AM   R++ N        +PT     ++    +++ +Y   D+  +   +E    K+  LV  E   ++  +++  N+ Y   LDV+    G+ +   + +  ++  S    I       I    +   IHL +   +      L  ++  +  D YL++      +  Y  +L LL      +   LA + L    C +ALG    A  +Y  ++      D +   L A + L  L+      Q LG  +K +    P  +   L       +  ++LL     LL+ + +  D+  V      +       +N+ ++C   I+ +K+    +     L +SR   +N         +   DG S + +L  +L                   W L++  +L      R   + + V +++       +R+K   L    +S  ++       +  +RI+  +     Q WN+F  I  +     + RF LR +    +N  + +++  +  + GS K +LA   + F     +P   L + +T ++ A  +   +   L    F F+  Y KLRG CQE+YYN GR  H++     AI+ Y++ L  PP+     E    DL R+ AFNL  IY+     +  + L  +Y
Sbjct:  102 PRSKLPKVLRGLMGEANIRFARGESEEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNPSNTEEWVRLAEMSLEQDNIKQAIFCYGKALRY-NPTNVRFLWER-SSLYEQIGEHKLAMDGYRRILNL------LSPTDGERFMQLARDMAKTYYETNDIASAIGTIEEALSKHQNLVAIED-VNIAAELYLSNKQYDKALDVITQFSGITLSKSETDVLNSAESVVCHIPDGVPIDITVKMMLCLIHLNILEPVYPLLTFLMEQNPEEVGDLYLDVAEAFLDVGEYNSALPLLSALVCSLKYNLAVVWLRHADCLKALGHMEKAAESYSKVV------DMAPLHLDARISLSTLQ------QQLGHPEKALEALEPMYDPDTLAQDSNAAQQELKLLLHRSTLLFSQGKLYDY--VDTLLTMLAMLLKIAMNRAQVCL--ISSSKSGERHL---YLLKVSRDKMSNND----DQDVANSDGKSIFTVLTSVL--------------TKDDWWSLLVKTVLALGDLSRFKEAELLVDSSLEYYSFYDDRMKRKELEYFGLSAAILDKNFRKAYNYIRIMLMENVNKPQLWNIFNQITMHSQDVRHHRFCLRLMLKNPSNLALCVLSGHNAFVSGSFKHALAQYVQAFRMEMNDPLHSLCIGLTFVHMASQKFVLKRHALLVQGFSFLNRYLKLRGPCQESYYNMGRALHQMGLVHLAIHYYQQALELPPLELEGMELDQLDLRRDIAFNLSLIYQNSGNLEMARRLLHQY 839          
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Mouse
Match: Gtf3c3 (general transcription factor IIIC, polypeptide 3 [Source:MGI Symbol;Acc:MGI:2138383])

HSP 1 Score: 83.9593 bits (206), Expect = 5.782e-16
Identity = 53/183 (28.96%), Postives = 87/183 (47.54%), Query Frame = 3
Query: 2193 QFWNLF-LIYTYIIGTSNERFVLRNLPVVKNNYPVEMINAGSILI-GSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCLSCPPVGNTDHEKSLNDLSREAAFNLVYIYKGRNQRKTVQHLTQKY 2735
            Q WN+F  +  +     + RF LR +    +N+ + ++N  +  + GS K +L    + F  +   P   L + +T I+ A  +   +   LT   F F+  Y  +RG CQE++YN GR  H++     AI+ Y+K L+ PP+     E    DL R+ A+N+  IY+        Q L   Y
Sbjct:  697 QLWNIFNQVTMHSQDVRHHRFCLRLMLKNPDNHALCVLNGHNAFVSGSFKHALGQYVQAFRAYPSEPLYNLCIGLTFIHMASQKYVLKRHALTVQGFSFLNRYLSIRGPCQESFYNLGRGLHQLGLTHLAIHYYQKALALPPLVVEGIEVDQLDLRRDIAYNMSLIYQSSGNTAMAQKLLYTY 879          

HSP 2 Score: 67.3958 bits (163), Expect = 9.274e-11
Identity = 56/223 (25.11%), Postives = 109/223 (48.88%), Query Frame = 3
Query:  483 KKKLSDECKGIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHKKASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQITKLAMNHCNTINIRE--KLAELLEKGGYEKEAM---KRKLTNFEMSASEKNPTVISDIVEELFYLSEKFYVRKDVKRSCKCLEIVNMKYPTLVTDEQRFSLLKQMFAVNR-YHGILDVVKNIKGV 1133
            + KL    +G+ G A + F  G+++EA   C  II++ PL Y  +  L+ I+  +GD +K+ QF   +A  +P ++E+W+   E +   + +++AI     A+ +  T N+R   + + L E+ G  K AM   +R L     S  E+   +  D       +++ +Y   D   +   +E    K+  LV+ E   ++  +++  N+ Y   L+V+ +  G+
Sbjct:  138 RSKLPRALRGLMGEANIRFARGEHEEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNPSDTEEWVRLAEMSLEQDNIKQAIFCYTKALKYEPT-NVRYLWERSSLYEQMGDHKMAMDGYRRILNLLSPSDGERFMQLARD-------MAKSYYEANDSASAINIIEEAFSKHQGLVSMED-VNIAAELYISNKQYDKALEVITDFSGI 351          
BLAST of General transcription factor 3C polypeptide 3 vs. UniProt/SwissProt
Match: sp|Q9Y5Q9|TF3C3_HUMAN (General transcription factor 3C polypeptide 3 OS=Homo sapiens OX=9606 GN=GTF3C3 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 6.489e-15
Identity = 56/195 (28.72%), Postives = 89/195 (45.64%), Query Frame = 3
Query: 2157 LRILKNKYGENIQFWNLF-LIYTYIIGTSNERFVLRNLPVVKNNYPVEMINAGSILI-GSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCLSCPPVGNTDHEKSLNDLSREAAFNLVYIYKGRNQRKTVQHLTQKY 2735
            +RI+  +     Q WN+F  +  +     + RF LR +     N+ + ++N  +  + GS K +L    + F  H + P     + +T I+ A  +   +   L    F F+  Y  LRG CQE++YN GR  H++     AI+ Y+K L  PP+     E    DL R+ A+NL  IY+        Q L   Y
Sbjct:  689 IRIMVMENVNKPQLWNIFNQVTMHSQDVRHHRFCLRLMLKNPENHALCVLNGHNAFVSGSFKHALGQYVQAFRTHPDEPLYSFCIGLTFIHMASQKYVLRRHALIVQGFSFLNRYLSLRGPCQESFYNLGRGLHQLGLIHLAIHYYQKALELPPLVVEGIELDQLDLRRDIAYNLSLIYQSSGNTGMAQTLLYTY 883          

HSP 2 Score: 66.2402 bits (160), Expect = 1.150e-9
Identity = 55/226 (24.34%), Postives = 111/226 (49.12%), Query Frame = 3
Query:  483 KKKLSDECKGIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHKKASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQITKLAMNHCNTINIRE--KLAELLEKGGYEKEAM---KRKLTNFEMSASEKNPTVISDIVEELFYLSEKFYVRKDVKRSCKCLEIVNMKYPTLVTDEQRFSLLKQMFAVNR-YHGILDVVKNIKGVEID 1142
            + KL    +G+ G A + F  G+ +EA   C  II++ PL Y  +  L+ I+  +GD +K+ QF   +A  +P ++E+W+   E +   + +++AI     A+ +  T N+R   + + L E+ G  K AM   +R L     S  E+   +  D       +++ +Y   DV  +   ++    K+  LV+ E   ++  +++  N+ Y   L+++ +  G+ ++
Sbjct:  142 RSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNPSDTEEWVRLAEMSLEQDNIKQAIFCYTKALKYEPT-NVRYLWERSSLYEQMGDHKMAMDGYRRILNLLSPSDGERFMQLARD-------MAKSYYEANDVTSAINIIDEAFSKHQGLVSMED-VNIAAELYISNKQYDKALEIITDFSGIVLE 358          
BLAST of General transcription factor 3C polypeptide 3 vs. TrEMBL
Match: A0A5K4F5L5 (O-linked n-acetylglucosamine transferase, ogt,putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 8.113e-39
Identity = 189/838 (22.55%), Postives = 345/838 (41.17%), Query Frame = 3
Query:  483 KKKLSDECKGIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHKKASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQITKLAM--NHCNTINIREKLAELLEKGGYEKEAMKRKLTNFEMSASEKNPTVISDIVEELFYLSEKFYVRKDVKRSCKCLEIVNMKYPTLVTDEQRFSLLKQMFAVNRYHGILDVVKNIKGVEI--------DLNYPSNLLSFTTEISY----DNRRQIIYYALFASI-HLEMTVFIESPRFILFM-KDIMDKSDWYLNICLKLYAMKHYKISLNLLEN--PGDMVDKLASL-KLFGKCQEALGFDNDALCTYDNIINNVTGQDASIWELKANLLYRLKREDDAIQVLGES-------------------------------------QKFIYINLPQTNLVSRCKPNKDSIQ------------------------LLYKLCNLLYKEKRFEDFIKVSWKFLFIDSYEY--FQINKVELCCEDIAFAKTRISEIQNNIWLGISRTLDANGHCVFATTHLK-MGDGSTYDILKKLLDLFVTXXXXXXXXXXXXXQWGLVLTKILNWTQAIRLNLSVIYVSTAIRNRIKNYRLRRDISGNMIFQELRILKNKYGENIQFWNLF-LIYTYIIGTSNERFVLRNLPVVKNNYPVEMINAGSILI-GSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCLSCPPVGNTDHEKSLNDLSREAAFNLVYIYKGRNQRKTVQHLTQKYLT 2741
            + +L  E     G AE +    +++ A+  C +II   P     Y +L+ I   RG+ +KA +F + +A  +P +   WL  ++  E  E    AI   + A+  N  +T ++R++L +L    G  +EA++ +L    ++          ++  EL   +++F+   D   S K  E    +YP   TD  R S L  M  + RY   L    +  GV++        D++  S+ LS   +       DN    +   LF  + HL +   + S     +  ++I   SDW L+I +       Y I++ L+      ++  KL  +  L  +C    G    A+  Y ++I N+  +         NLL RL R  +A++ L  S                                     + F + +L +T++V     ++ S++                        L Y+ C +L   +  + F++ +W  LF D       +  ++ L  +     K  I  + + +   ++ TL        +TT    +     + +  +++D+           LE  + W  +L  +       RL  S + +S+++  R           G   F ELR ++ ++ E  Q+WN+  L  T      + RF+ R +     N  +  I +   L+ GS + ++A    + ++  ++  L L L++  ++ A+ ++          A  F+  YK+LRG+CQE YYN  R  H++     AI+ YEK L+  P+GN   EKS+ +L REAAFNL  +Y+        +H+ QKY+ 
Sbjct:  135 RARLPIELAQYLGEAERHLNNDEFEHAERICYQIIDTAPQASQPYIVLAEISFRRGNQEKAKEFLYQAAQRNPSDQNTWLTLMDWAEEAEDFPLAIHYARQALRRNRADT-SLRQRLIDLCHVAGRSREALQLRLAALSVTPESTGEEQF-EVAREL---ADQFFKLLDPHNSVKAYENAFEQYPDHGTDNDRNSALSIMLQMKRYDQALKFFTSFCGVKLYLNSGDLFDMDRHSSKLSSVEKFKRCEFPDNMAVELQLKLFLILAHLGLGPLVVSRVESTYTNENITKYSDWLLDIVVAYKEKNLYSIAIQLILKLKKSNVTCKLVQVWTLLAECYLEAGETESAIKAYRHVIENLDPRHTDARLGLVNLLRRLGRNQEALKFLNPSNLVQKGVKPEISLTEQCDLIVQKREKSPLKSSHRSTVKSFAFSDLQRTSVVGDVDSDERSVEKVCLDSDWLDASANLVSRDHVAYRLAYERCRMLDTPESVDSFLEEAWALLFSDVTRVCGPRFTQLALTLDSEQHRKLVIDRLAS-VAPALTDTLSNQIDAERSTTETNGVSSSDIWGLFLRVVDVLRARLPKSLPQLETATAWASLLPHV-QGNDLRRLAASHLLISSSLIAR----------HGTPAFLELRKIQKQWSEYNQYWNVMNLAITLSRDFKHCRFLDRLVTKDSLNLAIGTIASSDTLVRGSYRYAIARLINMREKFPDDALLTLLLAVGFLSMAMQKHIGSRHLAILQAVGFLGEYKRLRGDCQEVYYNIARACHQLLITHMAIHYYEKVLAMEPIGNNPEEKSVTNLHREAAFNLALLYRTNGNPAMARHILQKYVV 955          
BLAST of General transcription factor 3C polypeptide 3 vs. TrEMBL
Match: C3XQ24 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_113732 PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 9.277e-32
Identity = 181/781 (23.18%), Postives = 337/781 (43.15%), Query Frame = 3
Query:  507 KGIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHKKASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQITKLAMNH-CNTINIREKLAELLEKGGYEKEAMKRKLTNFEMSASEKNPTVISDIVEELFYLSEKFYVRKDVKRSCKCLEIVNMKYPTLVTDEQRFSLLKQMFAVNRYHGILDVVKNIKGVEID-----LNYPSNLLSFTTEISYDNRRQIIYYALFASIHLEMTV----------FIESPRFI---LFMKDIMDKSDWYLNICLKLYAMKHYKISLNLLENPGDMVDK----LASLKL-FGKCQEALGFDNDALCTYDNIINNVTGQDASIWELKANLLYRLKREDDAIQVLGESQKFIYINLPQTNLVSRCKPNKDSIQLLYKLCNLLYKEKRFEDFIKVSWKFLFIDSY--EYFQINKVELCCEDIAFAKTRI---SEIQNNIWLGISRT-LDANGHCVFATTHLKMGDGSTYDILKKLLDLFVTXXXXXXXXXXXXXQWGLVLTKILNWT----QAIRLNLSVIYVSTAIRNRIKNYRLRRDISGNMIFQELRILKNKYGENIQFWNLF-LIYTYIIGTSNERFVLRNLPVVKNNYPVEMINAGSILI-GSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCL--SCPPVGNTDHEKSLNDLSREAAFNLVYIYKGRNQRKTVQHLTQKY 2735
            +G+ G A L F  GKYD+A + C  +I++ P  Y  ++  + ++  +GD +++ QF   +A  +P++ E+W+   E +     + +AI   K A+ +  N I I  + A LLE+    ++A++      ++   EK      D++ +   +S+ ++   + + + + ++    K+PTLVT E    L +    + +Y  +L+ + N   V++       +  + L       +     Q++   +     +++++          ++ + R +   L  +   D  D YL+I      +  Y  +  +L     +V+     LA++ L + +C  ALG    A+ +Y  ++        +   L A L  +L R ++A+Q L E+         +T      +P  D +QLL+    LLY + R EDF+  +   L +  Y  E +Q   ++L    I   + +    + ++    +G  R+ +D +G         K+   S  +      DLF  +    + L        L +  + +       A +  L  + +S    N+  NYR+        +F    I++N  G N Q WN+F  I T      + RF LR +    +N  +  +N  + LI G+ K +L    + +     NP   L + +T  + A  +   +   +      F+  Y   RG  QE YYN GR  H+I  E  AI+ Y+K L  + P VG+  + + L DL RE A+NL  IY G   +   + L  KY
Sbjct:  156 RGLMGEANLRFARGKYDDAIKMCMEVIRQVPHCYEPFQTAAMVYEEKGDMERSLQFALIAAHLNPQDPEEWVKLAEVSLEQNNISQAITCYKKALRYDPNNIGILWEQANLLEQTQEPRKALEGYQQILKL-LPEKEGNKYMDLMRD---MSKTYHATGETEAAIETIQAAFTKHPTLVTFEDVNMLTELYVTMKQYRHVLEAMSNYCSVQLSWQGGVTDTMAALDRLGMPDTGKQETQVMQCTIPPETPIDLSIKLAVSLVHLRYLAAARPLVDMLLQESAEDMGDLYLDIAEAYVDVGEYDSARPIL---AMLVNTERYNLAAVWLRYAECLNALGKTEHAVQSYAKVVEMAPSHLGARLSLSA-LQQQLGRPEEALQALSEAV--------ETAAQVSSQPGPD-VQLLHHKSTLLYSQGRMEDFVDSA--LLMLSKYFEEAYQQQNLQLVVTKITSRRRKYQLRAMVKEQGGVGQGRSVVDLSG---------KLSSISKLE----WWDLFCKASRSLTTLGRTEEVEHLTMAALASPQFERDLAKQKELKYMILSACCLNK--NYRM------AYVFVRPMIMENT-GVN-QLWNVFSQITTSSEDARHHRFCLRLMIKNPHNIALSFLNGHNSLISGTYKHALGEYVRAYRLDPSNPMSLLLIGVTFFHMASQKYTIKRHFVLVQGMSFLNEYLIHRGGTQEAYYNVGRALHQIGLEHLAIHYYQKALHMAPPDVGDNKYSQLL-DLRREVAYNLALIYSGSGSKNLAKMLLDKY 893          
BLAST of General transcription factor 3C polypeptide 3 vs. TrEMBL
Match: A0A553NDZ5 (Uncharacterized protein OS=Tigriopus californicus OX=6832 GN=TCAL_02042 PE=4 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.046e-27
Identity = 187/770 (24.29%), Postives = 337/770 (43.77%), Query Frame = 3
Query:  471 RHVSKKKLSDECKGIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHKKASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQITKLAMNHCNTINIREKLA--ELLEKGGYEKEAMK--RKLTNFEMSASEKNPTVISDIVEELFYLSEKFYVRKDVKRSCKCLEIVNMKYPTLVTDEQRFSLLKQMFAVNRYHGILDVV---------KNIKGVEID-LNYPSNLLSFTTEISYDNRRQIIYYAL-FASIHLEMTVFIESPRFILFMKDIMDKSDWYLNICLKLYAMKHYKISLNLLENPGDMV--DKLASLKLFGKCQEALGFDNDALC----TYDNIINNVTGQDASIWELKANLLYRLKREDDAIQVLGESQKFIYINLPQTNLVSRCKPNKDSIQLLYKLCNLLYKEKRFEDFIKVSWKFLFIDSYEYFQI-NKVEL----CCEDIAFAKTRISEIQNNIWLGISRTLDANGHCVFATTHLKMGDGSTYDILKKLLDLFVTXXXXXXXXXXXXXQWGLVLTKILNWTQAIRLNLSVIYVSTAIRN--RIKNYRLRRDISGNMIFQELRILKNKYGENIQFWNLF-LIYTYIIGTSNERFVLRNLPVVKNNYPVEMINAGSILI-GSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCLSCPPVGNTDHEKSLNDLSREAAFNLVYIYK 2690
            +++ +K+L    +G+ G A L F  G  + A   C  +I++ P     Y+ LS ++   G+ +K+ QF   +A   P+++E+W    + +  +    +AI   + A++  +  N R  LA   LLE+ G  + A++  ++L         ++    S  +  L ++ E F   KDV       E V  KYP++VT E+   LL+ + ++N+    L+V+          ++   E+D L+    L +F+  I  +     I   L    ++L+ T  ++     +   D  +  + +L+I   L   +H+  SL  LE    +V  +  A   ++ K  E+L F+ ++L      Y  ++ +      +   L +++L++L R D+A+  L + +    +N                  LLY+ C LL+ E  FE+F+ V  K L   S  + QI NK EL      + +A     +SE++      + R    +G    + T + M D   Y + +KL D     +   +      S  G   +   N    I      + + ++  N      Y L R++    I            +N + WNLF L+        + RF++R +    +N  + ++N  + L+ G+ K SL      F +  +NP + L L +T  + A  +   +   L   +  F+  Y +LRG CQE+YYN GR  H++     A+  Y+K LS PP    D++    +L RE AFNL  IY+
Sbjct:  192 KNIRRKRLDPALQGLMGEANLRFVRGDRETAIRMCMEVIRQDPTAPEPYQTLSNVYEEGGEQEKSLQFALIAAHLAPQDAEEWARLADMSLEMGDRNQAISCYRKAID-ADLENTRYHLARCSLLEQSGEIRSAIRGYKRLIAVLKEDQSQDFINASKELARLLHVKENFEAAKDV-----IYEAVK-KYPSIVTSEELNLLLELLISLNQNDEALEVLCKYCSTQFSSDVSQEELDDLSPEKQLEAFSIVIMPEGTPLDIKAKLVIVLVNLKATHLVKVSCKEIMASDPEEFGEIFLDIAEVLMTNQHFDQSLPFLEK---LVKSESYAQPAVWLKYGESL-FETNSLAEAELAYQKVVESAPQHHEARRTL-SSILHKLGRADEALFTLTQDEDVDLLN----------------PTLLYEKCQLLWSEGCFEEFV-VKAKLLL--SRHFVQIRNKEELHAIASAKKLASKNKALSEVRAYRREPLIRD---SGPSFESGTQISMED--EYLLFRKLCDYLYEQKRFEALQKVSFSAMG---SPYFNKKPDIVKECEFLCLISSFLNGDSYHAYNLVRELVTKDI------------KNPRIWNLFNLVIMRADDVRHNRFLMRLMSRNPDNIALGILNGHNCLVAGTYKYSLGEYMSAFKQERDNPMVALMLGLTFTHMACQKFSAKKHSLVVQSCAFLHKYLQLRGVCQESYYNLGRAMHQLGLLPAALFYYKKALSLPPAVENDYK---FNLCREIAFNLSLIYR 907          
BLAST of General transcription factor 3C polypeptide 3 vs. TrEMBL
Match: A0A3B3RHU6 (General transcription factor IIIC, polypeptide 3 OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 4.434e-27
Identity = 174/796 (21.86%), Postives = 323/796 (40.58%), Query Frame = 3
Query:  483 KKKLSDECKGIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHKKASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQITKLAMNHCNTINIRE--KLAELLEKGGYEKEAMK--RKLTNFEMSASEKNPTVISDIVEELFYLSEKFYVRKDVKRSCKCLEIVNMKYPTLVTDEQRFSLLKQMFAVNRYH-----GILDVVK------NIKGVEIDLNYPSNLLSFTTEISYDNRRQIIYYALFASIHLEMTVFIE-SPRFILFMKDIMDKSDWYLNICLKLYAMKHYKISLNLLENP--GDMVDKLASLKLFGKCQEALGFDNDALCTYDNIINNVTGQDASIWELKANLLYRLKREDDAIQVLGESQKFIYINLPQTNLVSRCKPNKDSIQLLYKLCNLLYKEKRFEDFIKVSWKFLFIDSYEYFQINKVELC----CED-------IAFAKTRISEIQNNIWLGISRTLDANGHCVFATTHLKMGDGSTYDILKKLLDLFVTXXXXXXXXXXXXXQWGLVLTKILNWTQAIRLNLSVIYVSTAIR------NRIKNYRLRR-DISGNMI-------FQELRILKNKYGENIQFWNLF-LIYTYIIGTSNERFVLRNLPVVKNNYPVEMINAGSILI-GSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCLSCPPVGNTDHEKSLNDLSREAAFNLVYIYKGRNQRKTVQHLTQKY 2735
            + KL    +G+ G A + +  G+ ++A   C  II++ PL Y  +  L+ I+  +GD +KA QF   +A  +P + E+W+   + +   + +++AI     A+ + N  N+R   + + L E+ G  K+AM   R++ N         PT   + ++    +++ +Y   D++ S   +E    +YP L T+E   ++  +++  NR H      IL + +       I GV I  + P        +I       +I   +F  +H  +T  +E SP          +  D YL++         Y  +L LL      +  +  A      +C +ALG    A+ +Y  ++        +   L + L  +L   D A+Q L           P+T L       +  ++LL     LL  + R +D++      L +       +N+ ++C    C         +  ++ +IS+I++                     +L +  G    +L +                     W L+L  +    +  R   + + V +++       +R+K   L    +S  ++       +  +R++     E  Q WN+F  +  +     + RF LR +     N+ + ++N  +  + GS K +L    + F      P   L + +T  + A  +   +   L    F F+  Y +LRG+CQE++YN GR   ++     AI  Y+K LSC P      +    DL+RE A+NL  IY+    +  VQHL   Y
Sbjct:  103 RSKLPRALRGLMGEANIRYARGEKEDAITMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKALQFGLIAAHLNPSDYEEWVKLADMSLEQDNIKQAIICYSKAIKY-NPSNVRYLWERSSLYEQVGDHKQAMDGYRRILNL------LPPTDGENFMQLSRDMAKSYYETNDLQSSMGVMEEALNRYPHLATNEC-VNMAAELYITNRQHEKALQNILILFECSLASGEILGVLIPEDVP-------IDIRVKLMICLIQQHVFEPLHPMLTALMEQSPE---------ELGDLYLDVADAFQDEGEYSSALPLLSALVCSERYNLPAVWLRHAECLKALGHMEVAVNSYIKVVEMAPLHLEARLSL-STLQQQLGNPDGALQALQPMYD------PET-LAQDSAAAQQELKLLLHRSILLRSQSRMDDYLDTVLTMLAM--LLKVAMNRAQVCLISRCNSGERHLYLVKVSREKISDIEDQ-----------------EAAYLDVIGGRKTSVLSR------------------DDWWQLLLRCVCVMCEQNRFGEAELLVDSSLEYYSFYDDRVKRKELEYFGLSAAILDHNFRKAYNYIRLMLMDNVERPQLWNIFNQVTMHSQDVRHHRFCLRLMLKNPENHALCVLNGHNAFVSGSFKHALGQYVQTFRAQPTEPLYSLCVGLTFFHMASQKFVVKRHPLLLQGFSFLWRYAELRGHCQESFYNLGRALQQLGLSHLAILYYQKALSCTPPSLEGIDGEQVDLAREIAYNLSLIYQASGNKGMVQHLLHTY 829          
BLAST of General transcription factor 3C polypeptide 3 vs. TrEMBL
Match: A0A2J7PT14 (Uncharacterized protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G02347 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 3.849e-26
Identity = 180/781 (23.05%), Postives = 329/781 (42.13%), Query Frame = 3
Query:  492 LSDECKGIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHKKASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQI-TKLAMNHCNTINIREKLAELLEKGGYEKEAMKRKLTNFEMSASEKNPTVISDIVEELFYLSEKFYVRKDVKRSCKCLEIVNMKYPTLVTDEQRFSLLKQMFAVNRYHGILDVVKNIKGVEIDLNYPSNLLSFTTEISYDNRRQIIYYALFASIHLEMTVFIESPRFILFM---------KDIMDKSDWYLNICLKLYAMKHYKISLNLL------ENPGDMVDKLASLKL-FGKCQEALGFDNDALCTYDNIINNVTGQDASIWELKANLLYRLKREDDAIQVLGESQKFIYINLPQTNLVSRCKPNKDSIQLLYKLCNLLYK-EKRFEDFIKVSWKFLFIDSYEYFQI-NKVELCCEDIAFAKTRISEIQNNIWLGISRTLDANGHCVFATTHLKMGDGSTYDILKKLLDLFV----TXXXXXXXXXXXXXQWGLVLTKILNWTQAIRLNLSVIYVSTAIRNRIK--NYRLRRDISGNMIFQELRILKNKYGENIQFWNLF-LIYTYIIGTSNERFVLRNLPVVKNNYPVEMINAGSILI-GSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRG--NCQETYYNFGRFYHRIKCEERAINCYEKCL--SCPPVGNTDHEKSLNDLSREAAFNLVYIYKGRNQRKTVQHLTQKYLT 2741
            L    +G+ G A L +  G+ + A + C  II++ P     ++ L+ ++   G   K+ QF   +A   P ++E+W+     +E    L++A+   +K      + +    K  ELLE+ G  K A++     ++   S   P   S +V+    L+ KF+   ++ ++ + +++V  K P LVT E    +L+ + +   Y   L+++    G+E++    +  L+ + +         I  +L   +H+++TV +   +    +          D  +  D YL++   L +   ++ +L LL      EN G     LA++ L   +C +A G  + A  +Y+ ++     Q      + + LL  L RE++A+ VL +  +   +           +P      LLY+ C LL   ++R E+F+ V    L   S  + +I N+ EL      +A +R+  ++      +     + G   F T     G G     +++   LF     T        L     +  + +K+   +    L +  + +     N      Y L RD       Q LR +K       + WNLF LI        + RF++R L    N+  + +++A + L+ G+ K +L+  +  F  +   P     L +TL   A  +   +   L + A  FM  Y++ RG    QE +YN GR +H++     AI  Y++ L  + P +    H   L DL REAAFNL  IY         +    KY+ 
Sbjct:  182 LPPALQGLMGEANLRYARGERETAVKMCLEIIRQVPTAPEPFQTLAVLYDELGAPDKSLQFALIAAHLSPYDAEQWIHLAAKSEEQGNLKQAVTCYSKAVAADASNVEAHMKRGELLERIGERKAALR----GYQRLLSLLTPEQGSVVVQVAKMLASKFHKDGELMKAKETMDVVFKKVPHLVTSEHVNLMLELLLSQKEYTHCLEILVQYCGIEVE----AGSLTESADQPLIVLHCTIPESLPVDLHVKLTVVLIHLKAFHMLNMLLEPLEENDPEEAGDLYLDVAEALMSEGRHRDALRLLNPLVKSENYG-----LAAVWLRHAECLKACGQRDRAAASYEVVVQQAP-QHLQARIILSGLLNELGREEEALAVLTQDAESEVL-----------EPG-----LLYEKCMLLKGVQERTEEFLAVGQLLL---SRHFVRIRNRDEL------YALSRLRRLEKKKE-ALREIRTSRGEPQFDTDAPDFGVGKNSPTVEEEWALFREMCDTCYRIGRFALLQRLAFSAMGSKLFYSSPDRALEMEFLCLLACFHNGDAYYGYNLARD-------QLLREMKYP-----RIWNLFNLILQRADDVRHNRFLMRLLARHPNHPALTLLHANNCLVAGTYKYALSEYAATFRSN-PGPLSAFLLGVTLFQMACQKFSAKKHSLVTQALAFMWKYQQYRGEDGYQEVHYNIGRAFHQLGLLPAAIYHYKEALNFTSPLLEKYPH---LLDLKREAAFNLYLIYMSTGAYDIARSYVDKYIV 906          
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Cavefish
Match: gtf3c3 (general transcription factor IIIC, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-040914-80])

HSP 1 Score: 77.0258 bits (188), Expect = 6.268e-14
Identity = 55/197 (27.92%), Postives = 91/197 (46.19%), Query Frame = 3
Query: 2157 LRILKNKYGENIQFWNLF-LIYTYIIGTSNERFVLRNLPVVKNNYPVEMINAGSILI-GSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCLSCPPVGNTDHEKSLNDLSREAAFNLVYIYKGRNQRKTVQHLTQKYLT 2741
            +R++     E  Q WN+F  +        + RF LR +     N+ + ++N  + L+ G+ K +L    + F     NP   L + +T  + A  +   +   L    F F+  Y  LRG+CQE+ YN GR  H++     AI+ Y+K LS PP+     ++   DL RE A+NL  I      ++  ++    Y T
Sbjct:  638 IRLMLMNSVERDQLWNVFNQVTLQSQDVRHHRFCLRLMLKNPENHALCLLNGHTSLVSGTFKHALGQYMQAFKNQPCNPLHSLCVGLTFFHMASQKFVVKRHPLVLQGFSFLWRYVDLRGHCQESLYNVGRALHQLGLTHLAIHYYQKALSFPPLKLEGTDEDQVDLRREIAYNLSLICHASGNKEMARYYIYTYCT 834          

HSP 2 Score: 60.8474 bits (146), Expect = 5.819e-9
Identity = 47/194 (24.23%), Postives = 94/194 (48.45%), Query Frame = 3
Query:  483 KKKLSDECKGIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHKKASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQITKLAMNHCNTINIRE--KLAELLEKGGYEKEAM---KRKLTNFEMSASEKNPTVISDIVEELFYLSEKFYVRKDVKRSCKCLEIVNMKYPTLVTDE 1049
            + KL    +G+ G A + +  G  ++A   C  II++ PL Y  +  L+ I+  +GD +KA QF   +A  +P + E+W+   + +   + +++AI     A+ + N  N+R   + + L E+ G  K+AM   +R L+    +  E    +  D       +++ +Y   ++  +   +E    ++P LV+ E
Sbjct:  122 RSKLPRALRGLMGEANIRYARGDKEDAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKALQFGLIAAHLNPSDCEEWVKLADMSLEQDNIKQAIICYTKAIKY-NQSNVRYLWERSSLYEQVGEHKQAMDGYRRILSLLPPTDGEHFMQLSRD-------MAKSYYESNELASAIGVMEEALERHPELVSHE 307          
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Sea Lamprey
Match: gtf3c3 (general transcription factor IIIC, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-040914-80])

HSP 1 Score: 90.1225 bits (222), Expect = 1.418e-18
Identity = 56/184 (30.43%), Postives = 90/184 (48.91%), Query Frame = 3
Query: 2193 QFWNLF-LIYTYIIGTSNERFVLRNLPVVKNNYPVEMINAGSILI-GSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCLSCPPVGNTDHEKSLNDLSREAAFNLVYIYKGRNQRKTVQHLTQKYL 2738
            Q WN+F  I        + RF LR L    +N P+ ++N  +  + GS K +L    + +  + + P  CL + +T ++ A  +   +   L    F F+  Y +LRG+ QE+YYN GR  H++     AI+ Y++ L+CPP      +    DL REAA+NL  IY+        +    KY+
Sbjct:  684 QLWNIFNQITANSQDIRHHRFCLRLLLKNPDNLPLCILNGHNAFVAGSFKHALGQYVQAYRTNTKEPMFCLCIGLTFVHMASQKFANKRHPLIIQGFSFLMQYLELRGHGQESYYNVGRALHQLGLTHLAIHYYQQTLACPPPQCQGMDPQQLDLRREAAYNLSLIYQSSGNPDMARATIHKYI 867          
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Sea Lamprey
Match: gtf3c3 (general transcription factor IIIC, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-040914-80])

HSP 1 Score: 89.7373 bits (221), Expect = 1.706e-18
Identity = 56/184 (30.43%), Postives = 90/184 (48.91%), Query Frame = 3
Query: 2193 QFWNLF-LIYTYIIGTSNERFVLRNLPVVKNNYPVEMINAGSILI-GSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCLSCPPVGNTDHEKSLNDLSREAAFNLVYIYKGRNQRKTVQHLTQKYL 2738
            Q WN+F  I        + RF LR L    +N P+ ++N  +  + GS K +L    + +  + + P  CL + +T ++ A  +   +   L    F F+  Y +LRG+ QE+YYN GR  H++     AI+ Y++ L+CPP      +    DL REAA+NL  IY+        +    KY+
Sbjct:  700 QLWNIFNQITANSQDIRHHRFCLRLLLKNPDNLPLCILNGHNAFVAGSFKHALGQYVQAYRTNTKEPMFCLCIGLTFVHMASQKFANKRHPLIIQGFSFLMQYLELRGHGQESYYNVGRALHQLGLTHLAIHYYQQTLACPPPQCQGMDPQQLDLRREAAYNLSLIYQSSGNPDMARATIHKYI 883          
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Nematostella
Match: EDO31296 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYA9])

HSP 1 Score: 75.485 bits (184), Expect = 6.437e-14
Identity = 57/203 (28.08%), Postives = 95/203 (46.80%), Query Frame = 3
Query: 2166 LKNKYGENIQFWNLFLIYTYIIGTSNE----RFVLRNLPVVKNNYPVEMINA-GSILIGSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCLSCP---PVGNTDHEKSLN---DLSREAAFNLVYIYKGRNQRKTVQHLTQKYLT 2741
            L+    EN Q + L+ +   ++G S +    R+ LR L    +  P+ ++N   S   GS K ++A   + F +   +P + L + I  I+ A  R   +   +    F FM  Y  LRG  QE+YYN GR +H++     A++ Y+  L  P      +T  +  ++   DL REAA+NL  IY+        + +  KY+ 
Sbjct:  550 LRQVVAENPQSFLLWNMLGRVVGHSQDSRHHRYCLRMLIKYPDLLPLVVVNGHNSFTAGSFKFAIAEYIRAFRQCPSDPLISLCMGIQYIHLACQRFPHKRNSVVIQGFMFMYQYMCLRGKGQESYYNIGRAFHQLGLNHFAVHYYKLALDSPYHNGSPDTSQQPQVSECYDLHREAAYNLSLIYRASGNTDLARQIISKYIV 752          
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Medaka
Match: gtf3c3 (general transcription factor IIIC subunit 3 [Source:NCBI gene;Acc:101166411])

HSP 1 Score: 77.7962 bits (190), Expect = 4.395e-14
Identity = 56/187 (29.95%), Postives = 86/187 (45.99%), Query Frame = 3
Query: 2193 QFWNLFLIYTYIIGTSNER---FVLRNLPVVKNNYPVEMINAGSILI-GSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCLSCPPVGNTDHEKSLNDLSREAAFNLVYIYKGRNQRKTVQHLTQKYLT 2741
            Q WN+F   T  I + ++R   F LR L    NN+ + ++   + ++ GS K +L    + F  H +NP   L + +T  + A  +   +   L    F F+  Y +LRG  QE+ YN GR  H++     AI+ Y+K L  P    +       DL RE AFNL  IY+        + L   + T
Sbjct:  758 QLWNIFNQLT--INSQHQRHHRFCLRLLLKYPNNHALCVLCGHNAMVSGSFKHALGQYVQAFQTHPDNPLYSLCVGLTFFHMASQKYVAKRHALVLQGFSFLWRYVELRGESQESMYNLGRALHQMGLTHLAIHYYQKALELPAKTLSGIADDQVDLRREIAFNLSLIYQASGNMAVARQLIYTHCT 942          

HSP 2 Score: 60.4622 bits (145), Expect = 9.586e-9
Identity = 51/214 (23.83%), Postives = 100/214 (46.73%), Query Frame = 3
Query:  471 RHVSKKKLSDECKGIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHKKASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQITKLAMNHCNTINIRE--KLAELLEKGGYEKEAM---KRKLTNFEMSASEKNPTVISDIVEELFYLSEKFYVRKDVKRSCKCLEIVNMKYPTLVTDEQRFSLLKQMFAVNRYH 1097
            RH SK  L    +G+ G A + +  G+ D A + C  II++ PL Y  +  L+ I+   GD  K+ QF   +A  +P + E+W+   E +     + +AI     A+ + +  N+R   + + L  + G  K+ M   +R L+   +   E    +  D       +++ +Y   D+  +   +E    ++P+LV D+   ++  +++  +R H
Sbjct:  177 RHGSK--LPTALRGLMGEANIRYARGEKDTAVQMCMEIIRQAPLAYEPFSTLAMIYEDEGDTDKSLQFSLIAAHLNPSDCEEWIRLAEMSLEQNNIRQAIICYSKAIKY-DPTNVRYLWERSSLHMRLGEHKQCMDGYRRILSLLPLEDGEHFMQLSKD-------MAKSYYESNDLPSALSVIEEGLSRHPSLVGDD-FVNMAAELYISSRQH 379          
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Medaka
Match: gtf3c3 (general transcription factor IIIC subunit 3 [Source:NCBI gene;Acc:101166411])

HSP 1 Score: 59.6918 bits (143), Expect = 1.710e-8
Identity = 51/216 (23.61%), Postives = 100/216 (46.30%), Query Frame = 3
Query:  465 NERHVSKKKLSDECKGIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHKKASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQITKLAMNHCNTINIRE--KLAELLEKGGYEKEAM---KRKLTNFEMSASEKNPTVISDIVEELFYLSEKFYVRKDVKRSCKCLEIVNMKYPTLVTDEQRFSLLKQMFAVNRYH 1097
              RH SK  L    +G+ G A + +  G+ D A + C  II++ PL Y  +  L+ I+   GD  K+ QF   +A  +P + E+W+   E +     + +AI     A+ + +  N+R   + + L  + G  K+ M   +R L+   +   E    +  D       +++ +Y   D+  +   +E    ++P+LV D+   ++  +++  +R H
Sbjct:  162 GRRHGSK--LPTALRGLMGEANIRYARGEKDTAVQMCMEIIRQAPLAYEPFSTLAMIYEDEGDTDKSLQFSLIAAHLNPSDCEEWIRLAEMSLEQNNIRQAIICYSKAIKY-DPTNVRYLWERSSLHMRLGEHKQCMDGYRRILSLLPLEDGEHFMQLSKD-------MAKSYYESNDLPSALSVIEEGLSRHPSLVGDD-FVNMAAELYISSRQH 366          
BLAST of General transcription factor 3C polypeptide 3 vs. Planmine SMEST
Match: SMESG000042638.1 (SMESG000042638.1)

HSP 1 Score: 1741.47 bits (4509), Expect = 0.000e+0
Identity = 894/894 (100.00%), Postives = 894/894 (100.00%), Query Frame = 3
Query:   60 MATPAKRFKMXXXXXXXXXXNNLGRRMLRSSTARKSKELCKKLLNTVNKSNSDSEDYEVSEYDSDVDPEFKYSDESENEDGXXXXXXXXXXXXXXXXXXXXXITEFDETFDMLERMYNNEILVSKECSFKTAESFNERHVSKKKLSDECKGIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHKKASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQITKLAMNHCNTINIREKLAELLEKGGYEKEAMKRKLTNFEMSASEKNPTVISDIVEELFYLSEKFYVRKDVKRSCKCLEIVNMKYPTLVTDEQRFSLLKQMFAVNRYHGILDVVKNIKGVEIDLNYPSNLLSFTTEISYDNRRQIIYYALFASIHLEMTVFIESPRFILFMKDIMDKSDWYLNICLKLYAMKHYKISLNLLENPGDMVDKLASLKLFGKCQEALGFDNDALCTYDNIINNVTGQDASIWELKANLLYRLKREDDAIQVLGESQKFIYINLPQTNLVSRCKPNKDSIQLLYKLCNLLYKEKRFEDFIKVSWKFLFIDSYEYFQINKVELCCEDIAFAKTRISEIQNNIWLGISRTLDANGHCVFATTHLKMGDGSTYDILKKLLDLFVTXXXXXXXXXXXXXQWGLVLTKILNWTQAIRLNLSVIYVSTAIRNRIKNYRLRRDISGNMIFQELRILKNKYGENIQFWNLFLIYTYIIGTSNERFVLRNLPVVKNNYPVEMINAGSILIGSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCLSCPPVGNTDHEKSLNDLSREAAFNLVYIYKGRNQRKTVQHLTQKYLT 2741
            MATPAKRFKMSSTSSDDESSNNLGRRMLRSSTARKSKELCKKLLNTVNKSNSDSEDYEVSEYDSDVDPEFKYSDESENEDGEERAENASANSSCSEESVISNITEFDETFDMLERMYNNEILVSKECSFKTAESFNERHVSKKKLSDECKGIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHKKASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQITKLAMNHCNTINIREKLAELLEKGGYEKEAMKRKLTNFEMSASEKNPTVISDIVEELFYLSEKFYVRKDVKRSCKCLEIVNMKYPTLVTDEQRFSLLKQMFAVNRYHGILDVVKNIKGVEIDLNYPSNLLSFTTEISYDNRRQIIYYALFASIHLEMTVFIESPRFILFMKDIMDKSDWYLNICLKLYAMKHYKISLNLLENPGDMVDKLASLKLFGKCQEALGFDNDALCTYDNIINNVTGQDASIWELKANLLYRLKREDDAIQVLGESQKFIYINLPQTNLVSRCKPNKDSIQLLYKLCNLLYKEKRFEDFIKVSWKFLFIDSYEYFQINKVELCCEDIAFAKTRISEIQNNIWLGISRTLDANGHCVFATTHLKMGDGSTYDILKKLLDLFVTSEEDYSELLELLSQWGLVLTKILNWTQAIRLNLSVIYVSTAIRNRIKNYRLRRDISGNMIFQELRILKNKYGENIQFWNLFLIYTYIIGTSNERFVLRNLPVVKNNYPVEMINAGSILIGSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCLSCPPVGNTDHEKSLNDLSREAAFNLVYIYKGRNQRKTVQHLTQKYLT
Sbjct:    1 MATPAKRFKMSSTSSDDESSNNLGRRMLRSSTARKSKELCKKLLNTVNKSNSDSEDYEVSEYDSDVDPEFKYSDESENEDGEERAENASANSSCSEESVISNITEFDETFDMLERMYNNEILVSKECSFKTAESFNERHVSKKKLSDECKGIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHKKASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQITKLAMNHCNTINIREKLAELLEKGGYEKEAMKRKLTNFEMSASEKNPTVISDIVEELFYLSEKFYVRKDVKRSCKCLEIVNMKYPTLVTDEQRFSLLKQMFAVNRYHGILDVVKNIKGVEIDLNYPSNLLSFTTEISYDNRRQIIYYALFASIHLEMTVFIESPRFILFMKDIMDKSDWYLNICLKLYAMKHYKISLNLLENPGDMVDKLASLKLFGKCQEALGFDNDALCTYDNIINNVTGQDASIWELKANLLYRLKREDDAIQVLGESQKFIYINLPQTNLVSRCKPNKDSIQLLYKLCNLLYKEKRFEDFIKVSWKFLFIDSYEYFQINKVELCCEDIAFAKTRISEIQNNIWLGISRTLDANGHCVFATTHLKMGDGSTYDILKKLLDLFVTSEEDYSELLELLSQWGLVLTKILNWTQAIRLNLSVIYVSTAIRNRIKNYRLRRDISGNMIFQELRILKNKYGENIQFWNLFLIYTYIIGTSNERFVLRNLPVVKNNYPVEMINAGSILIGSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCLSCPPVGNTDHEKSLNDLSREAAFNLVYIYKGRNQRKTVQHLTQKYLT 894          
BLAST of General transcription factor 3C polypeptide 3 vs. Planmine SMEST
Match: SMESG000042638.1 (SMESG000042638.1)

HSP 1 Score: 1724.91 bits (4466), Expect = 0.000e+0
Identity = 874/874 (100.00%), Postives = 874/874 (100.00%), Query Frame = 3
Query:  120 NNLGRRMLRSSTARKSKELCKKLLNTVNKSNSDSEDYEVSEYDSDVDPEFKYSDESENEDGXXXXXXXXXXXXXXXXXXXXXITEFDETFDMLERMYNNEILVSKECSFKTAESFNERHVSKKKLSDECKGIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHKKASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQITKLAMNHCNTINIREKLAELLEKGGYEKEAMKRKLTNFEMSASEKNPTVISDIVEELFYLSEKFYVRKDVKRSCKCLEIVNMKYPTLVTDEQRFSLLKQMFAVNRYHGILDVVKNIKGVEIDLNYPSNLLSFTTEISYDNRRQIIYYALFASIHLEMTVFIESPRFILFMKDIMDKSDWYLNICLKLYAMKHYKISLNLLENPGDMVDKLASLKLFGKCQEALGFDNDALCTYDNIINNVTGQDASIWELKANLLYRLKREDDAIQVLGESQKFIYINLPQTNLVSRCKPNKDSIQLLYKLCNLLYKEKRFEDFIKVSWKFLFIDSYEYFQINKVELCCEDIAFAKTRISEIQNNIWLGISRTLDANGHCVFATTHLKMGDGSTYDILKKLLDLFVTXXXXXXXXXXXXXQWGLVLTKILNWTQAIRLNLSVIYVSTAIRNRIKNYRLRRDISGNMIFQELRILKNKYGENIQFWNLFLIYTYIIGTSNERFVLRNLPVVKNNYPVEMINAGSILIGSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCLSCPPVGNTDHEKSLNDLSREAAFNLVYIYKGRNQRKTVQHLTQKYLT 2741
            NNLGRRMLRSSTARKSKELCKKLLNTVNKSNSDSEDYEVSEYDSDVDPEFKYSDESENEDGEERAENASANSSCSEESVISNITEFDETFDMLERMYNNEILVSKECSFKTAESFNERHVSKKKLSDECKGIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHKKASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQITKLAMNHCNTINIREKLAELLEKGGYEKEAMKRKLTNFEMSASEKNPTVISDIVEELFYLSEKFYVRKDVKRSCKCLEIVNMKYPTLVTDEQRFSLLKQMFAVNRYHGILDVVKNIKGVEIDLNYPSNLLSFTTEISYDNRRQIIYYALFASIHLEMTVFIESPRFILFMKDIMDKSDWYLNICLKLYAMKHYKISLNLLENPGDMVDKLASLKLFGKCQEALGFDNDALCTYDNIINNVTGQDASIWELKANLLYRLKREDDAIQVLGESQKFIYINLPQTNLVSRCKPNKDSIQLLYKLCNLLYKEKRFEDFIKVSWKFLFIDSYEYFQINKVELCCEDIAFAKTRISEIQNNIWLGISRTLDANGHCVFATTHLKMGDGSTYDILKKLLDLFVTSEEDYSELLELLSQWGLVLTKILNWTQAIRLNLSVIYVSTAIRNRIKNYRLRRDISGNMIFQELRILKNKYGENIQFWNLFLIYTYIIGTSNERFVLRNLPVVKNNYPVEMINAGSILIGSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCLSCPPVGNTDHEKSLNDLSREAAFNLVYIYKGRNQRKTVQHLTQKYLT
Sbjct:   12 NNLGRRMLRSSTARKSKELCKKLLNTVNKSNSDSEDYEVSEYDSDVDPEFKYSDESENEDGEERAENASANSSCSEESVISNITEFDETFDMLERMYNNEILVSKECSFKTAESFNERHVSKKKLSDECKGIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHKKASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQITKLAMNHCNTINIREKLAELLEKGGYEKEAMKRKLTNFEMSASEKNPTVISDIVEELFYLSEKFYVRKDVKRSCKCLEIVNMKYPTLVTDEQRFSLLKQMFAVNRYHGILDVVKNIKGVEIDLNYPSNLLSFTTEISYDNRRQIIYYALFASIHLEMTVFIESPRFILFMKDIMDKSDWYLNICLKLYAMKHYKISLNLLENPGDMVDKLASLKLFGKCQEALGFDNDALCTYDNIINNVTGQDASIWELKANLLYRLKREDDAIQVLGESQKFIYINLPQTNLVSRCKPNKDSIQLLYKLCNLLYKEKRFEDFIKVSWKFLFIDSYEYFQINKVELCCEDIAFAKTRISEIQNNIWLGISRTLDANGHCVFATTHLKMGDGSTYDILKKLLDLFVTSEEDYSELLELLSQWGLVLTKILNWTQAIRLNLSVIYVSTAIRNRIKNYRLRRDISGNMIFQELRILKNKYGENIQFWNLFLIYTYIIGTSNERFVLRNLPVVKNNYPVEMINAGSILIGSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWKLTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCLSCPPVGNTDHEKSLNDLSREAAFNLVYIYKGRNQRKTVQHLTQKYLT 885          
The following BLAST results are available for this feature:
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
GTF3C31.351e-1528.72general transcription factor IIIC subunit 3 [Sourc... [more]
GTF3C37.347e-1024.66general transcription factor IIIC subunit 3 [Sourc... [more]
GTF3C39.806e-1021.85general transcription factor IIIC subunit 3 [Sourc... [more]
back to top
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tftc-32.490e-1125.14Transcription Factor ThreeC subunit (GTF3C homolog... [more]
back to top
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG89503.829e-727.36gene:FBgn0034186 transcript:FBtr0306810[more]
CG89503.829e-727.36gene:FBgn0034186 transcript:FBtr0087013[more]
back to top
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gtf3c32.431e-1929.95general transcription factor IIIC, polypeptide 3 [... [more]
back to top
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
GTF3C32.614e-2922.58general transcription factor IIIC subunit 3 [Sourc... [more]
back to top
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Gtf3c35.782e-1628.96general transcription factor IIIC, polypeptide 3 [... [more]
back to top
BLAST of General transcription factor 3C polypeptide 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q9Y5Q9|TF3C3_HUMAN6.489e-1528.72General transcription factor 3C polypeptide 3 OS=H... [more]
back to top
BLAST of General transcription factor 3C polypeptide 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4F5L58.113e-3922.55O-linked n-acetylglucosamine transferase, ogt,puta... [more]
C3XQ249.277e-3223.18Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A553NDZ52.046e-2724.29Uncharacterized protein OS=Tigriopus californicus ... [more]
A0A3B3RHU64.434e-2721.86General transcription factor IIIC, polypeptide 3 O... [more]
A0A2J7PT143.849e-2623.05Uncharacterized protein OS=Cryptotermes secundus O... [more]
back to top
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gtf3c36.268e-1427.92general transcription factor IIIC, polypeptide 3 [... [more]
back to top
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gtf3c31.418e-1830.43general transcription factor IIIC, polypeptide 3 [... [more]
gtf3c31.706e-1830.43general transcription factor IIIC, polypeptide 3 [... [more]
back to top
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO312966.437e-1428.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of General transcription factor 3C polypeptide 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gtf3c34.395e-1429.95general transcription factor IIIC subunit 3 [Sourc... [more]
gtf3c31.710e-823.61general transcription factor IIIC subunit 3 [Sourc... [more]
back to top
BLAST of General transcription factor 3C polypeptide 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000042638.10.000e+0100.00SMESG000042638.1[more]
SMESG000042638.10.000e+0100.00SMESG000042638.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004151 ID=SMED30004151|Name=General transcription factor 3C polypeptide 3|organism=Schmidtea mediterranea sexual|type=transcript|length=3017bp
TAAATAACTGAATAACCTAATTAAATATATTTTAATATTTTAAAAATTCT
TACTCCTGTATGGCAACACCTGCAAAGCGATTCAAAATGTCTAGCACATC
TTCTGATGATGAAAGCTCTAATAATTTAGGTAGAAGAATGTTAAGAAGCA
GTACAGCTCGAAAATCTAAAGAATTATGCAAGAAATTGCTTAATACTGTA
AACAAAAGTAATAGTGACTCTGAAGATTATGAAGTTTCTGAGTATGATTC
AGACGTAGATCCAGAATTTAAGTATTCAGATGAATCTGAAAATGAAGATG
GCGAAGAAAGAGCTGAAAACGCGAGTGCAAATTCCAGTTGTAGCGAAGAA
TCAGTTATTTCAAATATTACAGAATTTGATGAAACCTTCGATATGCTTGA
AAGAATGTATAATAACGAAATACTAGTATCGAAAGAATGCAGCTTTAAAA
CCGCAGAAAGTTTTAATGAAAGACACGTGTCTAAAAAAAAACTCTCAGAT
GAATGTAAAGGTATATATGGAGCTGCCGAGCTAAATTTCTGGGAAGGAAA
ATATGACGAAGCTCAAGAACAATGTGCAAGAATTATTAAAGAGTTCCCAC
TTCATTATGGGGCGTATGAAATATTAAGTCGGATTCACGTTGCAAGAGGT
GACCATAAGAAAGCCAGCCAATTTTTTTTTACATCGGCAATGTGTGACCC
AAAAAATTCTGAGAAATGGCTTCTTTGCATAGAAAACACTGAAGGTCTAG
AAGGATTAGAAAAAGCCATTCAAATAACTAAATTGGCAATGAATCATTGT
AATACAATAAATATCAGAGAAAAATTGGCAGAATTGCTTGAAAAGGGTGG
TTATGAGAAAGAAGCAATGAAAAGAAAACTCACAAATTTTGAAATGTCTG
CTAGTGAAAAGAATCCAACCGTCATTAGCGATATTGTTGAAGAGTTATTT
TATTTGTCGGAAAAGTTTTATGTACGTAAAGACGTAAAGCGATCGTGCAA
ATGTTTGGAAATAGTAAATATGAAATATCCAACTCTAGTCACAGATGAGC
AGAGATTTAGTCTACTCAAGCAAATGTTCGCAGTGAATAGATATCATGGT
ATCTTAGATGTAGTGAAAAATATCAAGGGAGTCGAAATCGACTTGAATTA
TCCGTCAAATCTGTTGTCTTTTACCACAGAAATTTCATACGACAATCGAA
GACAGATAATTTACTATGCACTCTTTGCTTCGATCCATTTAGAAATGACT
GTATTTATCGAGAGCCCAAGATTTATTTTATTTATGAAAGATATCATGGA
TAAATCCGATTGGTATTTGAATATTTGTCTTAAGCTCTATGCCATGAAAC
ATTATAAAATTTCATTAAATCTTCTAGAGAATCCTGGAGATATGGTCGAT
AAATTAGCCTCATTAAAACTATTTGGCAAATGCCAAGAAGCTTTGGGTTT
CGATAATGATGCATTGTGTACATACGATAATATCATAAACAATGTGACTG
GGCAGGATGCGTCTATTTGGGAATTGAAAGCAAATTTGCTGTATAGATTA
AAGCGAGAAGATGATGCAATTCAAGTTTTGGGTGAAAGCCAAAAATTTAT
ATACATTAATCTTCCTCAAACCAATCTTGTCAGTCGATGTAAACCCAATA
AGGATAGTATTCAGTTGCTCTATAAACTCTGTAATTTACTCTACAAAGAA
AAACGATTTGAAGACTTTATTAAAGTCTCATGGAAGTTTCTTTTCATTGA
TTCGTATGAATATTTCCAAATAAACAAAGTTGAACTGTGTTGCGAAGACA
TAGCATTTGCTAAAACGAGAATTTCCGAAATTCAAAACAATATCTGGCTT
GGTATTTCAAGAACTCTCGATGCTAATGGCCATTGTGTCTTTGCTACGAC
TCATTTGAAAATGGGTGACGGCTCGACATATGACATATTGAAAAAGTTAT
TGGATCTGTTTGTAACATCAGAAGAAGATTATTCCGAGTTACTTGAGCTG
TTGTCCCAATGGGGATTAGTTTTAACGAAAATTCTCAACTGGACACAGGC
TATCCGATTGAACCTATCTGTCATCTATGTGTCGACGGCTATAAGAAATC
GAATAAAAAACTATCGGTTAAGACGAGATATTTCCGGAAATATGATTTTT
CAAGAGTTGAGAATTCTGAAAAATAAATATGGAGAGAATATTCAATTTTG
GAACCTATTCCTGATTTATACATATATCATTGGCACCAGCAACGAGAGAT
TTGTCCTTCGGAATTTACCAGTAGTTAAAAACAATTATCCAGTGGAAATG
ATCAATGCAGGTTCTATTCTAATCGGTAGTGCTAAATTGAGTTTGGCTAT
CAATAGTAAACTATTCGATGAACACTGTGAAAATCCTCAGTTATGTCTGC
ATTTATCAATAACGCTAATTAATTCAGCGTTATCAAGGAATTGTCGACAA
AGCTGGAAATTAACATCTTTGGCTTTTGAATTTATGAAACTCTATAAGAA
ATTACGAGGAAATTGTCAAGAAACTTATTATAACTTCGGCAGGTTCTATC
ACAGGATAAAGTGTGAAGAACGTGCTATAAATTGCTATGAAAAATGTTTA
TCTTGTCCTCCAGTTGGAAACACAGATCATGAGAAATCACTGAACGATCT
GTCACGCGAAGCTGCTTTTAATTTGGTCTATATATATAAAGGAAGAAACC
AAAGGAAAACAGTGCAACATCTGACCCAAAAATATTTAACAATATAATAT
TGATTGATATTCTTATTTTCAGATTTGTTTTTAATTTTCTTTCACTGTAA
AATATAAATTTCCATCTTATATCTTTTCAAATTTTTATTGGCTTCTGTGG
AGCATGCTTGCTACACCCATTCGAATCGCCCAAAAGGTTAGCGCGTTTCC
TTGACAACATGTATCGTTTTTATTAATATGTTGGGAAAAGTGAATCGCGT
TGCCATGACTACAAAATATCACTATATATATCCAATATCATTATTCTTAT
TACGGTTTGTGTCGGAT
back to top

protein sequence of SMED30004151-orf-1

>SMED30004151-orf-1 ID=SMED30004151-orf-1|Name=SMED30004151-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=896bp
MATPAKRFKMSSTSSDDESSNNLGRRMLRSSTARKSKELCKKLLNTVNKS
NSDSEDYEVSEYDSDVDPEFKYSDESENEDGEERAENASANSSCSEESVI
SNITEFDETFDMLERMYNNEILVSKECSFKTAESFNERHVSKKKLSDECK
GIYGAAELNFWEGKYDEAQEQCARIIKEFPLHYGAYEILSRIHVARGDHK
KASQFFFTSAMCDPKNSEKWLLCIENTEGLEGLEKAIQITKLAMNHCNTI
NIREKLAELLEKGGYEKEAMKRKLTNFEMSASEKNPTVISDIVEELFYLS
EKFYVRKDVKRSCKCLEIVNMKYPTLVTDEQRFSLLKQMFAVNRYHGILD
VVKNIKGVEIDLNYPSNLLSFTTEISYDNRRQIIYYALFASIHLEMTVFI
ESPRFILFMKDIMDKSDWYLNICLKLYAMKHYKISLNLLENPGDMVDKLA
SLKLFGKCQEALGFDNDALCTYDNIINNVTGQDASIWELKANLLYRLKRE
DDAIQVLGESQKFIYINLPQTNLVSRCKPNKDSIQLLYKLCNLLYKEKRF
EDFIKVSWKFLFIDSYEYFQINKVELCCEDIAFAKTRISEIQNNIWLGIS
RTLDANGHCVFATTHLKMGDGSTYDILKKLLDLFVTSEEDYSELLELLSQ
WGLVLTKILNWTQAIRLNLSVIYVSTAIRNRIKNYRLRRDISGNMIFQEL
RILKNKYGENIQFWNLFLIYTYIIGTSNERFVLRNLPVVKNNYPVEMINA
GSILIGSAKLSLAINSKLFDEHCENPQLCLHLSITLINSALSRNCRQSWK
LTSLAFEFMKLYKKLRGNCQETYYNFGRFYHRIKCEERAINCYEKCLSCP
PVGNTDHEKSLNDLSREAAFNLVYIYKGRNQRKTVQHLTQKYLTI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR039340Tfc4/TFIIIC-102/Sfc4
IPR011990TPR-like_helical_dom_sf
IPR013026TPR-contain_dom
IPR019734TPR_repeat
Vocabulary: molecular function
TermDefinition
GO:0001004transcription factor activity, RNA polymerase III promoter sequence-specific binding, TFIIIB recruiting
GO:0005515protein binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0000127transcription factor TFIIIC complex
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005730nucleolus
GO:0031965nuclear membrane
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006359regulation of transcription from RNA polymerase III promoter
GO:0006383transcription from RNA polymerase III promoter
GO:00427915S class rRNA transcription from RNA polymerase III type 1 promoter
GO:0042797tRNA transcription from RNA polymerase III promoter
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 158..178
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..34
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 49..93
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..29
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 407..672
e-value: 1.6E-6
score: 29.0
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 14..282
e-value: 2.2E-8
score: 35.7
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 153..271
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 449..850
IPR039340Transcription factor Tfc4/TFIIIC-102/Sfc4PANTHERPTHR23082TRANSCRIPTION INITIATION FACTOR IIIC TFIIIC , POLYPEPTIDE 3-RELATEDcoord: 47..557
coord: 639..895
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 820..853
score: 8.231
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 183..216
score: 6.874
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 149..216
score: 8.553
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 820..853
score: 7.576