Protein kinase-like domain

Overview
NameProtein kinase-like domain
Smed IDSMED30004149
Length (bp)2685
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase-like domain (SMED30004149) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase-like domain (SMED30004149) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase-like domain (SMED30004149) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase-like domain (SMED30004149) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004149

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30004149SMESG000016842.1 SmedASXL_006049SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30004149SMESG000016842.1 dd_Smed_v4_6898_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30004149SMESG000016842.1 dd_Smed_v4_6898_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30004149SMESG000016842.1 dd_Smed_v6_6898_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30004149SMESG000016842.1 dd_Smed_v4_6898_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30004149SMESG000016842.1 dd_Smed_v4_6898_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30004149SMESG000016842.1 dd_Smed_v4_6898_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase-like domain vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 290.812 bits (743), Expect = 6.327e-83
Identity = 151/484 (31.20%), Postives = 251/484 (51.86%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            K    +H A   G  EVVK  +++  NINA S+  + P++ A + NHI++VK L+EN  N  + +   + P+  A   GH Q V +L++N+     R       +H A          LL++N  +  V+ K    P+  A   GNV +  LL+N    +D  ++    P+HVA + G+ ++VK+L+     I+A T     P+HCA + GH ++V+LL++ G+ L A  +N   P+H A+    VE +  LL+ K  V+ VT      +H+  H GH    KLL+D + +          PIH A + GH  IV +L+ +  + +V++      LH A   G +++V  L+ N   +DA ++ +  P+H+A R G  EIV++L++     +A T   + P+HI+   G  D+ ++L+ +       T   + PLH+A +YG  D+ KLL+Q+    D   KN Y+P+ IA K N  +I + L+
Sbjct:   59 KGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLL 538          

HSP 2 Score: 256.144 bits (653), Expect = 8.270e-71
Identity = 124/456 (27.19%), Postives = 241/456 (52.85%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            ++ K    + P+H A   G+ +VV+  +E+   + A ++    P+H A + +H+E VK L++++  ++ ++      +H AA  GH ++ KLL+    + NARA      IH A    H++IV LL++N     V +      +  A ++G VE+V  L+ N   +D +++    P+H+A R G  ++V++L+Q+    +A T   + P+H + + G V++  +L++ G+      +  + P+H A+  G +++  LLL+++   ++  +  + P+HI   K  ++    L++Y  +  I T++   P+H A   GH ++V +L+D   NI +S       LH A     +++ ++L ++  D DA +KL + P+ VAC  G++++V  L+++G    A T+  + P+H A   G+  I+N+L+       A T +    L IA R G+  +V  L
Sbjct:  247 IDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 702          

HSP 3 Score: 252.292 bits (643), Expect = 1.704e-69
Identity = 130/506 (25.69%), Postives = 252/506 (49.80%), Query Frame = 1
Query:  202 ACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCK-----------------------------IDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            A   GN++ V  +++   +IN  ++     +H A +  H+ +V+ L+    +++S +      +H A+  G  ++VK+L++   +INA+++  +  ++ A    H+D+VK L+EN  +     ++   P+  A + G+ + V +L+ N+ K                              DV+S+  + P+H+A  +G+++V  +L+     ++        P+H A K G+  +VKLL+  G  +DA   +   P+H A+  G  +++ LLLE+   + A T+    P+H+     H+E VK L+ +K  ++  T      +H A + GHY + ++L+D   N          P+H A   G+L+IV +L++N    D  +      +H+A R+G +E+V+ L+R G   +A    +  P+HIA  +G  +IV LL+    + +A T + + PLHI+ R G  D+  +L++ G    +  K  ++P+ +A KY   ++   L+ 
Sbjct:    1 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQ 506          

HSP 4 Score: 245.743 bits (626), Expect = 2.460e-67
Identity = 129/490 (26.33%), Postives = 239/490 (48.78%), Query Frame = 1
Query:  163 EMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            +++      P+H A   GNV V    + +   ++  +     P+H A +  +  +VKLL++    I++ +     P+H AA  GH Q+V+LL++    + AR +     +H A    HV+ VK L+++   V     +    +  A   G+  + +LL++     + ++     PIHVA   GHL++V +L+QN    +         +H A + G VE+V+ L++NG+ +DA       P+H AS LG  E++ LLL+     +A T   + P+HI   +G ++   +L++      +AT+K   P+H A  YG  ++ ++L+      + +      PLH A     + I + L+    + +  +K    P+H+A + GH ++V +L+ KG      T+     +H+A      ++ ++L     + +A T   + PL +AC YG+  +V  L++QG N +   KN Y+P+  A +  +  I N L+ 
Sbjct:  182 DVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 671          

HSP 5 Score: 241.891 bits (616), Expect = 5.602e-66
Identity = 128/475 (26.95%), Postives = 232/475 (48.84%), Query Frame = 1
Query:  181 NMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
             + P+H A   GN  +VK  +++   I+A +     P+H A  + H ++V+LL+E    + + +     P+H AA   H++ VK L+Q+   ++         +H A    H  + KLL++   +          PI  A   G++ IV LL+ N    DV +      +H+A R G ++VV+ L++N   ++A       P+H A + G  EIV+LL+Q+ +  DA   N + P+H ++  G V++ ++LLE        T+  + P+H+    G L+  KLL+  +   + A +    P+H A      +I   L++      +   +   PLH A   G+ D+V +L++   +I   +K     +H+A +   + +  +L + G   +A+T+  + P+ +AC  GN  +VN L+    N+ A T + + PLH A + GH  I+ +L+Q G   +    N  + + IAK+  Y
Sbjct:  221 GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGY 695          

HSP 6 Score: 234.572 bits (597), Expect = 1.366e-63
Identity = 125/485 (25.77%), Postives = 237/485 (48.87%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            P++ A    +++VVK+ +E   N +  +E  + P+  A +  H + V +L+EN    ++   +    +H AA     +   LL+QN+ + + +++  +  +H A    +V++  LL+     V    +    P+  A K GN  +V+LL++   +ID K++    P+H A R GH  VV++L++    + A T+    P+H A +  HVE VK L+Q+ + +D    +    +H A+  G   +  LLL+K+ +  A       PIH+    GHL  V LL+      ++   +    +H A   G  E+VR L+ +   ++    E   PLH A   G  +IV +L+++    DA +   + P+H++ R G +++  +L+  G      T+  + P+H+A   G+ D+  LL+  R   ++   + + PLHIA +     I   L+  G  T+++ K   +P+ +A +  + ++   L+    N
Sbjct:   96 PLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGAN 576          

HSP 7 Score: 192.2 bits (487), Expect = 1.142e-49
Identity = 120/462 (25.97%), Postives = 217/462 (46.97%), Query Frame = 1
Query:  400 AAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIFL 1785
            AA  G+L  V   ++   DIN   +     +H A    HV +V+ L+     V    K+    +  A  +G  E+V++L+     I+ +SQ  + P+++A +  H+DVVK L++N  +    TE  + P+  A + GH + V +L++N    D  G+     +H A+   D +   LLL+   + +  ++  + P+HI  H G++    LL++    ++        P+H A   G+  +V++L+D    I+    +   PLH A  +G+  +V +L+E    + A +K    P+H+A +  H+E VK L++     +  T      +H+A   G+Y +  LL+  R N  A  +    P+H+A   GH +IV LL+Q G + DV +    + + +A +    E+        C   +  L   ++ E++        T LH     IA  +GK  I ++ L
Sbjct:    1 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEV------VRCLLRNGALVDARAREEQ--------TPLH-----IASRLGKTEIVQLLL 439          
BLAST of Protein kinase-like domain vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 282.722 bits (722), Expect = 5.563e-79
Identity = 156/529 (29.49%), Postives = 262/529 (49.53%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVE---------------------------------LITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILT 1665
            K    +H A   G  EVVK  +++  NINA S+  + P++ A + NHI++VK L+EN  N  + +   + P+  A   GH Q V +L++N+     R       +H A          LL++N  +  V+ K    P+  A   GNV +  LL+N    +D  ++    P+HVA + G+ ++VK+L+     I+A T     P+HCA + GH ++V+LL++ G+ L A  +N   P+H A+    VE                                 +  LLL+K+ +  A     + P+HI C K  ++ ++LL+ Y   I+  TE    PIH A + GH  IV +L+ +  + +V++      LH A   G +++V  L+ N   +DA ++ +  P+H+A R G  EIV++L++     +A T   + P+HI+   G  D+ ++L+ +       T   + PLH+A +YG  D+ KLL+Q+    D   KN Y+P+ IA K N  +I + L++       NI+T
Sbjct:   75 KGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAET--NIVT 597          

HSP 2 Score: 253.062 bits (645), Expect = 3.658e-69
Identity = 130/482 (26.97%), Postives = 244/482 (50.62%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            ++ K    + P+H A   G+ +VV+  +E+   + A ++    P+H A + +H+E VK L++++  ++ ++      +H AA  GH ++ KLL+    + NARA   +  +H AC    + +++LL++    +    +    PI  A   G++ IV LL+ N    DV +      +H+A R G ++VV+ L++N   ++A       P+H A + G  EIV+LL+Q+ +  DA   N + P+H ++  G V++ ++LLE        T+  + P+H+    G L+  KLL+  +   + A +    P+H A      +I   L++      +   +   PLH A   G+ D+V +L++   +I   +K     +H+A +   + +  +L + G   +A+T+  + P+ +AC  GN  +VN L+    N+ A T + + PLH A + GH  I+ +L+Q G   +    N  + + IAK+  Y
Sbjct:  263 IDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGY 744          

HSP 3 Score: 247.284 bits (630), Expect = 2.720e-67
Identity = 130/484 (26.86%), Postives = 237/484 (48.97%), Query Frame = 1
Query:  181 NMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
             + P+H A   GN  +VK  +++   I+A +     P+H A  + H ++V+LL+E    + + +     P+H AA   H++ VK L+Q+   ++         +H A    H  + KLL++   +          P+  ACK   ++++ELL+     I   ++    PIHVA   GHL++V +L+QN    +         +H A + G VE+V+ L++NG+ +DA       P+H AS LG  E++ LLL+     +A T   + P+HI   +G ++   +L++      +AT+K   P+H A  YG  ++ ++L+      + +      PLH A     + I + L+    + +  +K    P+H+A + GH ++V +L+ KG      T+     +H+A      ++ ++L     + +A T   + PL +AC YG+  +V  L++QG N +   KN Y+P+  A +  +  I N L+ 
Sbjct:  237 GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 720          

HSP 4 Score: 237.269 bits (604), Expect = 5.275e-64
Identity = 131/539 (24.30%), Postives = 252/539 (46.75%), Query Frame = 1
Query:  202 ACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCK-----------------------------IDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHV---------------------------------ACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            A   GN++ V  +++   +IN  ++     +H A +  H+ +V+ L+    +++S +      +H A+  G  ++VK+L++   +INA+++  +  ++ A    H+D+VK L+EN  +     ++   P+  A + G+ + V +L+ N+ K                              DV+S+  + P+H+A  +G+++V  +L+     ++        P+H A K G+  +VKLL+  G  +DA   +   P+H A+  G  +++ LLLE+   + A T+    P+H+     H+E VK L+ +K  ++  T      +H A + GHY + ++L+D   N          PLH AC    + ++ +L++    I A ++    PIHV                                 A R+G +E+V+ L+R G   +A    +  P+HIA  +G  +IV LL+    + +A T + + PLHI+ R G  D+  +L++ G    +  K  ++P+ +A KY   ++   L+ 
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQ 555          

HSP 5 Score: 191.43 bits (485), Expect = 3.386e-49
Identity = 104/398 (26.13%), Postives = 198/398 (49.75%), Query Frame = 1
Query:  397 KAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIA 1590
            +AA  G+L  V   ++   DIN   +     +H A    HV +V+ L+     V    K+    +  A  +G  E+V++L+     I+ +SQ  + P+++A +  H+DVVK L++N  +    TE  + P+  A + GH + V +L++N    D  G+     +H A+   D +   LLL+   + +  ++  + P+HI  H G++    LL++    ++        P+H A   G+  +V++L+D    I+    +   PLH A  +G+  +V +L+E    + A +K    P+H+A +  H+E VK L++     +  T      +H+A   G+Y +  LL+  R N  A  ++ + PLHIAC+     +++LL++ G +   + ++  +P+ +A
Sbjct:   16 RAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVA 409          

HSP 6 Score: 56.225 bits (134), Expect = 3.643e-7
Identity = 29/118 (24.58%), Postives = 61/118 (51.69%), Query Frame = 1
Query: 1291 ACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            A R+G+L+ V   ++ G       +     +H+A   G+  +V  L+    ++++ T      LHIA   G A++VK+L+++G N +   +N ++P+ +A + N+ ++   L+    N
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN 134          
BLAST of Protein kinase-like domain vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 282.337 bits (721), Expect = 6.509e-79
Identity = 156/529 (29.49%), Postives = 262/529 (49.53%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVE---------------------------------LITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILT 1665
            K    +H A   G  EVVK  +++  NINA S+  + P++ A + NHI++VK L+EN  N  + +   + P+  A   GH Q V +L++N+     R       +H A          LL++N  +  V+ K    P+  A   GNV +  LL+N    +D  ++    P+HVA + G+ ++VK+L+     I+A T     P+HCA + GH ++V+LL++ G+ L A  +N   P+H A+    VE                                 +  LLL+K+ +  A     + P+HI C K  ++ ++LL+ Y   I+  TE    PIH A + GH  IV +L+ +  + +V++      LH A   G +++V  L+ N   +DA ++ +  P+H+A R G  EIV++L++     +A T   + P+HI+   G  D+ ++L+ +       T   + PLH+A +YG  D+ KLL+Q+    D   KN Y+P+ IA K N  +I + L++       NI+T
Sbjct:   75 KGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAET--NIVT 597          

HSP 2 Score: 253.062 bits (645), Expect = 3.838e-69
Identity = 130/482 (26.97%), Postives = 244/482 (50.62%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            ++ K    + P+H A   G+ +VV+  +E+   + A ++    P+H A + +H+E VK L++++  ++ ++      +H AA  GH ++ KLL+    + NARA   +  +H AC    + +++LL++    +    +    PI  A   G++ IV LL+ N    DV +      +H+A R G ++VV+ L++N   ++A       P+H A + G  EIV+LL+Q+ +  DA   N + P+H ++  G V++ ++LLE        T+  + P+H+    G L+  KLL+  +   + A +    P+H A      +I   L++      +   +   PLH A   G+ D+V +L++   +I   +K     +H+A +   + +  +L + G   +A+T+  + P+ +AC  GN  +VN L+    N+ A T + + PLH A + GH  I+ +L+Q G   +    N  + + IAK+  Y
Sbjct:  263 IDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGY 744          

HSP 3 Score: 247.284 bits (630), Expect = 2.802e-67
Identity = 130/484 (26.86%), Postives = 237/484 (48.97%), Query Frame = 1
Query:  181 NMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
             + P+H A   GN  +VK  +++   I+A +     P+H A  + H ++V+LL+E    + + +     P+H AA   H++ VK L+Q+   ++         +H A    H  + KLL++   +          P+  ACK   ++++ELL+     I   ++    PIHVA   GHL++V +L+QN    +         +H A + G VE+V+ L++NG+ +DA       P+H AS LG  E++ LLL+     +A T   + P+HI   +G ++   +L++      +AT+K   P+H A  YG  ++ ++L+      + +      PLH A     + I + L+    + +  +K    P+H+A + GH ++V +L+ KG      T+     +H+A      ++ ++L     + +A T   + PL +AC YG+  +V  L++QG N +   KN Y+P+  A +  +  I N L+ 
Sbjct:  237 GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 720          

HSP 4 Score: 191.43 bits (485), Expect = 3.371e-49
Identity = 104/398 (26.13%), Postives = 198/398 (49.75%), Query Frame = 1
Query:  397 KAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIA 1590
            +AA  G+L  V   ++   DIN   +     +H A    HV +V+ L+     V    K+    +  A  +G  E+V++L+     I+ +SQ  + P+++A +  H+DVVK L++N  +    TE  + P+  A + GH + V +L++N    D  G+     +H A+   D +   LLL+   + +  ++  + P+HI  H G++    LL++    ++        P+H A   G+  +V++L+D    I+    +   PLH A  +G+  +V +L+E    + A +K    P+H+A +  H+E VK L++     +  T      +H+A   G+Y +  LL+  R N  A  ++ + PLHIAC+     +++LL++ G +   + ++  +P+ +A
Sbjct:   16 RAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVA 409          

HSP 5 Score: 156.377 bits (394), Expect = 4.020e-38
Identity = 85/305 (27.87%), Postives = 157/305 (51.48%), Query Frame = 1
Query:  697 ACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNE 1611
            A R G+LD V   ++   DI    +     +H A K GHV +V+ L+  GS++D+  +     +H AS+ G  E++ +L+++  ++ A ++  + P+++   + H++ VK L++   +   ATE    P+  A   GH + V IL++++   +V        LH A    +     +L++N  + D  SK  + P+H+A   G++ +  +L+ +G   +        P+H+A   GN ++V LL+     I+A T D   PLH A R GH  +V+LL+++G       KN  SP+ +A + ++ E
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKV----RLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVE 317          

HSP 6 Score: 56.225 bits (134), Expect = 3.719e-7
Identity = 29/118 (24.58%), Postives = 61/118 (51.69%), Query Frame = 1
Query: 1291 ACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            A R+G+L+ V   ++ G       +     +H+A   G+  +V  L+    ++++ T      LHIA   G A++VK+L+++G N +   +N ++P+ +A + N+ ++   L+    N
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN 134          
BLAST of Protein kinase-like domain vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 282.337 bits (721), Expect = 6.509e-79
Identity = 156/529 (29.49%), Postives = 262/529 (49.53%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVE---------------------------------LITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILT 1665
            K    +H A   G  EVVK  +++  NINA S+  + P++ A + NHI++VK L+EN  N  + +   + P+  A   GH Q V +L++N+     R       +H A          LL++N  +  V+ K    P+  A   GNV +  LL+N    +D  ++    P+HVA + G+ ++VK+L+     I+A T     P+HCA + GH ++V+LL++ G+ L A  +N   P+H A+    VE                                 +  LLL+K+ +  A     + P+HI C K  ++ ++LL+ Y   I+  TE    PIH A + GH  IV +L+ +  + +V++      LH A   G +++V  L+ N   +DA ++ +  P+H+A R G  EIV++L++     +A T   + P+HI+   G  D+ ++L+ +       T   + PLH+A +YG  D+ KLL+Q+    D   KN Y+P+ IA K N  +I + L++       NI+T
Sbjct:   75 KGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAET--NIVT 597          

HSP 2 Score: 253.062 bits (645), Expect = 3.838e-69
Identity = 130/482 (26.97%), Postives = 244/482 (50.62%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            ++ K    + P+H A   G+ +VV+  +E+   + A ++    P+H A + +H+E VK L++++  ++ ++      +H AA  GH ++ KLL+    + NARA   +  +H AC    + +++LL++    +    +    PI  A   G++ IV LL+ N    DV +      +H+A R G ++VV+ L++N   ++A       P+H A + G  EIV+LL+Q+ +  DA   N + P+H ++  G V++ ++LLE        T+  + P+H+    G L+  KLL+  +   + A +    P+H A      +I   L++      +   +   PLH A   G+ D+V +L++   +I   +K     +H+A +   + +  +L + G   +A+T+  + P+ +AC  GN  +VN L+    N+ A T + + PLH A + GH  I+ +L+Q G   +    N  + + IAK+  Y
Sbjct:  263 IDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGY 744          

HSP 3 Score: 247.284 bits (630), Expect = 2.802e-67
Identity = 130/484 (26.86%), Postives = 237/484 (48.97%), Query Frame = 1
Query:  181 NMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
             + P+H A   GN  +VK  +++   I+A +     P+H A  + H ++V+LL+E    + + +     P+H AA   H++ VK L+Q+   ++         +H A    H  + KLL++   +          P+  ACK   ++++ELL+     I   ++    PIHVA   GHL++V +L+QN    +         +H A + G VE+V+ L++NG+ +DA       P+H AS LG  E++ LLL+     +A T   + P+HI   +G ++   +L++      +AT+K   P+H A  YG  ++ ++L+      + +      PLH A     + I + L+    + +  +K    P+H+A + GH ++V +L+ KG      T+     +H+A      ++ ++L     + +A T   + PL +AC YG+  +V  L++QG N +   KN Y+P+  A +  +  I N L+ 
Sbjct:  237 GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 720          

HSP 4 Score: 191.43 bits (485), Expect = 3.371e-49
Identity = 104/398 (26.13%), Postives = 198/398 (49.75%), Query Frame = 1
Query:  397 KAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIA 1590
            +AA  G+L  V   ++   DIN   +     +H A    HV +V+ L+     V    K+    +  A  +G  E+V++L+     I+ +SQ  + P+++A +  H+DVVK L++N  +    TE  + P+  A + GH + V +L++N    D  G+     +H A+   D +   LLL+   + +  ++  + P+HI  H G++    LL++    ++        P+H A   G+  +V++L+D    I+    +   PLH A  +G+  +V +L+E    + A +K    P+H+A +  H+E VK L++     +  T      +H+A   G+Y +  LL+  R N  A  ++ + PLHIAC+     +++LL++ G +   + ++  +P+ +A
Sbjct:   16 RAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVA 409          

HSP 5 Score: 156.377 bits (394), Expect = 4.020e-38
Identity = 85/305 (27.87%), Postives = 157/305 (51.48%), Query Frame = 1
Query:  697 ACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNE 1611
            A R G+LD V   ++   DI    +     +H A K GHV +V+ L+  GS++D+  +     +H AS+ G  E++ +L+++  ++ A ++  + P+++   + H++ VK L++   +   ATE    P+  A   GH + V IL++++   +V        LH A    +     +L++N  + D  SK  + P+H+A   G++ +  +L+ +G   +        P+H+A   GN ++V LL+     I+A T D   PLH A R GH  +V+LL+++G       KN  SP+ +A + ++ E
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKV----RLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVE 317          

HSP 6 Score: 56.225 bits (134), Expect = 3.719e-7
Identity = 29/118 (24.58%), Postives = 61/118 (51.69%), Query Frame = 1
Query: 1291 ACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            A R+G+L+ V   ++ G       +     +H+A   G+  +V  L+    ++++ T      LHIA   G A++VK+L+++G N +   +N ++P+ +A + N+ ++   L+    N
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN 134          
BLAST of Protein kinase-like domain vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 275.404 bits (703), Expect = 1.580e-76
Identity = 155/532 (29.14%), Postives = 261/532 (49.06%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDK--------EKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVE---------------------------------LITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILT 1665
            +H A   G  EVVK  +++  NINA S+  + P++ A + NHI++VK L+EN  N  + +   + P+  A   GH Q V +L++N+     R       +H A          LL++N  +  V+ K            P+  A   GNV +  LL+N    +D  ++    P+HVA + G+ ++VK+L+     I+A T     P+HCA + GH ++V+LL++ G+ L A  +N   P+H A+    VE                                 +  LLL+K+ +  A     + P+HI C K  ++ ++LL+ Y   I+  TE    PIH A + GH  IV +L+ +  + +V++      LH A   G +++V  L+ N   +DA ++ +  P+H+A R G  EIV++L++     +A T   + P+HI+   G  D+ ++L+ +       T   + PLH+A +YG  D+ KLL+Q+    D   KN Y+P+ IA K N  +I + L++       NI+T
Sbjct:   80 LHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAET--NIVT 605          

HSP 2 Score: 253.062 bits (645), Expect = 4.057e-69
Identity = 130/482 (26.97%), Postives = 244/482 (50.62%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            ++ K    + P+H A   G+ +VV+  +E+   + A ++    P+H A + +H+E VK L++++  ++ ++      +H AA  GH ++ KLL+    + NARA   +  +H AC    + +++LL++    +    +    PI  A   G++ IV LL+ N    DV +      +H+A R G ++VV+ L++N   ++A       P+H A + G  EIV+LL+Q+ +  DA   N + P+H ++  G V++ ++LLE        T+  + P+H+    G L+  KLL+  +   + A +    P+H A      +I   L++      +   +   PLH A   G+ D+V +L++   +I   +K     +H+A +   + +  +L + G   +A+T+  + P+ +AC  GN  +VN L+    N+ A T + + PLH A + GH  I+ +L+Q G   +    N  + + IAK+  Y
Sbjct:  271 IDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGY 752          

HSP 3 Score: 247.284 bits (630), Expect = 2.989e-67
Identity = 130/484 (26.86%), Postives = 237/484 (48.97%), Query Frame = 1
Query:  181 NMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
             + P+H A   GN  +VK  +++   I+A +     P+H A  + H ++V+LL+E    + + +     P+H AA   H++ VK L+Q+   ++         +H A    H  + KLL++   +          P+  ACK   ++++ELL+     I   ++    PIHVA   GHL++V +L+QN    +         +H A + G VE+V+ L++NG+ +DA       P+H AS LG  E++ LLL+     +A T   + P+HI   +G ++   +L++      +AT+K   P+H A  YG  ++ ++L+      + +      PLH A     + I + L+    + +  +K    P+H+A + GH ++V +L+ KG      T+     +H+A      ++ ++L     + +A T   + PL +AC YG+  +V  L++QG N +   KN Y+P+  A +  +  I N L+ 
Sbjct:  245 GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 728          

HSP 4 Score: 230.72 bits (587), Expect = 6.818e-62
Identity = 131/547 (23.95%), Postives = 252/547 (46.07%), Query Frame = 1
Query:  202 ACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCK-----------------------------IDVKSQF--------NWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHV---------------------------------ACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            A   GN++ V  +++   +IN  ++     +H A +  H+ +V+ L+    +++S +      +H A+  G  ++VK+L++   +INA+++  +  ++ A    H+D+VK L+EN  +     ++   P+  A + G+ + V +L+ N+ K                              DV+S+          + P+H+A  +G+++V  +L+     ++        P+H A K G+  +VKLL+  G  +DA   +   P+H A+  G  +++ LLLE+   + A T+    P+H+     H+E VK L+ +K  ++  T      +H A + GHY + ++L+D   N          PLH AC    + ++ +L++    I A ++    PIHV                                 A R+G +E+V+ L+R G   +A    +  P+HIA  +G  +IV LL+    + +A T + + PLHI+ R G  D+  +L++ G    +  K  ++P+ +A KY   ++   L+ 
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQ 563          

HSP 5 Score: 190.274 bits (482), Expect = 8.375e-49
Identity = 108/406 (26.60%), Postives = 198/406 (48.77%), Query Frame = 1
Query:  397 KAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLL--------EKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIA 1590
            +AA  G+L  V   ++   DIN   +     +H A    HV +V+ L+     V    K+    +  A  +G  E+V++L+     I+ +SQ  + P+++A +  H+DVVK L++N  +    TE  + P+  A + GH + V +L++N    D  G+     +H A+   D +   LLL        + K  V   TE  + P+HI  H G++    LL++    ++        P+H A   G+  +V++L+D    I+    +   PLH A  +G+  +V +L+E    + A +K    P+H+A +  H+E VK L++     +  T      +H+A   G+Y +  LL+  R N  A  ++ + PLHIAC+     +++LL++ G +   + ++  +P+ +A
Sbjct:   16 RAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVA 417          

HSP 6 Score: 56.225 bits (134), Expect = 3.645e-7
Identity = 29/118 (24.58%), Postives = 61/118 (51.69%), Query Frame = 1
Query: 1291 ACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            A R+G+L+ V   ++ G       +     +H+A   G+  +V  L+    ++++ T      LHIA   G A++VK+L+++G N +   +N ++P+ +A + N+ ++   L+    N
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN 134          
BLAST of Protein kinase-like domain vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 258.455 bits (659), Expect = 2.514e-71
Identity = 141/535 (26.36%), Postives = 269/535 (50.28%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNR--YSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIF 1782
            + P+H A   G+ +VV   + +   I+A ++    P+H A + +H++  + L+ +R  ++ ++     P+H AA  GH+++ KLL+  + D N+RA   +  +H AC    + +V+LL++    +    +    P+  A   G + IV  L+      DV++     P+H+A R    DVV+VLI+N   ++A       P+H A + G+ +IV LL+Q G+  +A   +N+ P+H A+  G  E+  +LL+   D   +T+  + P+H+    G+LE V+LL++    ++I  + +  P+H A +Y + ++  +L+++  + + +      PLH A     ++I + L++   D +A S+  + P+H++ + GH EI  +LI  G    A        +H+     +  +  +L ++   I + T   + PLH+AC +G  ++VK L++ G   DV +K R  Y+P+  A +  +N           NC+  +L       + G +PN   T+       IAQ +G  ++ E  
Sbjct:  294 LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGA--DVGEKTRASYTPLHQAAQQGHN-----------NCVRYLL-------ENGASPN-EQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 2 Score: 237.269 bits (604), Expect = 2.326e-64
Identity = 142/552 (25.72%), Postives = 261/552 (47.28%), Query Frame = 1
Query:   79 MNDFQNFIEAVKSNKIKDIRRLFK---VQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLH 1725
            +N F     A + N  + ++ L K    Q L  +D     P+  A   G+  VV   +E     ++  +     +H A + +      LL++N  N +  S   + P+H AA YGH  + +LL++   ++N +A  N   +H A      ++  LL+     +    K+   P+  A +SG+ ++V+LL+     I  K++    P+H+A +  H+D  + L+ ++  ++ VT     P+H A   GHV + KLL+   +  ++   N + P+H A     ++++ LLL+ +  +EA TE    P+H+    G +  V  L+    + ++ T +   P+H A      ++VR+LI +   ++    E   PLH A   GN DIV +L++   + +A ++ ++ P+H+A + G  E+  +L+         T+  + P+H+A   GN ++V LL+     ++    +   PLH+A  Y +  +  LL++ G +     KN Y+P+ IA K N  EI + L+             FK+D +      F  T LH
Sbjct:  130 VNGFTPLYMAAQENHEEVVKYLLKHGANQALSTED--GFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQ------------FKADPNAKSRAGF--TPLH 661          

HSP 3 Score: 236.884 bits (603), Expect = 2.789e-64
Identity = 140/570 (24.56%), Postives = 259/570 (45.44%), Query Frame = 1
Query:   94 NFIEAVKSNKIKDIRRLFKVQF-LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHC-----------------------------DVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASML---------------------------------GDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            +F+ A ++  ++ +  L +    +   +   +  +H A   G+ EVV+  I++   ++A +      +H A       IV +L+EN  N+   S   + P++ AA   H ++VK L+++  +     E  +  +  A    H  +V +L+EN                               +  V  K    P+  A   G+  + +LL+     ++ +++ N  P+HVA + G  ++  +L+     I++ T+    P+HCA + GH ++V LL+  G+ + A  +N   P+H A+                                   G V +  LLL++  D  +     + P+HI C K  ++ V+LL+ Y+  IE  TE    P+H A + G   IV  L+    N +V       PLH A      D+V VLI N   +DA ++    P+H+A R G+ +IV +L++ G  + A T   + P+HIA   G  ++  +L+    +    T   + PLH+A +YG+ ++V+LL+++G   D+  KN+ +P+ +A  YN +++
Sbjct:   36 SFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKV 605          

HSP 4 Score: 222.631 bits (566), Expect = 1.444e-59
Identity = 123/452 (27.21%), Postives = 217/452 (48.01%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCN 1545
            P+H A   G+  V +  +EK  N+N  +  N  P+H A +     +  LL+     I+S +     P+H AA  GH Q+V LL+     I+A+ +     +H A    HVD  + L+ +   V     +   P+  A   G+V + +LL++ +   + ++   + P+H+AC+   + VV++L++ +  IEA TE    P+H A   G + IV  L+Q G+  D        P+H A+     +++ +L+     V+A       P+HI    G+ + V LL+    +    T     P+H A   G  E+  IL+D N +  +   +   PLH A   GNL++V +L+E    +D   K    P+HVA    + ++  +L+  G   +A  +  + P+HIA      +I + L+  + +  A +   + PLH++ + GH +I  LLI+ G +
Sbjct:  230 PLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSD 681          

HSP 5 Score: 212.616 bits (540), Expect = 2.379e-56
Identity = 115/511 (22.50%), Postives = 241/511 (47.16%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLH 1725
            +H A    +       ++   N +  S+  + P+H A    H  + +LL+E   N+   +     P+H A  +G   +  LL+     I++R +     +H A  + H  +V LL+     +  + K    P+  A +  +V+    L+ +   +D  +     P+HVA   GH+ V K+L+    D  +     + P+H ACK   +++V+LL++  + ++A  E+   P+H A+ +G + ++  LL++  + +  T     P+H+       + V++L+     ++    + + P+H A   G+ +IV +L+ +  N   +  +N  PLH A   G  ++  +L++++ D    +K  + P+H+A + G+LE+V++L+ +G   +   + +  P+H+A    N  +  LL+ +  + +A   + + PLHIA +    +I   L+Q   + +   +  ++P+ ++ +  + EI   LI              ++  D G   N  LT++H
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLI--------------ENGSDVGAKANNGLTAMH 694          

HSP 6 Score: 200.675 bits (509), Expect = 1.433e-52
Identity = 121/478 (25.31%), Postives = 223/478 (46.65%), Query Frame = 1
Query:  301 ACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQN----------------KCDIEAVT-------------EGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNC 1647
            A     +E V  L+    +I + ++     +H A+  GH ++V+ LI+    ++A   K    +H A L     IV +L+EN  +V V+      P++ A +  + E+V+ L+ +     + ++  + P+ VA + GH  VV VL++N                K D  A T             +  + P+H A  YGH  + +LL++ G+ ++    +N  P+H A+  G   +  LLL +   +++ T+    P+H     GH + V LL+     I   T+    P+H A    H +  R L+     ++    +   PLH A   G++ +  +L++ S D ++ +   + P+H+AC+   +++V++L++     EA TE    P+H+A  +G  +IV  L+    N +  T+    PLH+A R    D+V++LI+ G   D   +   +P+ IA +    +I   L+ A  N 
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS 517          
BLAST of Protein kinase-like domain vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 258.455 bits (659), Expect = 2.514e-71
Identity = 141/535 (26.36%), Postives = 269/535 (50.28%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNR--YSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIF 1782
            + P+H A   G+ +VV   + +   I+A ++    P+H A + +H++  + L+ +R  ++ ++     P+H AA  GH+++ KLL+  + D N+RA   +  +H AC    + +V+LL++    +    +    P+  A   G + IV  L+      DV++     P+H+A R    DVV+VLI+N   ++A       P+H A + G+ +IV LL+Q G+  +A   +N+ P+H A+  G  E+  +LL+   D   +T+  + P+H+    G+LE V+LL++    ++I  + +  P+H A +Y + ++  +L+++  + + +      PLH A     ++I + L++   D +A S+  + P+H++ + GH EI  +LI  G    A        +H+     +  +  +L ++   I + T   + PLH+AC +G  ++VK L++ G   DV +K R  Y+P+  A +  +N           NC+  +L       + G +PN   T+       IAQ +G  ++ E  
Sbjct:  294 LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGA--DVGEKTRASYTPLHQAAQQGHN-----------NCVRYLL-------ENGASPN-EQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 2 Score: 237.269 bits (604), Expect = 2.326e-64
Identity = 142/552 (25.72%), Postives = 261/552 (47.28%), Query Frame = 1
Query:   79 MNDFQNFIEAVKSNKIKDIRRLFK---VQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLH 1725
            +N F     A + N  + ++ L K    Q L  +D     P+  A   G+  VV   +E     ++  +     +H A + +      LL++N  N +  S   + P+H AA YGH  + +LL++   ++N +A  N   +H A      ++  LL+     +    K+   P+  A +SG+ ++V+LL+     I  K++    P+H+A +  H+D  + L+ ++  ++ VT     P+H A   GHV + KLL+   +  ++   N + P+H A     ++++ LLL+ +  +EA TE    P+H+    G +  V  L+    + ++ T +   P+H A      ++VR+LI +   ++    E   PLH A   GN DIV +L++   + +A ++ ++ P+H+A + G  E+  +L+         T+  + P+H+A   GN ++V LL+     ++    +   PLH+A  Y +  +  LL++ G +     KN Y+P+ IA K N  EI + L+             FK+D +      F  T LH
Sbjct:  130 VNGFTPLYMAAQENHEEVVKYLLKHGANQALSTED--GFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQ------------FKADPNAKSRAGF--TPLH 661          

HSP 3 Score: 236.884 bits (603), Expect = 2.789e-64
Identity = 140/570 (24.56%), Postives = 259/570 (45.44%), Query Frame = 1
Query:   94 NFIEAVKSNKIKDIRRLFKVQF-LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHC-----------------------------DVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASML---------------------------------GDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            +F+ A ++  ++ +  L +    +   +   +  +H A   G+ EVV+  I++   ++A +      +H A       IV +L+EN  N+   S   + P++ AA   H ++VK L+++  +     E  +  +  A    H  +V +L+EN                               +  V  K    P+  A   G+  + +LL+     ++ +++ N  P+HVA + G  ++  +L+     I++ T+    P+HCA + GH ++V LL+  G+ + A  +N   P+H A+                                   G V +  LLL++  D  +     + P+HI C K  ++ V+LL+ Y+  IE  TE    P+H A + G   IV  L+    N +V       PLH A      D+V VLI N   +DA ++    P+H+A R G+ +IV +L++ G  + A T   + P+HIA   G  ++  +L+    +    T   + PLH+A +YG+ ++V+LL+++G   D+  KN+ +P+ +A  YN +++
Sbjct:   36 SFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKV 605          

HSP 4 Score: 222.631 bits (566), Expect = 1.444e-59
Identity = 123/452 (27.21%), Postives = 217/452 (48.01%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCN 1545
            P+H A   G+  V +  +EK  N+N  +  N  P+H A +     +  LL+     I+S +     P+H AA  GH Q+V LL+     I+A+ +     +H A    HVD  + L+ +   V     +   P+  A   G+V + +LL++ +   + ++   + P+H+AC+   + VV++L++ +  IEA TE    P+H A   G + IV  L+Q G+  D        P+H A+     +++ +L+     V+A       P+HI    G+ + V LL+    +    T     P+H A   G  E+  IL+D N +  +   +   PLH A   GNL++V +L+E    +D   K    P+HVA    + ++  +L+  G   +A  +  + P+HIA      +I + L+  + +  A +   + PLH++ + GH +I  LLI+ G +
Sbjct:  230 PLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSD 681          

HSP 5 Score: 212.616 bits (540), Expect = 2.379e-56
Identity = 115/511 (22.50%), Postives = 241/511 (47.16%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLH 1725
            +H A    +       ++   N +  S+  + P+H A    H  + +LL+E   N+   +     P+H A  +G   +  LL+     I++R +     +H A  + H  +V LL+     +  + K    P+  A +  +V+    L+ +   +D  +     P+HVA   GH+ V K+L+    D  +     + P+H ACK   +++V+LL++  + ++A  E+   P+H A+ +G + ++  LL++  + +  T     P+H+       + V++L+     ++    + + P+H A   G+ +IV +L+ +  N   +  +N  PLH A   G  ++  +L++++ D    +K  + P+H+A + G+LE+V++L+ +G   +   + +  P+H+A    N  +  LL+ +  + +A   + + PLHIA +    +I   L+Q   + +   +  ++P+ ++ +  + EI   LI              ++  D G   N  LT++H
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLI--------------ENGSDVGAKANNGLTAMH 694          

HSP 6 Score: 200.675 bits (509), Expect = 1.433e-52
Identity = 121/478 (25.31%), Postives = 223/478 (46.65%), Query Frame = 1
Query:  301 ACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQN----------------KCDIEAVT-------------EGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNC 1647
            A     +E V  L+    +I + ++     +H A+  GH ++V+ LI+    ++A   K    +H A L     IV +L+EN  +V V+      P++ A +  + E+V+ L+ +     + ++  + P+ VA + GH  VV VL++N                K D  A T             +  + P+H A  YGH  + +LL++ G+ ++    +N  P+H A+  G   +  LLL +   +++ T+    P+H     GH + V LL+     I   T+    P+H A    H +  R L+     ++    +   PLH A   G++ +  +L++ S D ++ +   + P+H+AC+   +++V++L++     EA TE    P+H+A  +G  +IV  L+    N +  T+    PLH+A R    D+V++LI+ G   D   +   +P+ IA +    +I   L+ A  N 
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS 517          
BLAST of Protein kinase-like domain vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 258.07 bits (658), Expect = 2.854e-71
Identity = 141/535 (26.36%), Postives = 269/535 (50.28%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNR--YSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIF 1782
            + P+H A   G+ +VV   + +   I+A ++    P+H A + +H++  + L+ +R  ++ ++     P+H AA  GH+++ KLL+  + D N+RA   +  +H AC    + +V+LL++    +    +    P+  A   G + IV  L+      DV++     P+H+A R    DVV+VLI+N   ++A       P+H A + G+ +IV LL+Q G+  +A   +N+ P+H A+  G  E+  +LL+   D   +T+  + P+H+    G+LE V+LL++    ++I  + +  P+H A +Y + ++  +L+++  + + +      PLH A     ++I + L++   D +A S+  + P+H++ + GH EI  +LI  G    A        +H+     +  +  +L ++   I + T   + PLH+AC +G  ++VK L++ G   DV +K R  Y+P+  A +  +N           NC+  +L       + G +PN   T+       IAQ +G  ++ E  
Sbjct:  294 LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGA--DVGEKTRASYTPLHQAAQQGHN-----------NCVRYLL-------ENGASPN-EQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 2 Score: 237.269 bits (604), Expect = 2.303e-64
Identity = 142/552 (25.72%), Postives = 261/552 (47.28%), Query Frame = 1
Query:   79 MNDFQNFIEAVKSNKIKDIRRLFK---VQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLH 1725
            +N F     A + N  + ++ L K    Q L  +D     P+  A   G+  VV   +E     ++  +     +H A + +      LL++N  N +  S   + P+H AA YGH  + +LL++   ++N +A  N   +H A      ++  LL+     +    K+   P+  A +SG+ ++V+LL+     I  K++    P+H+A +  H+D  + L+ ++  ++ VT     P+H A   GHV + KLL+   +  ++   N + P+H A     ++++ LLL+ +  +EA TE    P+H+    G +  V  L+    + ++ T +   P+H A      ++VR+LI +   ++    E   PLH A   GN DIV +L++   + +A ++ ++ P+H+A + G  E+  +L+         T+  + P+H+A   GN ++V LL+     ++    +   PLH+A  Y +  +  LL++ G +     KN Y+P+ IA K N  EI + L+             FK+D +      F  T LH
Sbjct:  130 VNGFTPLYMAAQENHEEVVKYLLKHGANQALSTED--GFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQ------------FKADPNAKSRAGF--TPLH 661          

HSP 3 Score: 236.884 bits (603), Expect = 3.079e-64
Identity = 140/570 (24.56%), Postives = 259/570 (45.44%), Query Frame = 1
Query:   94 NFIEAVKSNKIKDIRRLFKVQF-LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHC-----------------------------DVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASML---------------------------------GDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            +F+ A ++  ++ +  L +    +   +   +  +H A   G+ EVV+  I++   ++A +      +H A       IV +L+EN  N+   S   + P++ AA   H ++VK L+++  +     E  +  +  A    H  +V +L+EN                               +  V  K    P+  A   G+  + +LL+     ++ +++ N  P+HVA + G  ++  +L+     I++ T+    P+HCA + GH ++V LL+  G+ + A  +N   P+H A+                                   G V +  LLL++  D  +     + P+HI C K  ++ V+LL+ Y+  IE  TE    P+H A + G   IV  L+    N +V       PLH A      D+V VLI N   +DA ++    P+H+A R G+ +IV +L++ G  + A T   + P+HIA   G  ++  +L+    +    T   + PLH+A +YG+ ++V+LL+++G   D+  KN+ +P+ +A  YN +++
Sbjct:   36 SFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKV 605          

HSP 4 Score: 222.246 bits (565), Expect = 1.496e-59
Identity = 123/452 (27.21%), Postives = 217/452 (48.01%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCN 1545
            P+H A   G+  V +  +EK  N+N  +  N  P+H A +     +  LL+     I+S +     P+H AA  GH Q+V LL+     I+A+ +     +H A    HVD  + L+ +   V     +   P+  A   G+V + +LL++ +   + ++   + P+H+AC+   + VV++L++ +  IEA TE    P+H A   G + IV  L+Q G+  D        P+H A+     +++ +L+     V+A       P+HI    G+ + V LL+    +    T     P+H A   G  E+  IL+D N +  +   +   PLH A   GNL++V +L+E    +D   K    P+HVA    + ++  +L+  G   +A  +  + P+HIA      +I + L+  + +  A +   + PLH++ + GH +I  LLI+ G +
Sbjct:  230 PLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSD 681          

HSP 5 Score: 212.616 bits (540), Expect = 2.399e-56
Identity = 115/511 (22.50%), Postives = 241/511 (47.16%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLH 1725
            +H A    +       ++   N +  S+  + P+H A    H  + +LL+E   N+   +     P+H A  +G   +  LL+     I++R +     +H A  + H  +V LL+     +  + K    P+  A +  +V+    L+ +   +D  +     P+HVA   GH+ V K+L+    D  +     + P+H ACK   +++V+LL++  + ++A  E+   P+H A+ +G + ++  LL++  + +  T     P+H+       + V++L+     ++    + + P+H A   G+ +IV +L+ +  N   +  +N  PLH A   G  ++  +L++++ D    +K  + P+H+A + G+LE+V++L+ +G   +   + +  P+H+A    N  +  LL+ +  + +A   + + PLHIA +    +I   L+Q   + +   +  ++P+ ++ +  + EI   LI              ++  D G   N  LT++H
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLI--------------ENGSDVGAKANNGLTAMH 694          

HSP 6 Score: 200.675 bits (509), Expect = 1.697e-52
Identity = 121/478 (25.31%), Postives = 223/478 (46.65%), Query Frame = 1
Query:  301 ACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQN----------------KCDIEAVT-------------EGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNC 1647
            A     +E V  L+    +I + ++     +H A+  GH ++V+ LI+    ++A   K    +H A L     IV +L+EN  +V V+      P++ A +  + E+V+ L+ +     + ++  + P+ VA + GH  VV VL++N                K D  A T             +  + P+H A  YGH  + +LL++ G+ ++    +N  P+H A+  G   +  LLL +   +++ T+    P+H     GH + V LL+     I   T+    P+H A    H +  R L+     ++    +   PLH A   G++ +  +L++ S D ++ +   + P+H+AC+   +++V++L++     EA TE    P+H+A  +G  +IV  L+    N +  T+    PLH+A R    D+V++LI+ G   D   +   +P+ IA +    +I   L+ A  N 
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS 517          
BLAST of Protein kinase-like domain vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 258.07 bits (658), Expect = 2.854e-71
Identity = 141/535 (26.36%), Postives = 269/535 (50.28%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNR--YSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIF 1782
            + P+H A   G+ +VV   + +   I+A ++    P+H A + +H++  + L+ +R  ++ ++     P+H AA  GH+++ KLL+  + D N+RA   +  +H AC    + +V+LL++    +    +    P+  A   G + IV  L+      DV++     P+H+A R    DVV+VLI+N   ++A       P+H A + G+ +IV LL+Q G+  +A   +N+ P+H A+  G  E+  +LL+   D   +T+  + P+H+    G+LE V+LL++    ++I  + +  P+H A +Y + ++  +L+++  + + +      PLH A     ++I + L++   D +A S+  + P+H++ + GH EI  +LI  G    A        +H+     +  +  +L ++   I + T   + PLH+AC +G  ++VK L++ G   DV +K R  Y+P+  A +  +N           NC+  +L       + G +PN   T+       IAQ +G  ++ E  
Sbjct:  294 LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGA--DVGEKTRASYTPLHQAAQQGHN-----------NCVRYLL-------ENGASPN-EQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 2 Score: 237.269 bits (604), Expect = 2.303e-64
Identity = 142/552 (25.72%), Postives = 261/552 (47.28%), Query Frame = 1
Query:   79 MNDFQNFIEAVKSNKIKDIRRLFK---VQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLH 1725
            +N F     A + N  + ++ L K    Q L  +D     P+  A   G+  VV   +E     ++  +     +H A + +      LL++N  N +  S   + P+H AA YGH  + +LL++   ++N +A  N   +H A      ++  LL+     +    K+   P+  A +SG+ ++V+LL+     I  K++    P+H+A +  H+D  + L+ ++  ++ VT     P+H A   GHV + KLL+   +  ++   N + P+H A     ++++ LLL+ +  +EA TE    P+H+    G +  V  L+    + ++ T +   P+H A      ++VR+LI +   ++    E   PLH A   GN DIV +L++   + +A ++ ++ P+H+A + G  E+  +L+         T+  + P+H+A   GN ++V LL+     ++    +   PLH+A  Y +  +  LL++ G +     KN Y+P+ IA K N  EI + L+             FK+D +      F  T LH
Sbjct:  130 VNGFTPLYMAAQENHEEVVKYLLKHGANQALSTED--GFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQ------------FKADPNAKSRAGF--TPLH 661          

HSP 3 Score: 236.884 bits (603), Expect = 3.079e-64
Identity = 140/570 (24.56%), Postives = 259/570 (45.44%), Query Frame = 1
Query:   94 NFIEAVKSNKIKDIRRLFKVQF-LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHC-----------------------------DVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASML---------------------------------GDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            +F+ A ++  ++ +  L +    +   +   +  +H A   G+ EVV+  I++   ++A +      +H A       IV +L+EN  N+   S   + P++ AA   H ++VK L+++  +     E  +  +  A    H  +V +L+EN                               +  V  K    P+  A   G+  + +LL+     ++ +++ N  P+HVA + G  ++  +L+     I++ T+    P+HCA + GH ++V LL+  G+ + A  +N   P+H A+                                   G V +  LLL++  D  +     + P+HI C K  ++ V+LL+ Y+  IE  TE    P+H A + G   IV  L+    N +V       PLH A      D+V VLI N   +DA ++    P+H+A R G+ +IV +L++ G  + A T   + P+HIA   G  ++  +L+    +    T   + PLH+A +YG+ ++V+LL+++G   D+  KN+ +P+ +A  YN +++
Sbjct:   36 SFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKV 605          

HSP 4 Score: 222.246 bits (565), Expect = 1.496e-59
Identity = 123/452 (27.21%), Postives = 217/452 (48.01%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCN 1545
            P+H A   G+  V +  +EK  N+N  +  N  P+H A +     +  LL+     I+S +     P+H AA  GH Q+V LL+     I+A+ +     +H A    HVD  + L+ +   V     +   P+  A   G+V + +LL++ +   + ++   + P+H+AC+   + VV++L++ +  IEA TE    P+H A   G + IV  L+Q G+  D        P+H A+     +++ +L+     V+A       P+HI    G+ + V LL+    +    T     P+H A   G  E+  IL+D N +  +   +   PLH A   GNL++V +L+E    +D   K    P+HVA    + ++  +L+  G   +A  +  + P+HIA      +I + L+  + +  A +   + PLH++ + GH +I  LLI+ G +
Sbjct:  230 PLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSD 681          

HSP 5 Score: 212.616 bits (540), Expect = 2.399e-56
Identity = 115/511 (22.50%), Postives = 241/511 (47.16%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLH 1725
            +H A    +       ++   N +  S+  + P+H A    H  + +LL+E   N+   +     P+H A  +G   +  LL+     I++R +     +H A  + H  +V LL+     +  + K    P+  A +  +V+    L+ +   +D  +     P+HVA   GH+ V K+L+    D  +     + P+H ACK   +++V+LL++  + ++A  E+   P+H A+ +G + ++  LL++  + +  T     P+H+       + V++L+     ++    + + P+H A   G+ +IV +L+ +  N   +  +N  PLH A   G  ++  +L++++ D    +K  + P+H+A + G+LE+V++L+ +G   +   + +  P+H+A    N  +  LL+ +  + +A   + + PLHIA +    +I   L+Q   + +   +  ++P+ ++ +  + EI   LI              ++  D G   N  LT++H
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLI--------------ENGSDVGAKANNGLTAMH 694          

HSP 6 Score: 200.675 bits (509), Expect = 1.697e-52
Identity = 121/478 (25.31%), Postives = 223/478 (46.65%), Query Frame = 1
Query:  301 ACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQN----------------KCDIEAVT-------------EGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNC 1647
            A     +E V  L+    +I + ++     +H A+  GH ++V+ LI+    ++A   K    +H A L     IV +L+EN  +V V+      P++ A +  + E+V+ L+ +     + ++  + P+ VA + GH  VV VL++N                K D  A T             +  + P+H A  YGH  + +LL++ G+ ++    +N  P+H A+  G   +  LLL +   +++ T+    P+H     GH + V LL+     I   T+    P+H A    H +  R L+     ++    +   PLH A   G++ +  +L++ S D ++ +   + P+H+AC+   +++V++L++     EA TE    P+H+A  +G  +IV  L+    N +  T+    PLH+A R    D+V++LI+ G   D   +   +P+ IA +    +I   L+ A  N 
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS 517          
BLAST of Protein kinase-like domain vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 258.07 bits (658), Expect = 3.078e-71
Identity = 141/535 (26.36%), Postives = 269/535 (50.28%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNR--YSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIF 1782
            + P+H A   G+ +VV   + +   I+A ++    P+H A + +H++  + L+ +R  ++ ++     P+H AA  GH+++ KLL+  + D N+RA   +  +H AC    + +V+LL++    +    +    P+  A   G + IV  L+      DV++     P+H+A R    DVV+VLI+N   ++A       P+H A + G+ +IV LL+Q G+  +A   +N+ P+H A+  G  E+  +LL+   D   +T+  + P+H+    G+LE V+LL++    ++I  + +  P+H A +Y + ++  +L+++  + + +      PLH A     ++I + L++   D +A S+  + P+H++ + GH EI  +LI  G    A        +H+     +  +  +L ++   I + T   + PLH+AC +G  ++VK L++ G   DV +K R  Y+P+  A +  +N           NC+  +L       + G +PN   T+       IAQ +G  ++ E  
Sbjct:  294 LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGA--DVGEKTRASYTPLHQAAQQGHN-----------NCVRYLL-------ENGASPN-EQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 2 Score: 236.884 bits (603), Expect = 2.868e-64
Identity = 135/521 (25.91%), Postives = 252/521 (48.37%), Query Frame = 1
Query:   79 MNDFQNFIEAVKSNKIKDIRRLFK---VQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            +N F     A + N  + ++ L K    Q L  +D     P+  A   G+  VV   +E     ++  +     +H A + +      LL++N  N +  S   + P+H AA YGH  + +LL++   ++N +A  N   +H A      ++  LL+     +    K+   P+  A +SG+ ++V+LL+     I  K++    P+H+A +  H+D  + L+ ++  ++ VT     P+H A   GHV + KLL+   +  ++   N + P+H A     ++++ LLL+ +  +EA TE    P+H+    G +  V  L+    + ++ T +   P+H A      ++VR+LI +   ++    E   PLH A   GN DIV +L++   + +A ++ ++ P+H+A + G  E+  +L+         T+  + P+H+A   GN ++V LL+     ++    +   PLH+A  Y +  +  LL++ G +     KN Y+P+ IA K N  EI + L+ 
Sbjct:  130 VNGFTPLYMAAQENHEEVVKYLLKHGANQALSTED--GFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQ 644          

HSP 3 Score: 236.498 bits (602), Expect = 3.534e-64
Identity = 140/570 (24.56%), Postives = 259/570 (45.44%), Query Frame = 1
Query:   94 NFIEAVKSNKIKDIRRLFKVQF-LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHC-----------------------------DVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASML---------------------------------GDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            +F+ A ++  ++ +  L +    +   +   +  +H A   G+ EVV+  I++   ++A +      +H A       IV +L+EN  N+   S   + P++ AA   H ++VK L+++  +     E  +  +  A    H  +V +L+EN                               +  V  K    P+  A   G+  + +LL+     ++ +++ N  P+HVA + G  ++  +L+     I++ T+    P+HCA + GH ++V LL+  G+ + A  +N   P+H A+                                   G V +  LLL++  D  +     + P+HI C K  ++ V+LL+ Y+  IE  TE    P+H A + G   IV  L+    N +V       PLH A      D+V VLI N   +DA ++    P+H+A R G+ +IV +L++ G  + A T   + P+HIA   G  ++  +L+    +    T   + PLH+A +YG+ ++V+LL+++G   D+  KN+ +P+ +A  YN +++
Sbjct:   36 SFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKV 605          

HSP 4 Score: 222.246 bits (565), Expect = 1.893e-59
Identity = 123/452 (27.21%), Postives = 217/452 (48.01%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCN 1545
            P+H A   G+  V +  +EK  N+N  +  N  P+H A +     +  LL+     I+S +     P+H AA  GH Q+V LL+     I+A+ +     +H A    HVD  + L+ +   V     +   P+  A   G+V + +LL++ +   + ++   + P+H+AC+   + VV++L++ +  IEA TE    P+H A   G + IV  L+Q G+  D        P+H A+     +++ +L+     V+A       P+HI    G+ + V LL+    +    T     P+H A   G  E+  IL+D N +  +   +   PLH A   GNL++V +L+E    +D   K    P+HVA    + ++  +L+  G   +A  +  + P+HIA      +I + L+  + +  A +   + PLH++ + GH +I  LLI+ G +
Sbjct:  230 PLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSD 681          

HSP 5 Score: 212.231 bits (539), Expect = 3.229e-56
Identity = 115/511 (22.50%), Postives = 241/511 (47.16%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLH 1725
            +H A    +       ++   N +  S+  + P+H A    H  + +LL+E   N+   +     P+H A  +G   +  LL+     I++R +     +H A  + H  +V LL+     +  + K    P+  A +  +V+    L+ +   +D  +     P+HVA   GH+ V K+L+    D  +     + P+H ACK   +++V+LL++  + ++A  E+   P+H A+ +G + ++  LL++  + +  T     P+H+       + V++L+     ++    + + P+H A   G+ +IV +L+ +  N   +  +N  PLH A   G  ++  +L++++ D    +K  + P+H+A + G+LE+V++L+ +G   +   + +  P+H+A    N  +  LL+ +  + +A   + + PLHIA +    +I   L+Q   + +   +  ++P+ ++ +  + EI   LI              ++  D G   N  LT++H
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLI--------------ENGSDVGAKANNGLTAMH 694          

HSP 6 Score: 200.29 bits (508), Expect = 1.923e-52
Identity = 121/478 (25.31%), Postives = 223/478 (46.65%), Query Frame = 1
Query:  301 ACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQN----------------KCDIEAVT-------------EGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNC 1647
            A     +E V  L+    +I + ++     +H A+  GH ++V+ LI+    ++A   K    +H A L     IV +L+EN  +V V+      P++ A +  + E+V+ L+ +     + ++  + P+ VA + GH  VV VL++N                K D  A T             +  + P+H A  YGH  + +LL++ G+ ++    +N  P+H A+  G   +  LLL +   +++ T+    P+H     GH + V LL+     I   T+    P+H A    H +  R L+     ++    +   PLH A   G++ +  +L++ S D ++ +   + P+H+AC+   +++V++L++     EA TE    P+H+A  +G  +IV  L+    N +  T+    PLH+A R    D+V++LI+ G   D   +   +P+ IA +    +I   L+ A  N 
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS 517          
BLAST of Protein kinase-like domain vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 267.314 bits (682), Expect = 6.622e-75
Identity = 131/496 (26.41%), Postives = 252/496 (50.81%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNC 1647
            +E K    + P+H A   G+ +VV   +E+   I+A ++    P+H A +  H++  ++L+ +R  ++ ++      +H AA  GH+++ KLL+  N D NARA   +  +H AC    + +V+LL+ +   +    +    P+  A   G + IV  L+ ++   DV +     P+H+A R    D++++L++N   ++A       P+H A + G+V+IV LL+Q+G+ +DA  ++ +  +H A+  G  E+  +L+E    ++A T+  + P+H+    GH++  +LL+  + D++   +    P+H AC+Y + ++  +L++   +   +      PLH A     +DI   L+E     +A SK  + P+H++ + GH EI  +LI          +    P+H+     N ++  +L  +  NI+  T   + PLH+A  +G A++V+ L+Q G N D      Y+P+    +  +  I N L+    N 
Sbjct:  264 IEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANA 759          

HSP 2 Score: 261.151 bits (666), Expect = 9.945e-73
Identity = 139/496 (28.02%), Postives = 245/496 (49.40%), Query Frame = 1
Query:  142 LFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            L +   ++    K    +H A   G  EVVK  +E   ++N  S+  + P++ A + NH  +V+LL+ N  N    +   + P+  A   GH ++V +L++++     R +     +H A     V    LL++N  +  V  K    P+  A   GN  I  LLI     ++  ++ N  P+HVA + G  ++V +L++   +IEA T     P+HCA + GH ++V +L++ G+ + A  +N   P+H A+    V+   +LL  +  V+ VT      +H+  H GH+   KLL+D   D          P+H AC     ++V +L+    +I  +      PLH A   G ++IV  L+++    D P+     P+H+A R+   +I+++L+R G + +A    +  P+HIA  +GN DIV LL+     ++A T D +  LHIA + G  ++  +LI+ G   D   K  ++P+ +  KY + ++   L+
Sbjct:   64 LRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDT----RGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLL 555          

HSP 3 Score: 255.373 bits (651), Expect = 8.960e-71
Identity = 127/448 (28.35%), Postives = 232/448 (51.79%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            +  +H A   G+V V K  +++  + NA +   + P+H AC+ N +++V+LL+ +  +I + +     P+H AAF G + IV  L+Q++   +    +    +H A      DI+++L+ N   V    +E+  P+  A + GNV+IV LL+ +  ++D  ++  +  +H+A + G  +V  VLI+N   ++A T+  + P+H   KYGH+++ +LL+Q  + +DA G+N   P+H A    + ++  LLLEK     A  +    P+HI   K  ++    L++Y       ++    P+H +   GH EI  +LI+    +         P+H      N+++  +L +N  +ID  +K  + P+HVA   G   +V+ L++ G   +A T   + P+H     G+  IVNLL+  + N  A T++   PLHIA + G+  ++  L
Sbjct:  338 LTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL 785          

HSP 4 Score: 247.669 bits (631), Expect = 4.249e-68
Identity = 136/519 (26.20%), Postives = 254/519 (48.94%), Query Frame = 1
Query:   82 NDFQNFIEAVKSNKIKDIRRLFKV---QFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            N F     A + N    +R L      Q L  +D     P+  A   G+ +VV   +E     +   +     +H A + + ++   LL++N  N +  S   + P+H A+ YG+  I  LLIQ   D+N  A+ N   +H A      ++V LL+E   ++  + ++   P+  A +SG+ ++V++L+     I  K++    P+H+A +  H+D  ++L+ ++  ++ VT      +H A   GHV + KLL+   +  +A   N + P+H A     ++++ LLL     + A TE    P+H+    G +  V  L+ +    ++ T +   P+H A      +I+RIL+ +   ++    E   PLH A   GN+DIV +L+++   +DA +K  +  +H+A + G  E+  +LI  G   +A T+  + P+H+    G+  +  LL+    +++A   +   PLH+AC Y +  +  LL+++G +     KN ++P+ IA + N  +I   L+
Sbjct:  109 NGFTPLYMAAQENHDAVVRLLLSNGANQSLATED--GFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLL 621          

HSP 5 Score: 188.734 bits (478), Expect = 9.547e-49
Identity = 104/398 (26.13%), Postives = 201/398 (50.50%), Query Frame = 1
Query:  397 KAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIA 1590
            +AA  G+L+ V   ++NN DIN         +H A  + H+ +V  L+     V    K+    +  A  +G  E+V+LL+ +N  ++V+SQ  + P+++A +  H  VV++L+ N  +    TE  + P+  A + GH ++V +L+++    D  G+     +H A+   DV+  TLLL+   + +  ++  + P+HI  H G+     LL+    D+  + +    P+H A  +G   +V +L++   NIE    +   PLH A  +G+  +V++L+E    I A +K    P+H+A +  H++  ++L+      +  T      +H+A   G+  +  LL+    +  A  ++ + PLHIAC+     +V+LL++ G +     ++  +P+ +A
Sbjct:   17 RAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVA 410          

HSP 6 Score: 155.606 bits (392), Expect = 2.805e-38
Identity = 87/300 (29.00%), Postives = 151/300 (50.33%), Query Frame = 1
Query:  697 ACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKK 1596
            A R G+L+ V   ++N  DI          +H A K GH+ +V  L++ G+ +D+  +     +H AS+ G  E++ LLLE    V   ++  + P+++   + H   V+LL+    +  +ATE    P+  A   GH ++V +L++S+   +V        LH A    ++    +L++N  + D  SK  + P+H+A   G+  I  +LI+KG       +    P+H+A   G  ++V+LL+    NIEA T D   PLH A R GH  +V +L+++G       KN  +P+ +A +
Sbjct:   18 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKV----RLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQ 313          
BLAST of Protein kinase-like domain vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334061)

HSP 1 Score: 266.544 bits (680), Expect = 3.182e-74
Identity = 133/502 (26.49%), Postives = 254/502 (50.60%), Query Frame = 1
Query:  142 LFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNC 1647
            L K   +E K    + P+H A   G+ +VV   +E+   I+A ++    P+H A +  H++  ++L+ +R  ++ ++      +H AA  GH+++ KLL+  N D NARA   +  +H AC    + +V+LL+ +   +    +    P+  A   G + IV  L+ ++   DV +     P+H+A R    D++++L++N   ++A       P+H A + G+V+IV LL+Q+G+ +DA  ++ +  +H A+  G  E+  +L+E    ++A T+  + P+H+    GH++  +LL+  + D++   +    P+H AC+Y + ++  +L++   +   +      PLH A     +DI   L+E     +A SK  + P+H++ + GH EI  +LI          +    P+H+     N ++  +L  +  NI+  T   + PLH+A  +G A++V+ L+Q G N D      Y+P+    +  +  I N L+    N 
Sbjct:  408 LEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANA 909          

HSP 2 Score: 259.225 bits (661), Expect = 7.761e-72
Identity = 139/496 (28.02%), Postives = 245/496 (49.40%), Query Frame = 1
Query:  142 LFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            L +   ++    K    +H A   G  EVVK  +E   ++N  S+  + P++ A + NH  +V+LL+ N  N    +   + P+  A   GH ++V +L++++     R +     +H A     V    LL++N  +  V  K    P+  A   GN  I  LLI     ++  ++ N  P+HVA + G  ++V +L++   +IEA T     P+HCA + GH ++V +L++ G+ + A  +N   P+H A+    V+   +LL  +  V+ VT      +H+  H GH+   KLL+D   D          P+H AC     ++V +L+    +I  +      PLH A   G ++IV  L+++    D P+     P+H+A R+   +I+++L+R G + +A    +  P+HIA  +GN DIV LL+     ++A T D +  LHIA + G  ++  +LI+ G   D   K  ++P+ +  KY + ++   L+
Sbjct:  214 LRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDT----RGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLL 705          

HSP 3 Score: 254.218 bits (648), Expect = 4.051e-70
Identity = 127/445 (28.54%), Postives = 231/445 (51.91%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            +H A   G+V V K  +++  + NA +   + P+H AC+ N +++V+LL+ +  +I + +     P+H AAF G + IV  L+Q++   +    +    +H A      DI+++L+ N   V    +E+  P+  A + GNV+IV LL+ +  ++D  ++  +  +H+A + G  +V  VLI+N   ++A T+  + P+H   KYGH+++ +LL+Q  + +DA G+N   P+H A    + ++  LLLEK     A  +    P+HI   K  ++    L++Y       ++    P+H +   GH EI  +LI+    +         P+H      N+++  +L +N  +ID  +K  + P+HVA   G   +V+ L++ G   +A T   + P+H     G+  IVNLL+  + N  A T++   PLHIA + G+  ++  L
Sbjct:  491 LHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL 935          

HSP 4 Score: 246.128 bits (627), Expect = 1.933e-67
Identity = 136/519 (26.20%), Postives = 254/519 (48.94%), Query Frame = 1
Query:   82 NDFQNFIEAVKSNKIKDIRRLFKV---QFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            N F     A + N    +R L      Q L  +D     P+  A   G+ +VV   +E     +   +     +H A + + ++   LL++N  N +  S   + P+H A+ YG+  I  LLIQ   D+N  A+ N   +H A      ++V LL+E   ++  + ++   P+  A +SG+ ++V++L+     I  K++    P+H+A +  H+D  ++L+ ++  ++ VT      +H A   GHV + KLL+   +  +A   N + P+H A     ++++ LLL     + A TE    P+H+    G +  V  L+ +    ++ T +   P+H A      +I+RIL+ +   ++    E   PLH A   GN+DIV +L+++   +DA +K  +  +H+A + G  E+  +LI  G   +A T+  + P+H+    G+  +  LL+    +++A   +   PLH+AC Y +  +  LL+++G +     KN ++P+ IA + N  +I   L+
Sbjct:  259 NGFTPLYMAAQENHDAVVRLLLSNGANQSLATED--GFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLL 771          

HSP 5 Score: 187.578 bits (475), Expect = 2.108e-48
Identity = 104/398 (26.13%), Postives = 201/398 (50.50%), Query Frame = 1
Query:  397 KAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIA 1590
            +AA  G+L+ V   ++NN DIN         +H A  + H+ +V  L+     V    K+    +  A  +G  E+V+LL+ +N  ++V+SQ  + P+++A +  H  VV++L+ N  +    TE  + P+  A + GH ++V +L+++    D  G+     +H A+   DV+  TLLL+   + +  ++  + P+HI  H G+     LL+    D+  + +    P+H A  +G   +V +L++   NIE    +   PLH A  +G+  +V++L+E    I A +K    P+H+A +  H++  ++L+      +  T      +H+A   G+  +  LL+    +  A  ++ + PLHIAC+     +V+LL++ G +     ++  +P+ +A
Sbjct:  167 RAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVA 560          

HSP 6 Score: 154.836 bits (390), Expect = 5.974e-38
Identity = 87/300 (29.00%), Postives = 151/300 (50.33%), Query Frame = 1
Query:  697 ACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKK 1596
            A R G+L+ V   ++N  DI          +H A K GH+ +V  L++ G+ +D+  +     +H AS+ G  E++ LLLE    V   ++  + P+++   + H   V+LL+    +  +ATE    P+  A   GH ++V +L++S+   +V        LH A    ++    +L++N  + D  SK  + P+H+A   G+  I  +LI+KG       +    P+H+A   G  ++V+LL+    NIEA T D   PLH A R GH  +V +L+++G       KN  +P+ +A +
Sbjct:  168 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKV----RLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQ 463          
BLAST of Protein kinase-like domain vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334062)

HSP 1 Score: 243.817 bits (621), Expect = 2.066e-70
Identity = 131/465 (28.17%), Postives = 230/465 (49.46%), Query Frame = 1
Query:  142 LFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQ 1536
            L +   ++    K    +H A   G  EVVK  +E   ++N  S+  + P++ A + NH  +V+LL+ N  N    +   + P+  A   GH ++V +L++++     R +     +H A     V    LL++N  +  V  K    P+  A   GN  I  LLI     ++  ++ N  P+HVA + G  ++V +L++   +IEA T     P+HCA + GH ++V +L++ G+ + A  +N   P+H A+    V+   +LL  +  V+ VT      +H+  H GH+   KLL+D   D          P+H AC     ++V +L+    +I  +      PLH A   G ++IV  L+++    D P+     P+H+A R+   +I+++L+R G + +A    +  P+HIA  +GN DIV LL+     ++A T D +  LHIA + G  ++  L+ ++
Sbjct:   64 LRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDT----RGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVKDLIAKK 524          

HSP 2 Score: 236.498 bits (602), Expect = 9.491e-68
Identity = 131/513 (25.54%), Postives = 252/513 (49.12%), Query Frame = 1
Query:   94 NFIEAVKSNKIKDIRRLFKVQF-LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            +F+ A ++  ++ +    K    +   +   +  +H A   G++ VV   + +   +++ ++     +H A      E+VKLL+E+  ++   S   + P++ AA   H  +V+LL+ N  + +   E  +  +  A    H  +V +L+E+        K +   +  A K  +V+   LL++N+   DV S+  + P+H+A  +G+ ++  +LIQ   D+    + N  P+H A K+G   +V LL++ G  ++A   +   P+H A+  G  +++ +LLE+   + A T+    P+H+     H++  ++L+ ++  ++  T      +H A + GH  + ++L+D N +          PLH AC    L +V +L+ +   I A ++    P+HVA   G + IV  L++     +  T     P+H+A      DI+ +L+ +   ++A   +   PLHIA R G+ DIV LL+Q G   D   K+ Y+ + IA K   +E++ DLI
Sbjct:   14 SFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDT----RGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVK-DLI 521          

HSP 3 Score: 149.443 bits (376), Expect = 1.303e-37
Identity = 93/425 (21.88%), Postives = 189/425 (44.47%), Query Frame = 1
Query:   82 NDFQNFIEAVKSNKIKDIRRLFKV---QFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRH---------------------------------GHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCD 1248
            N F     A + N    +R L      Q L  +D     P+  A   G+ +VV   +E     +   +     +H A + + ++   LL++N  N +  S   + P+H A+ YG+  I  LLIQ   D+N  A+ N   +H A      ++V LL+E   ++  + ++   P+  A +SG+ ++V++L+     I  K++    P+H+A +                                  GH+ V K+L+    D  A     + P+H ACK   +++V+LL+++G+++ A  E+   P+H A+ +G + ++  LL+     +  T     P+H+       + +++L+     ++    +++ P+H A   G+ +IV +L+     ++ +  +    LH A   G  ++ +++ +   D
Sbjct:  109 NGFTPLYMAAQENHDAVVRLLLSNGANQSLATED--GFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVKDLIAKKITD 527          
BLAST of Protein kinase-like domain vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303118)

HSP 1 Score: 253.062 bits (645), Expect = 2.246e-69
Identity = 131/495 (26.46%), Postives = 252/495 (50.91%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            +E K    + P+H A   G+ +VV   +E+   I+A ++    P+H A +  H++  ++L+ +R  ++ ++      +H AA  GH+++ KLL+  N D NARA   +  +H AC    + +V+LL+ +   +    +    P+  A   G + IV  L+ ++   DV +     P+H+A R    D++++L++N   ++A       P+H A + G+V+IV LL+Q+G+ +DA  ++ +  +H A+  G  E+  +L+E    ++A T+  + P+H+    GH++  +LL+  + D++   +    P+H AC+Y + ++  +L++   +   +      PLH A     +DI   L+E     +A SK  + P+H++ + GH EI  +LI          +    P+H+     N ++  +L  +  NI+  T   + PLH+A  +G A++V+ L+Q G N D      Y+P+    +  +  I N L+    N
Sbjct:  264 IEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKAN 758          

HSP 2 Score: 246.128 bits (627), Expect = 3.789e-67
Identity = 138/485 (28.45%), Postives = 241/485 (49.69%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            K    +H A   G  EVVK  +E   ++N  S+  + P++ A + NH  +V+LL+ N  N    +   + P+  A   GH ++V +L+++    + R +     +H A     V    LL++N  +  V  K    P+  A   GN  I  LLI     ++  ++ N  P+HVA + G  ++V +L++   +IEA T     P+HCA + GH ++V +L++ G+ + A  +N   P+H A+    V+   +LL  +  V+ VT      +H+  H GH+   KLL+D   D          P+H AC     ++V +L+    +I  +      PLH A   G ++IV  L+++    D P+     P+H+A R+   +I+++L+R G + +A    +  P+HIA  +GN DIV LL+     ++A T D +  LHIA + G  ++  +LI+ G   D   K  ++P+ +  KY + ++   L+ 
Sbjct:   76 KGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQ 556          

HSP 3 Score: 242.662 bits (618), Expect = 5.817e-66
Identity = 127/448 (28.35%), Postives = 232/448 (51.79%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            +  +H A   G+V V K  +++  + NA +   + P+H AC+ N +++V+LL+ +  +I + +     P+H AAF G + IV  L+Q++   +    +    +H A      DI+++L+ N   V    +E+  P+  A + GNV+IV LL+ +  ++D  ++  +  +H+A + G  +V  VLI+N   ++A T+  + P+H   KYGH+++ +LL+Q  + +DA G+N   P+H A    + ++  LLLEK     A  +    P+HI   K  ++    L++Y       ++    P+H +   GH EI  +LI+    +         P+H      N+++  +L +N  +ID  +K  + P+HVA   G   +V+ L++ G   +A T   + P+H     G+  IVNLL+  + N  A T++   PLHIA + G+  ++  L
Sbjct:  338 LTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL 785          

HSP 4 Score: 231.876 bits (590), Expect = 1.680e-62
Identity = 136/519 (26.20%), Postives = 254/519 (48.94%), Query Frame = 1
Query:   82 NDFQNFIEAVKSNKIKDIRRLFKV---QFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            N F     A + N    +R L      Q L  +D     P+  A   G+ +VV   +E     +   +     +H A + + ++   LL++N  N +  S   + P+H A+ YG+  I  LLIQ   D+N  A+ N   +H A      ++V LL+E   ++  + ++   P+  A +SG+ ++V++L+     I  K++    P+H+A +  H+D  ++L+ ++  ++ VT      +H A   GHV + KLL+   +  +A   N + P+H A     ++++ LLL     + A TE    P+H+    G +  V  L+ +    ++ T +   P+H A      +I+RIL+ +   ++    E   PLH A   GN+DIV +L+++   +DA +K  +  +H+A + G  E+  +LI  G   +A T+  + P+H+    G+  +  LL+    +++A   +   PLH+AC Y +  +  LL+++G +     KN ++P+ IA + N  +I   L+
Sbjct:  109 NGFTPLYMAAQENHDAVVRLLLSNGANQSLATED--GFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLL 621          

HSP 5 Score: 219.164 bits (557), Expect = 2.151e-58
Identity = 128/505 (25.35%), Postives = 243/505 (48.12%), Query Frame = 1
Query:  202 ACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIV-----------------------------ELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            A   GN+E V   ++   +IN  +      +H A ++ HI +V  L+     ++S +      +H A+  G  ++VKLL+++N  +N +++  +  ++ A    H  +V+LL+ N  +  +  ++   P+  A + G+ ++V                              LL++N+   DV S+  + P+H+A  +G+ ++  +LIQ   D+    + N  P+H A K+G   +V LL++ G  ++A   +   P+H A+  G  +++ +LLE+   + A T+    P+H+     H++  ++L+ ++  ++  T      +H A + GH  + ++L+D N +          PLH AC    L +V +L+ +   I A ++    P+HVA   G + IV  L++     +  T     P+H+A      DI+ +L+ +   ++A   +   PLHIA R G+ DIV LL+Q G   D   K+ Y+ + IA K   +E+   LI
Sbjct:   18 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLI 522          

HSP 6 Score: 177.948 bits (450), Expect = 3.677e-45
Identity = 104/398 (26.13%), Postives = 201/398 (50.50%), Query Frame = 1
Query:  397 KAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIA 1590
            +AA  G+L+ V   ++NN DIN         +H A  + H+ +V  L+     V    K+    +  A  +G  E+V+LL+ +N  ++V+SQ  + P+++A +  H  VV++L+ N  +    TE  + P+  A + GH ++V +L+++    D  G+     +H A+   DV+  TLLL+   + +  ++  + P+HI  H G+     LL+    D+  + +    P+H A  +G   +V +L++   NIE    +   PLH A  +G+  +V++L+E    I A +K    P+H+A +  H++  ++L+      +  T      +H+A   G+  +  LL+    +  A  ++ + PLHIAC+     +V+LL++ G +     ++  +P+ +A
Sbjct:   17 RAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVA 410          
BLAST of Protein kinase-like domain vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303122)

HSP 1 Score: 253.062 bits (645), Expect = 2.300e-69
Identity = 131/495 (26.46%), Postives = 252/495 (50.91%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            +E K    + P+H A   G+ +VV   +E+   I+A ++    P+H A +  H++  ++L+ +R  ++ ++      +H AA  GH+++ KLL+  N D NARA   +  +H AC    + +V+LL+ +   +    +    P+  A   G + IV  L+ ++   DV +     P+H+A R    D++++L++N   ++A       P+H A + G+V+IV LL+Q+G+ +DA  ++ +  +H A+  G  E+  +L+E    ++A T+  + P+H+    GH++  +LL+  + D++   +    P+H AC+Y + ++  +L++   +   +      PLH A     +DI   L+E     +A SK  + P+H++ + GH EI  +LI          +    P+H+     N ++  +L  +  NI+  T   + PLH+A  +G A++V+ L+Q G N D      Y+P+    +  +  I N L+    N
Sbjct:  264 IEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKAN 758          

HSP 2 Score: 246.128 bits (627), Expect = 3.878e-67
Identity = 138/485 (28.45%), Postives = 241/485 (49.69%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            K    +H A   G  EVVK  +E   ++N  S+  + P++ A + NH  +V+LL+ N  N    +   + P+  A   GH ++V +L+++    + R +     +H A     V    LL++N  +  V  K    P+  A   GN  I  LLI     ++  ++ N  P+HVA + G  ++V +L++   +IEA T     P+HCA + GH ++V +L++ G+ + A  +N   P+H A+    V+   +LL  +  V+ VT      +H+  H GH+   KLL+D   D          P+H AC     ++V +L+    +I  +      PLH A   G ++IV  L+++    D P+     P+H+A R+   +I+++L+R G + +A    +  P+HIA  +GN DIV LL+     ++A T D +  LHIA + G  ++  +LI+ G   D   K  ++P+ +  KY + ++   L+ 
Sbjct:   76 KGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQ 556          

HSP 3 Score: 242.662 bits (618), Expect = 5.954e-66
Identity = 127/448 (28.35%), Postives = 232/448 (51.79%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            +  +H A   G+V V K  +++  + NA +   + P+H AC+ N +++V+LL+ +  +I + +     P+H AAF G + IV  L+Q++   +    +    +H A      DI+++L+ N   V    +E+  P+  A + GNV+IV LL+ +  ++D  ++  +  +H+A + G  +V  VLI+N   ++A T+  + P+H   KYGH+++ +LL+Q  + +DA G+N   P+H A    + ++  LLLEK     A  +    P+HI   K  ++    L++Y       ++    P+H +   GH EI  +LI+    +         P+H      N+++  +L +N  +ID  +K  + P+HVA   G   +V+ L++ G   +A T   + P+H     G+  IVNLL+  + N  A T++   PLHIA + G+  ++  L
Sbjct:  338 LTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL 785          

HSP 4 Score: 231.876 bits (590), Expect = 1.719e-62
Identity = 136/519 (26.20%), Postives = 254/519 (48.94%), Query Frame = 1
Query:   82 NDFQNFIEAVKSNKIKDIRRLFKV---QFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            N F     A + N    +R L      Q L  +D     P+  A   G+ +VV   +E     +   +     +H A + + ++   LL++N  N +  S   + P+H A+ YG+  I  LLIQ   D+N  A+ N   +H A      ++V LL+E   ++  + ++   P+  A +SG+ ++V++L+     I  K++    P+H+A +  H+D  ++L+ ++  ++ VT      +H A   GHV + KLL+   +  +A   N + P+H A     ++++ LLL     + A TE    P+H+    G +  V  L+ +    ++ T +   P+H A      +I+RIL+ +   ++    E   PLH A   GN+DIV +L+++   +DA +K  +  +H+A + G  E+  +LI  G   +A T+  + P+H+    G+  +  LL+    +++A   +   PLH+AC Y +  +  LL+++G +     KN ++P+ IA + N  +I   L+
Sbjct:  109 NGFTPLYMAAQENHDAVVRLLLSNGANQSLATED--GFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLL 621          

HSP 5 Score: 219.164 bits (557), Expect = 2.200e-58
Identity = 128/505 (25.35%), Postives = 243/505 (48.12%), Query Frame = 1
Query:  202 ACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIV-----------------------------ELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            A   GN+E V   ++   +IN  +      +H A ++ HI +V  L+     ++S +      +H A+  G  ++VKLL+++N  +N +++  +  ++ A    H  +V+LL+ N  +  +  ++   P+  A + G+ ++V                              LL++N+   DV S+  + P+H+A  +G+ ++  +LIQ   D+    + N  P+H A K+G   +V LL++ G  ++A   +   P+H A+  G  +++ +LLE+   + A T+    P+H+     H++  ++L+ ++  ++  T      +H A + GH  + ++L+D N +          PLH AC    L +V +L+ +   I A ++    P+HVA   G + IV  L++     +  T     P+H+A      DI+ +L+ +   ++A   +   PLHIA R G+ DIV LL+Q G   D   K+ Y+ + IA K   +E+   LI
Sbjct:   18 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLI 522          

HSP 6 Score: 177.948 bits (450), Expect = 3.752e-45
Identity = 104/398 (26.13%), Postives = 201/398 (50.50%), Query Frame = 1
Query:  397 KAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIA 1590
            +AA  G+L+ V   ++NN DIN         +H A  + H+ +V  L+     V    K+    +  A  +G  E+V+LL+ +N  ++V+SQ  + P+++A +  H  VV++L+ N  +    TE  + P+  A + GH ++V +L+++    D  G+     +H A+   DV+  TLLL+   + +  ++  + P+HI  H G+     LL+    D+  + +    P+H A  +G   +V +L++   NIE    +   PLH A  +G+  +V++L+E    I A +K    P+H+A +  H++  ++L+      +  T      +H+A   G+  +  LL+    +  A  ++ + PLHIAC+     +V+LL++ G +     ++  +P+ +A
Sbjct:   17 RAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVA 410          
BLAST of Protein kinase-like domain vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 272.322 bits (695), Expect = 4.634e-76
Identity = 145/510 (28.43%), Postives = 252/510 (49.41%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLI-----------------------------QNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
            LE    K    +H A   G  +VV   I    N+NA S+  + P++ A + NH+E+VK L+E+  N    +   + P+  A   GH  +V LLI                             QN+ + +  ++  +  +H A   +++ + +LL+    +V    K    P+  A + GNV +V LL++   +ID K++    P+H A R+GH+ VV++L+     ++A T+    PIH A +  H++ V+ L+Q  + +D    ++  P+H A+  G   ++ +LL+K     A     + P+HI C K H+  + LL+ +   +E  TE    P+H A + GH  IV+ L+    +   S+ +   PLH A   G+ ++   L++N+  +DA +K D  P+H A R GH E+VK+L+      ++ T     P+HIA   G+     +L+         T   + PLH+AC+YG  D+V+LL+++G N +   KN  +P+ +A  +N
Sbjct:  104 LETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHN 613          

HSP 2 Score: 271.166 bits (692), Expect = 1.071e-75
Identity = 143/522 (27.39%), Postives = 259/522 (49.62%), Query Frame = 1
Query:  169 KDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLI-----------------------------ENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNC 1647
            +  K   P++ A    ++EVVK+ +E   N + P+E  + P+  A +  H  +V LLI                             +N  N + LS   + P+H AA Y +L + +LL+    ++N   +     +H A    +V +V+LL++    +  + K++  P+  A ++G+V +VE+L++    +  K++    PIH+A +  H+D V+ L+Q   +I+ +T  +  P+H A   GH  +VK+L+  G+  +A   N + P+H A     +  + LLL+    +EAVTE    P+H+    GHL  VK L+        +  K   P+H A   GH E+ + L+ +N  ++    ++  PLH A   G+ ++V +L+E+  + D+ +     P+H+A R GH +  ++L+ +  +    T+  + P+H+AC  G  D+V LL+    N  A   +   PLH+A  + + D+VKLL+ +G +     +N Y+ + IA K N  E+ + L+    N 
Sbjct:  140 QSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANA 661          

HSP 3 Score: 265.003 bits (676), Expect = 1.161e-73
Identity = 135/480 (28.12%), Postives = 248/480 (51.67%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            P+H A    N+ V +  + +  N+N   +    P+H A    ++ +V+LL++    I++ +  E  P+H AA  GH+++V++L+     + A+ +     IH A    H+D V+ L++ + ++     +   P+  A   G+  +V++L++   K + ++   + P+H+AC+  H+  + +L+++   +EAVTE    P+H A   GH+ IVK L+Q G++ +A       P+H A+  G  E+   LL+    V+A  +    P+H     GH E VKLLM++K + + AT     P+H A   GH +  RIL+D N        +   PLH AC  G +D+V +L+E   + +A  K    P+HVA    +L++VK+L+ KG    +     +  +HIA      ++ + L+    N  + ++    PLH+A + G  D+V LLI +  N ++ +KN  +P+ +  +  +  I + L+
Sbjct:  242 PLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLV 721          

HSP 4 Score: 264.618 bits (675), Expect = 1.924e-73
Identity = 135/483 (27.95%), Postives = 246/483 (50.93%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTID---------DWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            + P+H A   G+  +VK  ++K    NA +   + P+H AC+ NH+  + LL+++  ++E+++     P+H AAF GHL IVK L+Q     NA   K    +H A    H ++ + L++N+  V  + K+   P+  A + G+ E+V+LL+ +    D  +     P+H+A R GH    ++L+        +T+  + P+H ACKYG V++V+LL++ G+  +A G+N   P+H A    +++++ LL+ K     +     +  +HI   +  LE    L+ Y  +    + +   P+H A   G  ++V +LI    N+ + +     PLH     G++ I ++L++    + A S++ + P+HVAC  G++++VK L+++    +A+   K R   ++ L+ +     L   S C +                + PLH A + GH DIV LL++ G   + +  N  SP+ IAK+  Y
Sbjct:  372 LTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQ----QAHVNSKTR---VSVLLLDASYTGLFSVSVCTLRTFAFSFSLIFLFQLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGY 847          

HSP 5 Score: 260.381 bits (664), Expect = 4.009e-72
Identity = 129/474 (27.22%), Postives = 242/474 (51.05%), Query Frame = 1
Query:  181 NMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
             + P+H A   GNV +V+  +++   I+A ++    P+H A  N H+ +V++L++    +++ +     P+H AA   H+  V+ L+Q N +I+     +   +H A    H  +VK+L++              P+  ACK  ++  ++LL+ ++  ++  ++    P+HVA   GHL++VK L+Q      A       P+H A + GH E+ + L+QN + +DA  +++  P+H A+ +G  EL+ LL+E K + ++ T     P+HI   +GH +  ++L+D        T+K   P+H AC YG  ++V +L++   N   +      PLH A  + NLD+V +L+       + ++  +  +H+A +   LE+   L++ G    + +     P+H+A   G  D+V LLIS + N+     +   PLH+  + GH  I  +L++QG +     +  Y+P+ +A  Y 
Sbjct:  272 GITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYG 745          

HSP 6 Score: 239.195 bits (609), Expect = 6.076e-65
Identity = 131/505 (25.94%), Postives = 253/505 (50.10%), Query Frame = 1
Query:  202 ACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLIN-----------------------------NNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            A   GN+E     I+   +IN  ++     +H A +  H+++V  L+ N  ++E+ +      +H AA  G  ++V  LI    ++NA+++K +  ++ A    H+++VK L+E+  +  +  ++   P+  A + G+  +V LLIN                             N+   DV S+  + P+H+A  + +L V ++L+    ++    +    P+H A + G+V +V+LL+  G+ +DA  ++   P+H A+  G V ++ +LL++   ++A T+    PIH+     H++ V+ L+ Y  +I+  T     P+H A + GH+ +V++L+D              PLH AC   ++  +++L+++S  ++A ++    P+HVA   GHL IVK L+++G    A       P+H+A   G+ ++   L+ +   ++A   DD  PLH A R GH ++VKLL++   N D      ++P+ IA +  + +    L+
Sbjct:   52 AARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILL 556          

HSP 7 Score: 201.06 bits (510), Expect = 1.472e-52
Identity = 121/441 (27.44%), Postives = 209/441 (47.39%), Query Frame = 1
Query:  397 KAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLI-----------------------------QNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            +AA  G+L+     I+N  DIN   +     +H A    HV +V  L+ N  D+    K+    +  A  +G  ++V  LIN    ++ +SQ  + P+++A +  HL+VVK L+++  +    TE  + P+  A + GH  +V LLI                             QN    D   +  + P+H A+   ++ +  LLL +  +V    +    P+HI   +G++  V+LL+D    I+  T+ E  P+H A   GH  +V IL+D    ++        P+H A    ++D V  L++ + +ID  +     P+HVA   GH  +VK+L+ KG K  A     + P+HIAC   +   ++LL+    ++EA T     PLH+A   GH +IVK L+Q+G + +  +    +P+ +A +  + E+   L+ 
Sbjct:   51 RAARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQ 491          

HSP 8 Score: 134.035 bits (336), Expect = 2.430e-31
Identity = 77/304 (25.33%), Postives = 140/304 (46.05%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVT-----------------------------------EGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLL-LEKKCDVEAVTEMKWR 981
            K   P+H AC  G V+VV+  +E+  N NA  +    P+H A  +N++++VKLL+    +  S +   +  +H AA    L++   L+Q   + N+ + +    +H A      D+V LLI    +V + +K    P+    + G+V I ++L+     +   S+  + P+HVAC +G++ +VK L+Q +  + + T                                   +  + P+H A + GH +IV LL+++G+  +    N   P+  A  LG + +I +L L  +  V  +T  K R
Sbjct:  568 KGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRVSVLLLDASYTGLFSVSVCTLRTFAFSFSLIFLFQLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSMITTEKHR 871          
BLAST of Protein kinase-like domain vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 271.166 bits (692), Expect = 4.778e-76
Identity = 145/510 (28.43%), Postives = 252/510 (49.41%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLI-----------------------------QNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
            LE    K    +H A   G  +VV   I    N+NA S+  + P++ A + NH+E+VK L+E+  N    +   + P+  A   GH  +V LLI                             QN+ + +  ++  +  +H A   +++ + +LL+    +V    K    P+  A + GNV +V LL++   +ID K++    P+H A R+GH+ VV++L+     ++A T+    PIH A +  H++ V+ L+Q  + +D    ++  P+H A+  G   ++ +LL+K     A     + P+HI C K H+  + LL+ +   +E  TE    P+H A + GH  IV+ L+    +   S+ +   PLH A   G+ ++   L++N+  +DA +K D  P+H A R GH E+VK+L+      ++ T     P+HIA   G+     +L+         T   + PLH+AC+YG  D+V+LL+++G N +   KN  +P+ +A  +N
Sbjct:   12 LETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHN 521          

HSP 2 Score: 270.011 bits (689), Expect = 1.118e-75
Identity = 143/522 (27.39%), Postives = 259/522 (49.62%), Query Frame = 1
Query:  169 KDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLI-----------------------------ENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNC 1647
            +  K   P++ A    ++EVVK+ +E   N + P+E  + P+  A +  H  +V LLI                             +N  N + LS   + P+H AA Y +L + +LL+    ++N   +     +H A    +V +V+LL++    +  + K++  P+  A ++G+V +VE+L++    +  K++    PIH+A +  H+D V+ L+Q   +I+ +T  +  P+H A   GH  +VK+L+  G+  +A   N + P+H A     +  + LLL+    +EAVTE    P+H+    GHL  VK L+        +  K   P+H A   GH E+ + L+ +N  ++    ++  PLH A   G+ ++V +L+E+  + D+ +     P+H+A R GH +  ++L+ +  +    T+  + P+H+AC  G  D+V LL+    N  A   +   PLH+A  + + D+VKLL+ +G +     +N Y+ + IA K N  E+ + L+    N 
Sbjct:   48 QSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANA 569          

HSP 3 Score: 264.233 bits (674), Expect = 1.248e-73
Identity = 135/480 (28.12%), Postives = 248/480 (51.67%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            P+H A    N+ V +  + +  N+N   +    P+H A    ++ +V+LL++    I++ +  E  P+H AA  GH+++V++L+     + A+ +     IH A    H+D V+ L++ + ++     +   P+  A   G+  +V++L++   K + ++   + P+H+AC+  H+  + +L+++   +EAVTE    P+H A   GH+ IVK L+Q G++ +A       P+H A+  G  E+   LL+    V+A  +    P+H     GH E VKLLM++K + + AT     P+H A   GH +  RIL+D N        +   PLH AC  G +D+V +L+E   + +A  K    P+HVA    +L++VK+L+ KG    +     +  +HIA      ++ + L+    N  + ++    PLH+A + G  D+V LLI +  N ++ +KN  +P+ +  +  +  I + L+
Sbjct:  150 PLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLV 629          

HSP 4 Score: 261.922 bits (668), Expect = 7.021e-73
Identity = 132/467 (28.27%), Postives = 243/467 (52.03%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGH---ADIVKLLIQQGCNTDVLDKNRYS 1575
            + P+H A   G+  +VK  ++K    NA +   + P+H AC+ NH+  + LL+++  ++E+++     P+H AAF GHL IVK L+Q     NA   K    +H A    H ++ + L++N+  V  + K+   P+  A + G+ E+V+LL+ +    D  +     P+H+A R GH    ++L+        +T+  + P+H ACKYG V++V+LL++ G+  +A G+N   P+H A    +++++ LL+ K     +     +  +HI   +  LE    L+ Y  +    + +   P+H A   G  ++V +LI    N+ + +     PLH     G++ I ++L++    + A S++ + P+HVAC  G++++VK L+++     + T   + P+H A   G+ DIV LL+         T +   PL IA R G+    D++KL+ ++  +    +K+R S
Sbjct:  280 LTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSMITTEKHRMS 746          

HSP 5 Score: 259.61 bits (662), Expect = 4.754e-72
Identity = 129/474 (27.22%), Postives = 242/474 (51.05%), Query Frame = 1
Query:  181 NMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
             + P+H A   GNV +V+  +++   I+A ++    P+H A  N H+ +V++L++    +++ +     P+H AA   H+  V+ L+Q N +I+     +   +H A    H  +VK+L++              P+  ACK  ++  ++LL+ ++  ++  ++    P+HVA   GHL++VK L+Q      A       P+H A + GH E+ + L+QN + +DA  +++  P+H A+ +G  EL+ LL+E K + ++ T     P+HI   +GH +  ++L+D        T+K   P+H AC YG  ++V +L++   N   +      PLH A  + NLD+V +L+       + ++  +  +H+A +   LE+   L++ G    + +     P+H+A   G  D+V LLIS + N+     +   PLH+  + GH  I  +L++QG +     +  Y+P+ +A  Y 
Sbjct:  180 GITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYG 653          

HSP 6 Score: 256.529 bits (654), Expect = 5.234e-71
Identity = 134/515 (26.02%), Postives = 247/515 (47.96%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWAC---------------------------------LNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            ++ K    + P+H A   G+V VV+  +++   + A ++    PIH A + +H++ V+ L++    I+ ++     P+H AA  GH ++VK+L+      NARA   +  +H AC                                    H++IVK L++        + +   P+  A ++G+ E+ + L+ NN ++D K++ +  P+H A R GH ++VK+L+++K + ++ T     P+H A + GH +  ++L+   +      +  + P+H A   G V+++ LLLE+  +  A  +    P+H+  H  +L+ VKLL+                +H A      E+   L+    N      +   PLH A   G  D+V +LI    +++  +K    P+H+  + GH+ I  ML+++G    A +   + P+H+AC  GN  +V  L+  + ++ + T   + PLH A + GH DIV LL++ G   + +  N  SP+ IAK+  Y
Sbjct:  206 IDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGY 720          

HSP 7 Score: 223.402 bits (568), Expect = 6.122e-60
Identity = 120/460 (26.09%), Postives = 232/460 (50.43%), Query Frame = 1
Query:  337 LIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLIN-----------------------------NNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            L+ N  ++E+ +      +H AA  G  ++V  LI    ++NA+++K +  ++ A    H+++VK L+E+  +  +  ++   P+  A + G+  +V LLIN                             N+   DV S+  + P+H+A  + +L V ++L+    ++    +    P+H A + G+V +V+LL+  G+ +DA  ++   P+H A+  G V ++ +LL++   ++A T+    PIH+     H++ V+ L+ Y  +I+  T     P+H A + GH+ +V++L+D              PLH AC   ++  +++L+++S  ++A ++    P+HVA   GHL IVK L+++G    A       P+H+A   G+ ++   L+ +   ++A   DD  PLH A R GH ++VKLL++   N D      ++P+ IA +  + +    L+
Sbjct:    5 LLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILL 464          

HSP 8 Score: 201.445 bits (511), Expect = 8.763e-53
Identity = 105/418 (25.12%), Postives = 204/418 (48.80%), Query Frame = 1
Query:   79 MNDFQNFIEAVKSNKIKDIRRLFK-VQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKML 1329
            +N F     A K N ++ +  L K    LE   +  + P+H A   G++ +VK  +++  + NA +     P+H A    H E+ + L++N   +++ +  +  P+H AA  GH ++VKLL+++  + ++        +H A    H    ++L++ +       K+   P+  ACK G V++VELL+      +   +    P+HVA  H +LDVVK+L+       +     +  +H A K   +E+   L+Q G+  ++       P+H AS  G  +++ LL+ K+ +V    +    P+H+V  +GH+    +L+     +  A+     P+H AC+YG+ ++V+ L+    ++         PLH A   G+ DIV +L+++    +  +     P+ +A R G++ ++ +L
Sbjct:  310 LNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 727          

HSP 9 Score: 52.7582 bits (125), Expect = 2.528e-6
Identity = 28/105 (26.67%), Postives = 54/105 (51.43%), Query Frame = 1
Query: 1315 IVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            +V  L+  G   E  T+     +HIA L G   +V  LI+   N+ A +   + PL++A +  H ++VK L++ G N  +  ++ ++P+ +A +  +  +   LI
Sbjct:    1 MVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLI 105          
BLAST of Protein kinase-like domain vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 270.781 bits (691), Expect = 2.636e-75
Identity = 145/510 (28.43%), Postives = 252/510 (49.41%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLI-----------------------------QNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
            LE    K    +H A   G  +VV   I    N+NA S+  + P++ A + NH+E+VK L+E+  N    +   + P+  A   GH  +V LLI                             QN+ + +  ++  +  +H A   +++ + +LL+    +V    K    P+  A + GNV +V LL++   +ID K++    P+H A R+GH+ VV++L+     ++A T+    PIH A +  H++ V+ L+Q  + +D    ++  P+H A+  G   ++ +LL+K     A     + P+HI C K H+  + LL+ +   +E  TE    P+H A + GH  IV+ L+    +   S+ +   PLH A   G+ ++   L++N+  +DA +K D  P+H A R GH E+VK+L+      ++ T     P+HIA   G+     +L+         T   + PLH+AC+YG  D+V+LL+++G N +   KN  +P+ +A  +N
Sbjct:   74 LETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHN 583          

HSP 2 Score: 269.626 bits (688), Expect = 6.378e-75
Identity = 143/522 (27.39%), Postives = 259/522 (49.62%), Query Frame = 1
Query:  169 KDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLI-----------------------------ENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNC 1647
            +  K   P++ A    ++EVVK+ +E   N + P+E  + P+  A +  H  +V LLI                             +N  N + LS   + P+H AA Y +L + +LL+    ++N   +     +H A    +V +V+LL++    +  + K++  P+  A ++G+V +VE+L++    +  K++    PIH+A +  H+D V+ L+Q   +I+ +T  +  P+H A   GH  +VK+L+  G+  +A   N + P+H A     +  + LLL+    +EAVTE    P+H+    GHL  VK L+        +  K   P+H A   GH E+ + L+ +N  ++    ++  PLH A   G+ ++V +L+E+  + D+ +     P+H+A R GH +  ++L+ +  +    T+  + P+H+AC  G  D+V LL+    N  A   +   PLH+A  + + D+VKLL+ +G +     +N Y+ + IA K N  E+ + L+    N 
Sbjct:  110 QSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANA 631          

HSP 3 Score: 263.848 bits (673), Expect = 5.708e-73
Identity = 135/480 (28.12%), Postives = 248/480 (51.67%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            P+H A    N+ V +  + +  N+N   +    P+H A    ++ +V+LL++    I++ +  E  P+H AA  GH+++V++L+     + A+ +     IH A    H+D V+ L++ + ++     +   P+  A   G+  +V++L++   K + ++   + P+H+AC+  H+  + +L+++   +EAVTE    P+H A   GH+ IVK L+Q G++ +A       P+H A+  G  E+   LL+    V+A  +    P+H     GH E VKLLM++K + + AT     P+H A   GH +  RIL+D N        +   PLH AC  G +D+V +L+E   + +A  K    P+HVA    +L++VK+L+ KG    +     +  +HIA      ++ + L+    N  + ++    PLH+A + G  D+V LLI +  N ++ +KN  +P+ +  +  +  I + L+
Sbjct:  212 PLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLV 691          

HSP 4 Score: 262.692 bits (670), Expect = 1.581e-72
Identity = 136/484 (28.10%), Postives = 251/484 (51.86%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGH---ADIVKLLIQQGCNTDVLDKNRYS-PVDIAKKYNYNEIEND 1623
            + P+H A   G+  +VK  ++K    NA +   + P+H AC+ NH+  + LL+++  ++E+++     P+H AAF GHL IVK L+Q     NA   K    +H A    H ++ + L++N+  V  + K+   P+  A + G+ E+V+LL+ +    D  +     P+H+A R GH    ++L+        +T+  + P+H ACKYG V++V+LL++ G+  +A G+N   P+H A    +++++ LL+ K     +     +  +HI   +  LE    L+ Y  +    + +   P+H A   G  ++V +LI    N+ + +     PLH     G++ I ++L++    + A S++ + P+HVAC  G++++VK L+++     + T   + P+H A   G+ DIV LL+         T +   PL IA R G+    D++KL+ ++  +    +K+R S P  + +  + +E E D
Sbjct:  342 LTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSMITTEKHRMSFPETVDEILDVSEDEGD 825          

HSP 5 Score: 259.225 bits (661), Expect = 1.796e-71
Identity = 129/474 (27.22%), Postives = 242/474 (51.05%), Query Frame = 1
Query:  181 NMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
             + P+H A   GNV +V+  +++   I+A ++    P+H A  N H+ +V++L++    +++ +     P+H AA   H+  V+ L+Q N +I+     +   +H A    H  +VK+L++              P+  ACK  ++  ++LL+ ++  ++  ++    P+HVA   GHL++VK L+Q      A       P+H A + GH E+ + L+QN + +DA  +++  P+H A+ +G  EL+ LL+E K + ++ T     P+HI   +GH +  ++L+D        T+K   P+H AC YG  ++V +L++   N   +      PLH A  + NLD+V +L+       + ++  +  +H+A +   LE+   L++ G    + +     P+H+A   G  D+V LLIS + N+     +   PLH+  + GH  I  +L++QG +     +  Y+P+ +A  Y 
Sbjct:  242 GITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYG 715          

HSP 6 Score: 238.039 bits (606), Expect = 1.837e-64
Identity = 131/505 (25.94%), Postives = 253/505 (50.10%), Query Frame = 1
Query:  202 ACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLIN-----------------------------NNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            A   GN+E     I+   +IN  ++     +H A +  H+++V  L+ N  ++E+ +      +H AA  G  ++V  LI    ++NA+++K +  ++ A    H+++VK L+E+  +  +  ++   P+  A + G+  +V LLIN                             N+   DV S+  + P+H+A  + +L V ++L+    ++    +    P+H A + G+V +V+LL+  G+ +DA  ++   P+H A+  G V ++ +LL++   ++A T+    PIH+     H++ V+ L+ Y  +I+  T     P+H A + GH+ +V++L+D              PLH AC   ++  +++L+++S  ++A ++    P+HVA   GHL IVK L+++G    A       P+H+A   G+ ++   L+ +   ++A   DD  PLH A R GH ++VKLL++   N D      ++P+ IA +  + +    L+
Sbjct:   22 AARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILL 526          

HSP 7 Score: 200.29 bits (508), Expect = 3.667e-52
Identity = 105/418 (25.12%), Postives = 204/418 (48.80%), Query Frame = 1
Query:   79 MNDFQNFIEAVKSNKIKDIRRLFK-VQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKML 1329
            +N F     A K N ++ +  L K    LE   +  + P+H A   G++ +VK  +++  + NA +     P+H A    H E+ + L++N   +++ +  +  P+H AA  GH ++VKLL+++  + ++        +H A    H    ++L++ +       K+   P+  ACK G V++VELL+      +   +    P+HVA  H +LDVVK+L+       +     +  +H A K   +E+   L+Q G+  ++       P+H AS  G  +++ LL+ K+ +V    +    P+H+V  +GH+    +L+     +  A+     P+H AC+YG+ ++V+ L+    ++         PLH A   G+ DIV +L+++    +  +     P+ +A R G++ ++ +L
Sbjct:  372 LNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 789          

HSP 8 Score: 199.904 bits (507), Expect = 4.421e-52
Identity = 121/441 (27.44%), Postives = 209/441 (47.39%), Query Frame = 1
Query:  397 KAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLI-----------------------------QNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            +AA  G+L+     I+N  DIN   +     +H A    HV +V  L+ N  D+    K+    +  A  +G  ++V  LIN    ++ +SQ  + P+++A +  HL+VVK L+++  +    TE  + P+  A + GH  +V LLI                             QN    D   +  + P+H A+   ++ +  LLL +  +V    +    P+HI   +G++  V+LL+D    I+  T+ E  P+H A   GH  +V IL+D    ++        P+H A    ++D V  L++ + +ID  +     P+HVA   GH  +VK+L+ KG K  A     + P+HIAC   +   ++LL+    ++EA T     PLH+A   GH +IVK L+Q+G + +  +    +P+ +A +  + E+   L+ 
Sbjct:   21 RAARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQ 461          
BLAST of Protein kinase-like domain vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 266.544 bits (680), Expect = 7.766e-74
Identity = 149/514 (28.99%), Postives = 253/514 (49.22%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLI-----------------------------QNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILI----DSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
            LE    K    +H A   G  +VV   I    N+NA S+  + P++ A + NH+E+VK L+E+  N    +   + P+  A   GH  +V LLI                             QN+ + +  ++  +  +H A   +++ + +LL+    +V    K    P+  A + GNV +V LL++   +ID K++    P+H A R+GH+ VV++L+     ++A T+    PIH A +  H++ V+ L+Q  + +D    ++  P+H A+  G   ++ +LL+K     A     + P+HI C K H+  + LL+ +   +E  TE    P+H A + GH  IV+ L+      N NI  SD     PLH A   G+ ++   L++N+  +DA +K D  P+H A R GH E+VK+L+      ++ T     P+HIA   G+     +L+         T   + PLH+AC+YG  D+V+LL+++G N +   KN  +P+ +A  +N
Sbjct:  101 LETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVET-PLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHN 613          

HSP 2 Score: 263.848 bits (673), Expect = 6.076e-73
Identity = 142/525 (27.05%), Postives = 260/525 (49.52%), Query Frame = 1
Query:  169 KDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLI-----------------------------ENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIE---IATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNC 1647
            +  K   P++ A    ++EVVK+ +E   N + P+E  + P+  A +  H  +V LLI                             +N  N + LS   + P+H AA Y +L + +LL+    ++N   +     +H A    +V +V+LL++    +  + K++  P+  A ++G+V +VE+L++    +  K++    PIH+A +  H+D V+ L+Q   +I+ +T  +  P+H A   GH  +VK+L+  G+  +A   N + P+H A     +  + LLL+    +EAVTE    P+H+    GHL  VK L+           +++    P+H A   GH E+ + L+ +N  ++    ++  PLH A   G+ ++V +L+E+  + D+ +     P+H+A R GH +  ++L+ +  +    T+  + P+H+AC  G  D+V LL+    N  A   +   PLH+A  + + D+VKLL+ +G +     +N Y+ + IA K N  E+ + L+    N 
Sbjct:  137 QSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANA 661          

HSP 3 Score: 257.684 bits (657), Expect = 5.949e-71
Identity = 134/483 (27.74%), Postives = 249/483 (51.55%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDA---CGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            P+H A    N+ V +  + +  N+N   +    P+H A    ++ +V+LL++    I++ +  E  P+H AA  GH+++V++L+     + A+ +     IH A    H+D V+ L++ + ++     +   P+  A   G+  +V++L++   K + ++   + P+H+AC+  H+  + +L+++   +EAVTE    P+H A   GH+ IVK L+Q G++ ++     +    P+H A+  G  E+   LL+    V+A  +    P+H     GH E VKLLM++K + + AT     P+H A   GH +  RIL+D N        +   PLH AC  G +D+V +L+E   + +A  K    P+HVA    +L++VK+L+ KG    +     +  +HIA      ++ + L+    N  + ++    PLH+A + G  D+V LLI +  N ++ +KN  +P+ +  +  +  I + L+
Sbjct:  239 PLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLV 721          

HSP 4 Score: 254.603 bits (649), Expect = 7.644e-70
Identity = 135/518 (26.06%), Postives = 258/518 (49.81%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKID---VKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCN--------------------IEVSDT-------------ENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            ++ K    + P+H A   G+V VV+  +++   + A ++    PIH A + +H++ V+ L++    I+ ++     P+H AA  GH ++VK+L+      NARA   +  +H AC   H+  + LL+++   +    +    P+  A   G++ IV+ L+      +     S +   P+H+A R GH +V + L+QN   ++A  + +  P+HCA + GH E+VKLL+++ +  D+       P+H A+  G  +   +LL++      +T+  + P+H+ C  G ++ V+LL++   +   A +    P+H A ++ + ++V++L+    +                    +EV+ +             +   PLH A   G  D+V +LI    +++  +K    P+H+  + GH+ I  ML+++G    A +   + P+H+AC  GN  +V  L+  + ++ + T   + PLH A + GH DIV LL++ G   + +  N  SP+ IAK+  Y
Sbjct:  295 IDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGY 812          

HSP 5 Score: 254.218 bits (648), Expect = 7.857e-70
Identity = 128/477 (26.83%), Postives = 245/477 (51.36%), Query Frame = 1
Query:  181 NMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEA-VTEGNW--KPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
             + P+H A   GNV +V+  +++   I+A ++    P+H A  N H+ +V++L++    +++ +     P+H AA   H+  V+ L+Q N +I+     +   +H A    H  +VK+L++              P+  ACK  ++  ++LL+ ++  ++  ++    P+HVA   GHL++VK L+Q      + +   ++   P+H A + GH E+ + L+QN + +DA  +++  P+H A+ +G  EL+ LL+E K + ++ T     P+HI   +GH +  ++L+D        T+K   P+H AC YG  ++V +L++   N   +      PLH A  + NLD+V +L+       + ++  +  +H+A +   LE+   L++ G    + +     P+H+A   G  D+V LLIS + N+     +   PLH+  + GH  I  +L++QG +     +  Y+P+ +A  Y 
Sbjct:  269 GITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYG 745          

HSP 6 Score: 250.366 bits (638), Expect = 1.504e-68
Identity = 125/451 (27.72%), Postives = 234/451 (51.88%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINA---RAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            + P+H A   G+  +VK  ++K    NA +   + P+H AC+ NH+  + LL+++  ++E+++     P+H AAF GHL IVK L+Q     N+    ++     +H A    H ++ + L++N+  V  + K+   P+  A + G+ E+V+LL+ +    D  +     P+H+A R GH    ++L+        +T+  + P+H ACKYG V++V+LL++ G+  +A G+N   P+H A    +++++ LL+ K     +     +  +HI   +  LE    L+ Y  +    + +   P+H A   G  ++V +LI    N+ + +     PLH     G++ I ++L++    + A S++ + P+HVAC  G++++VK L+++     + T   + P+H A   G+ DIV LL+         T +   PL IA R G+  ++ +L
Sbjct:  369 LTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 819          

HSP 7 Score: 221.476 bits (563), Expect = 4.461e-59
Identity = 120/445 (26.97%), Postives = 232/445 (52.13%), Query Frame = 1
Query:  292 IHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLI----SSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            +H A +  H+++V  L+ N  ++E+ +      +H AA  G  ++V  LI    ++NA+++K +  ++ A    H+++VK L+E+  +  +  ++   P+  A + G+  +V LLIN   K  V+       +H+A R+       VL+QN  + + +++  + P+H A  Y ++ + +LL+  G+ ++   +N   P+H AS  G+V ++ LLL++   ++A T+ +  P+H     GH+  V++L+D    ++  T+    PIH A    H + VR L+  N  I+    ++  PLH A   G+  +V VL++     +A +   + P+H+AC+  H+  + +L++     EA TE    P+H+A  +G+ +IV  L+    S   NI +    +  PLH+A R GH ++ + L+Q     D   K+  +P+  A +  + E+
Sbjct:   79 LHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVR----LPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVET-PLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKEL 518          

HSP 8 Score: 177.948 bits (450), Expect = 4.018e-45
Identity = 101/397 (25.44%), Postives = 196/397 (49.37%), Query Frame = 1
Query:  490 IHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSD 1680
            +H A    HV +V  L+ N  D+    K+    +  A  +G  ++V  LIN    ++ +SQ  + P+++A +  HL+VVK L+++  +    TE  + P+  A + GH  +V LLI  G+     G+     +H A+   D     +LL+   + + +++  + P+HI  H  +L   +LL++   ++    +    P+H A   G+  +VR+L+D    I+    +   PLH A  NG++ +V +L++    + A +K    PIH+A +  H++ V+ L++   + +  T     P+H+A   G++ +V +L+       A  ++ + PLHIAC+  H   + LL++   + + + ++  +P+ +A    +  I   L+    +   NI   F SD
Sbjct:   79 LHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNI---FSSD 468          

HSP 9 Score: 160.229 bits (404), Expect = 1.800e-39
Identity = 90/342 (26.32%), Postives = 166/342 (48.54%), Query Frame = 1
Query:  667 SQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKC-----------------------------DIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            SQ     +H+A + GH+ +V  L+ N  D+E  T+     +H A   G  ++V  LI  G+ ++A  +  + P++ A+    +E++  LLE   +    TE  + P+ +   +GH   V LL++Y                               + ++ ++    P+H A +Y +  + ++L++   N+  +      PLH A   GN+ +V +L++    IDA +K +  P+H A R+GH+ +V++L+ +G   +A T+    PIH+A    + D V  L+     I+  T+D   PLH+A   GH  +VK+L+ +G   +    N ++P+ IA K N+
Sbjct:   72 SQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNH 413          

HSP 10 Score: 150.214 bits (378), Expect = 2.713e-36
Identity = 77/268 (28.73%), Postives = 137/268 (51.12%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWR 981
            K   P+H AC  G V+VV+  +E+  N NA  +    P+H A  +N++++VKLL+    +  S +   +  +H AA    L++   L+Q   + N+ + +    +H A      D+V LLI    +V + +K    P+    + G+V I ++L+     +   S+  + P+HVAC +G++ +VK L+Q +  + + T   + P+H A + GH +IV LL+++G+  +    N   P+  A  LG + +I +L   K   E    MK R
Sbjct:  568 KGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL---KLVTEESVSMKHR 832          
BLAST of Protein kinase-like domain vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 266.544 bits (680), Expect = 8.673e-74
Identity = 149/514 (28.99%), Postives = 253/514 (49.22%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLI-----------------------------QNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILI----DSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
            LE    K    +H A   G  +VV   I    N+NA S+  + P++ A + NH+E+VK L+E+  N    +   + P+  A   GH  +V LLI                             QN+ + +  ++  +  +H A   +++ + +LL+    +V    K    P+  A + GNV +V LL++   +ID K++    P+H A R+GH+ VV++L+     ++A T+    PIH A +  H++ V+ L+Q  + +D    ++  P+H A+  G   ++ +LL+K     A     + P+HI C K H+  + LL+ +   +E  TE    P+H A + GH  IV+ L+      N NI  SD     PLH A   G+ ++   L++N+  +DA +K D  P+H A R GH E+VK+L+      ++ T     P+HIA   G+     +L+         T   + PLH+AC+YG  D+V+LL+++G N +   KN  +P+ +A  +N
Sbjct:   82 LETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVET-PLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHN 594          

HSP 2 Score: 263.462 bits (672), Expect = 6.848e-73
Identity = 142/525 (27.05%), Postives = 260/525 (49.52%), Query Frame = 1
Query:  169 KDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLI-----------------------------ENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIE---IATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNC 1647
            +  K   P++ A    ++EVVK+ +E   N + P+E  + P+  A +  H  +V LLI                             +N  N + LS   + P+H AA Y +L + +LL+    ++N   +     +H A    +V +V+LL++    +  + K++  P+  A ++G+V +VE+L++    +  K++    PIH+A +  H+D V+ L+Q   +I+ +T  +  P+H A   GH  +VK+L+  G+  +A   N + P+H A     +  + LLL+    +EAVTE    P+H+    GHL  VK L+           +++    P+H A   GH E+ + L+ +N  ++    ++  PLH A   G+ ++V +L+E+  + D+ +     P+H+A R GH +  ++L+ +  +    T+  + P+H+AC  G  D+V LL+    N  A   +   PLH+A  + + D+VKLL+ +G +     +N Y+ + IA K N  E+ + L+    N 
Sbjct:  118 QSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANA 642          

HSP 3 Score: 257.684 bits (657), Expect = 6.289e-71
Identity = 134/483 (27.74%), Postives = 249/483 (51.55%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDA---CGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            P+H A    N+ V +  + +  N+N   +    P+H A    ++ +V+LL++    I++ +  E  P+H AA  GH+++V++L+     + A+ +     IH A    H+D V+ L++ + ++     +   P+  A   G+  +V++L++   K + ++   + P+H+AC+  H+  + +L+++   +EAVTE    P+H A   GH+ IVK L+Q G++ ++     +    P+H A+  G  E+   LL+    V+A  +    P+H     GH E VKLLM++K + + AT     P+H A   GH +  RIL+D N        +   PLH AC  G +D+V +L+E   + +A  K    P+HVA    +L++VK+L+ KG    +     +  +HIA      ++ + L+    N  + ++    PLH+A + G  D+V LLI +  N ++ +KN  +P+ +  +  +  I + L+
Sbjct:  220 PLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLV 702          

HSP 4 Score: 254.603 bits (649), Expect = 7.307e-70
Identity = 128/477 (26.83%), Postives = 245/477 (51.36%), Query Frame = 1
Query:  181 NMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEA-VTEGNW--KPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
             + P+H A   GNV +V+  +++   I+A ++    P+H A  N H+ +V++L++    +++ +     P+H AA   H+  V+ L+Q N +I+     +   +H A    H  +VK+L++              P+  ACK  ++  ++LL+ ++  ++  ++    P+HVA   GHL++VK L+Q      + +   ++   P+H A + GH E+ + L+QN + +DA  +++  P+H A+ +G  EL+ LL+E K + ++ T     P+HI   +GH +  ++L+D        T+K   P+H AC YG  ++V +L++   N   +      PLH A  + NLD+V +L+       + ++  +  +H+A +   LE+   L++ G    + +     P+H+A   G  D+V LLIS + N+     +   PLH+  + GH  I  +L++QG +     +  Y+P+ +A  Y 
Sbjct:  250 GITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYG 726          

HSP 5 Score: 254.218 bits (648), Expect = 7.934e-70
Identity = 135/518 (26.06%), Postives = 258/518 (49.81%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKID---VKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCN--------------------IEVSDT-------------ENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            ++ K    + P+H A   G+V VV+  +++   + A ++    PIH A + +H++ V+ L++    I+ ++     P+H AA  GH ++VK+L+      NARA   +  +H AC   H+  + LL+++   +    +    P+  A   G++ IV+ L+      +     S +   P+H+A R GH +V + L+QN   ++A  + +  P+HCA + GH E+VKLL+++ +  D+       P+H A+  G  +   +LL++      +T+  + P+H+ C  G ++ V+LL++   +   A +    P+H A ++ + ++V++L+    +                    +EV+ +             +   PLH A   G  D+V +LI    +++  +K    P+H+  + GH+ I  ML+++G    A +   + P+H+AC  GN  +V  L+  + ++ + T   + PLH A + GH DIV LL++ G   + +  N  SP+ IAK+  Y
Sbjct:  276 IDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGY 793          

HSP 6 Score: 250.366 bits (638), Expect = 1.464e-68
Identity = 125/451 (27.72%), Postives = 234/451 (51.88%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINA---RAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            + P+H A   G+  +VK  ++K    NA +   + P+H AC+ NH+  + LL+++  ++E+++     P+H AAF GHL IVK L+Q     N+    ++     +H A    H ++ + L++N+  V  + K+   P+  A + G+ E+V+LL+ +    D  +     P+H+A R GH    ++L+        +T+  + P+H ACKYG V++V+LL++ G+  +A G+N   P+H A    +++++ LL+ K     +     +  +HI   +  LE    L+ Y  +    + +   P+H A   G  ++V +LI    N+ + +     PLH     G++ I ++L++    + A S++ + P+HVAC  G++++VK L+++     + T   + P+H A   G+ DIV LL+         T +   PL IA R G+  ++ +L
Sbjct:  350 LTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 800          

HSP 7 Score: 221.476 bits (563), Expect = 4.506e-59
Identity = 120/445 (26.97%), Postives = 232/445 (52.13%), Query Frame = 1
Query:  292 IHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLI----SSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            +H A +  H+++V  L+ N  ++E+ +      +H AA  G  ++V  LI    ++NA+++K +  ++ A    H+++VK L+E+  +  +  ++   P+  A + G+  +V LLIN   K  V+       +H+A R+       VL+QN  + + +++  + P+H A  Y ++ + +LL+  G+ ++   +N   P+H AS  G+V ++ LLL++   ++A T+ +  P+H     GH+  V++L+D    ++  T+    PIH A    H + VR L+  N  I+    ++  PLH A   G+  +V VL++     +A +   + P+H+AC+  H+  + +L++     EA TE    P+H+A  +G+ +IV  L+    S   NI +    +  PLH+A R GH ++ + L+Q     D   K+  +P+  A +  + E+
Sbjct:   60 LHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVR----LPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVET-PLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKEL 499          

HSP 8 Score: 177.948 bits (450), Expect = 4.169e-45
Identity = 101/397 (25.44%), Postives = 196/397 (49.37%), Query Frame = 1
Query:  490 IHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSD 1680
            +H A    HV +V  L+ N  D+    K+    +  A  +G  ++V  LIN    ++ +SQ  + P+++A +  HL+VVK L+++  +    TE  + P+  A + GH  +V LLI  G+     G+     +H A+   D     +LL+   + + +++  + P+HI  H  +L   +LL++   ++    +    P+H A   G+  +VR+L+D    I+    +   PLH A  NG++ +V +L++    + A +K    PIH+A +  H++ V+ L++   + +  T     P+H+A   G++ +V +L+       A  ++ + PLHIAC+  H   + LL++   + + + ++  +P+ +A    +  I   L+    +   NI   F SD
Sbjct:   60 LHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNI---FSSD 449          

HSP 9 Score: 160.229 bits (404), Expect = 2.003e-39
Identity = 90/342 (26.32%), Postives = 166/342 (48.54%), Query Frame = 1
Query:  667 SQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKC-----------------------------DIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            SQ     +H+A + GH+ +V  L+ N  D+E  T+     +H A   G  ++V  LI  G+ ++A  +  + P++ A+    +E++  LLE   +    TE  + P+ +   +GH   V LL++Y                               + ++ ++    P+H A +Y +  + ++L++   N+  +      PLH A   GN+ +V +L++    IDA +K +  P+H A R+GH+ +V++L+ +G   +A T+    PIH+A    + D V  L+     I+  T+D   PLH+A   GH  +VK+L+ +G   +    N ++P+ IA K N+
Sbjct:   53 SQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNH 394          

HSP 10 Score: 150.214 bits (378), Expect = 2.721e-36
Identity = 77/268 (28.73%), Postives = 137/268 (51.12%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWR 981
            K   P+H AC  G V+VV+  +E+  N NA  +    P+H A  +N++++VKLL+    +  S +   +  +H AA    L++   L+Q   + N+ + +    +H A      D+V LLI    +V + +K    P+    + G+V I ++L+     +   S+  + P+HVAC +G++ +VK L+Q +  + + T   + P+H A + GH +IV LL+++G+  +    N   P+  A  LG + +I +L   K   E    MK R
Sbjct:  549 KGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL---KLVTEESVSMKHR 813          
BLAST of Protein kinase-like domain vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 265.003 bits (676), Expect = 4.088e-73
Identity = 136/474 (28.69%), Postives = 236/474 (49.79%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            + P+H A   G+V + +  ++    I A ++    PIH A + +H++ V+LL++ + +I+ ++     P+H AA  GH ++ KLL+      NARA   +  +H AC   H+ +++LL+++   +    +    P+  A   G++ IV+ L+      +V S     P+H+A R  H DV   LIQNK  + A  + +  P+HCA + GH E+V+LL++NG+  D        P+H  +  G  +   LLL+ +    ++T+    P+H+  +  HL  V+LL++              P+H A      +  R L+           +   PLH A   G+ D+V +L+    ++   +K    P+H+A + GHL I ++L+       A T   + P+H+AC  GN  +V  L+  + N+ A T   + PLH A + GH DIV LL++ G   +    N  +P+ IAK+  Y
Sbjct:  306 LTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGY 779          

HSP 2 Score: 246.514 bits (628), Expect = 4.397e-67
Identity = 142/533 (26.64%), Postives = 255/533 (47.84%), Query Frame = 1
Query:  142 LFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIV-----------------------------KLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH--ACCNC 1647
            L K   LE    K    +H A   G  +VV+  +    N+N+ S+  + P++ A + NH+ +VK L+EN  N    +   + P+  A   GH  +V                              +L+QN+ + +  ++  +  +H A   +++++ +LL+    +V    +     +  A + GNV +V LL++   +ID  ++    P+H A R+GH+ + ++L+ +   I+A T+    PIH A +  H++ V+LL+Q  + +D    ++  P+H A+  G   +  LLL+K     A     + P+HI C K H+  ++LL+     I+  TE    P+H A + GH  IV+ L+    +  V   +   PLH A    + D+ + LI+N   ++A +K D  P+H A RSGH E+V++L+  G   +  T     P+H+    G+     LL+ ++    + T     PLH+A  + H +IV+LL+ +G +     +N Y+P+ +A K    +    L+   A CN 
Sbjct:   98 LHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNA 630          

HSP 3 Score: 236.884 bits (603), Expect = 6.136e-64
Identity = 134/549 (24.41%), Postives = 252/549 (45.90%), Query Frame = 1
Query:  169 KDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPI-----------------------------HYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVT------------------------EG---------NWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            +  K   P++ A    ++ VVKF +E   N N  +E  + P+                             H A  N+      +L++N  N + LS   + P+H AA Y +L + +LL+    ++N   +     +H A    +V +V+LL++    +    K++  P+  A ++G+V I E+L+++   I  K++    PIH+A +  HLD V++L+Q +  I+ +T                        +G          + P+H ACK  H+ +++LL+++G+++DA  E+   P+H AS +G + ++  LL+K       +     P+H+     H +    L+  K  +    + ++ P+H A   GHYE+VR+L+++  + +   T    PLH     G+     +L++N     + +K    P+HVA    HL IV++L+ KG          + P+H+A    + D    L+       A ++    PLH+A + GH D+V LL+ +  N  + +K+  +P+ +A +  +  I   L+
Sbjct:  140 QSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLV 688          

HSP 4 Score: 236.113 bits (601), Expect = 1.257e-63
Identity = 119/416 (28.61%), Postives = 213/416 (51.20%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKG-CKTEAYTEGKWRPIHIACLIGNYDIVNLL 1428
            + P+H A   G+  V K  ++K    NA +   + P+H AC+ +HI +++LL+++  +I++++     P+H A+F GHL IVK L+Q     N  + K    +H A    H D+   LI+N   V    K+   P+  A +SG+ E+V LL+ N    D  +     P+H+  R GH    ++L+ N+    ++T+    P+H A  + H+ IV+LL+  G++      N + P+H A     V+    LL+      A +     P+H+   +GH + V LL+  + ++ +  +    P+H A   GH  I  +L+  + ++         PLH AC  GN+ +V  L+++  +++A +KL + P+H A + GH +IV +L++ G C  +A   G   P+ IA  +G   + ++L
Sbjct:  372 LTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNG-ITPLAIAKRLGYISVTDVL 786          

HSP 5 Score: 232.261 bits (591), Expect = 2.051e-62
Identity = 124/479 (25.89%), Postives = 241/479 (50.31%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            +H +   G+V++V   + K   +   ++     +H A      ++V+ L+ +  N+ S S   + P++ AA   HL +VK L++N  + N   E  +  +  A    H ++V  LI       ++ K +   +  A ++ +     +L+ N+   DV S+  + P+H+A  + +L+V ++L+    ++    +     +H A + G+V +V+LL+  G+ +DAC ++   P+H A   G V +  +LL+    ++A T+    PIH+     HL+ V+LL+ Y+  I+  T     P+H A + GH+ + ++L+D              PLH AC   ++ ++ +L+++   IDA ++    P+HVA   GHL IVK L++KG     ++     P+H+A    + D+ + LI ++  + A   DD  PLH A R GH ++V+LL++ G + D      ++P+ +  +  + +    L+
Sbjct:   82 LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLI----SYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLL 556          

HSP 6 Score: 194.512 bits (493), Expect = 3.080e-50
Identity = 121/443 (27.31%), Postives = 209/443 (47.18%), Query Frame = 1
Query:  397 KAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVED--KEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIV-----------------------------KLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            +AA  G+L      ++N  DIN   +     +H +    HV +V  L+  H D+V+E   K+    +  A  +G  ++V  L+N+   ++ +SQ  + P+++A +  HL VVK L++N  +    TE  + P+  A + GH  +V                              +L+QN    D   +  + P+H A+   ++ +  LLL +  +V    +     +HI   +G++  V+LL+D    I+  T+ E  P+H A   GH  I  IL+D    I+        P+H A    +LD V +L++    ID  +     P+HVA   GH  + K+L+ KG K+ A     + P+HIAC   +  ++ LL+ S  +I+A T     PLH+A   GH  IVK L+Q+G + +V      +P+ +A +  + ++ + LI 
Sbjct:   51 RAARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELL--HKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQ 491          

HSP 7 Score: 68.9366 bits (167), Expect = 3.991e-11
Identity = 27/104 (25.96%), Postives = 60/104 (57.69%), Query Frame = 1
Query:  142 LFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNC 453
            L K   + + +  ++ P+H A   G++ + +  +    ++ A +   + P+H AC   +I++VK L++++ N+ +++ + + P+H+AA  GH  IV LL++N  
Sbjct:  655 LSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGA 758          
BLAST of Protein kinase-like domain vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 262.307 bits (669), Expect = 3.137e-72
Identity = 141/507 (27.81%), Postives = 250/507 (49.31%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCN---------------IEVSDTENAR------------------PLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            + P+H A   G+V + +  ++    I A ++    PIH A + +H++ V+LL++ + +I+ ++     P+H AA  GH ++ KLL+      NARA   +  +H AC   H+ +++LL+++   +    +    P+  A   G++ IV+ L+      +V S     P+H+A R  H DV   LIQNK  + A  + +  P+HCA + GH E+V+LL++NG+  D        P+H  +  G  +   LLL+ +    ++T+  + P+H+    G ++  +LL++ +     A +    P+H A Y+ H  IVR+L++   +               ++    + AR                  PLH A   G+ D+V +L+    ++   +K    P+H+A + GHL I ++L+       A T   + P+H+AC  GN  +V  L+  + N+ A T   + PLH A + GH DIV LL++ G   +    N  +P+ IAK+  Y
Sbjct:  306 LTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGY 812          

HSP 2 Score: 251.136 bits (640), Expect = 1.324e-68
Identity = 124/448 (27.68%), Postives = 231/448 (51.56%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            + P+H A   G+  V K  ++K    NA +   + P+H AC+ +HI +++LL+++  +I++++     P+H A+F GHL IVK L+Q     N  + K    +H A    H D+   LI+N   V    K+   P+  A +SG+ E+V LL+ N    D  +     P+H+  R GH    ++L+ N+    ++T+  + P+H A KYG ++I +LL++  +  ++ G+    P+H A     + ++ LLL K           + P+H+   +  ++  + L+ +       + +   P+H A   GH ++V +L+    N+ + +  +  PLH A   G+L+I  VL+ +   + A +++ + P+HVAC  G++++VK L++      A T+  + P+H A   G+ DIV LL+ +       +++   PL IA R G+  +  +L
Sbjct:  372 LTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 819          

HSP 3 Score: 249.21 bits (635), Expect = 5.549e-68
Identity = 137/524 (26.15%), Postives = 247/524 (47.14%), Query Frame = 1
Query:  169 KDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPI-----------------------------HYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH--ACCNC 1647
            +  K   P++ A    ++ VVKF +E   N N  +E  + P+                             H A  N+      +L++N  N + LS   + P+H AA Y +L + +LL+    ++N   +     +H A    +V +V+LL++    +    K++  P+  A ++G+V I E+L+++   I  K++    PIH+A +  HLD V++L+Q +  I+ +T  +  P+H A   GH  + KLL+  G+  +A   N + P+H A     + ++ LLL+    ++AVTE    P+H+    GHL  VK L+       + + K   P+H A    H ++   LI +   +     ++  PLH A  +G+ ++V +L+EN    D P+     P+H+  R GH +  ++L+       + T+  + P+H+A   G   I  LL+    +  +       PLH+A  + H +IV+LL+ +G +     +N Y+P+ +A K    +    L+   A CN 
Sbjct:  140 QSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNA 663          

HSP 4 Score: 242.662 bits (618), Expect = 8.805e-66
Identity = 137/517 (26.50%), Postives = 249/517 (48.16%), Query Frame = 1
Query:  142 LFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLI-----------------------------QNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            L K   LE    K    +H A   G  +VV+  +    N+N+ S+  + P++ A + NH+ +VK L+EN  N    +   + P+  A   GH  +V  LI                             QN+ + +  ++  +  +H A   +++++ +LL+    +V    +     +  A + GNV +V LL++   +ID  ++    P+H A R+GH+ + ++L+ +   I+A T+    PIH A +  H++ V+LL+Q  + +D    ++  P+H A+  G   +  LLL+K     A     + P+HI C K H+  ++LL+     I+  TE    P+H A + GH  IV+ L+    +  V   +   PLH A    + D+ + LI+N   ++A +K D  P+H A RSGH E+V++L+  G   +  T     P+H+    G+     LL+ ++    + T   + PLH+A +YG   I +LL+++  + +   K   +P+ +A  +N+
Sbjct:   98 LHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNH 614          

HSP 5 Score: 235.343 bits (599), Expect = 2.071e-63
Identity = 127/482 (26.35%), Postives = 233/482 (48.34%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIE--NHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            P+H A    N+ V +  + +  N+N   +     +H A    ++ +V+LL++    I++ +  E  P+H A   GH++I ++L+ +   I A+ +     IH A    H+D V+LL++   H D +  D     P+  A   G+  + +LL++   K + ++   + P+H+AC+  H+ V+++L+++   I+AVTE    P+H A   GH+ IVK L+Q G++ +        P+H A+     ++   L++ K  V A  +    P+H     GH E V+LL++     +  T     P+H     GH +   +L+D+         +   PLH A   G + I  +L+E     ++  K    P+HVA    HL IV++L+ KG          + P+H+A    + D    L+       A ++    PLH+A + GH D+V LL+ +  N  + +K+  +P+ +A +  +  I   L+
Sbjct:  242 PLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDH--LTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLV 721          

HSP 6 Score: 232.646 bits (592), Expect = 1.415e-62
Identity = 133/531 (25.05%), Postives = 256/531 (48.21%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIFL 1785
            +H +   G+V++V   + K   +   ++     +H A      ++V+ L+ +  N+ S S   + P++ AA   HL +VK L++N  + N   E  +  +  A    H ++V  LI       ++ K +   +  A ++ +     +L+ N+   DV S+  + P+H+A  + +L+V ++L+    ++    +     +H A + G+V +V+LL+  G+ +DAC ++   P+H A   G V +  +LL+    ++A T+    PIH+     HL+ V+LL+ Y+  I+  T     P+H A + GH+ + ++L+D              PLH AC   ++ ++ +L+++   IDA ++    P+HVA   GHL IVK L++KG     ++     P+H+A    + D+ + LI ++  + A   DD  PLH A R GH ++V+LL++ G + D      ++P+ +  +  + +    L+                   +  A + S+T        +A   GK  I+E+ L
Sbjct:   82 LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLI----SYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLL-------------------DNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLL 589          

HSP 7 Score: 195.282 bits (495), Expect = 2.277e-50
Identity = 122/443 (27.54%), Postives = 208/443 (46.95%), Query Frame = 1
Query:  397 KAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVED--KEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLI-----------------------------QNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            +AA  G+L      ++N  DIN   +     +H +    HV +V  L+  H D+V+E   K+    +  A  +G  ++V  L+N+   ++ +SQ  + P+++A +  HL VVK L++N  +    TE  + P+  A + GH  +V  LI                             QN    D   +  + P+H A+   ++ +  LLL +  +V    +     +HI   +G++  V+LL+D    I+  T+ E  P+H A   GH  I  IL+D    I+        P+H A    +LD V +L++    ID  +     P+HVA   GH  + K+L+ KG K+ A     + P+HIAC   +  ++ LL+ S  +I+A T     PLH+A   GH  IVK L+Q+G + +V      +P+ +A +  + ++ + LI 
Sbjct:   51 RAARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELL--HKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQ 491          

HSP 8 Score: 68.9366 bits (167), Expect = 4.246e-11
Identity = 27/104 (25.96%), Postives = 60/104 (57.69%), Query Frame = 1
Query:  142 LFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNC 453
            L K   + + +  ++ P+H A   G++ + +  +    ++ A +   + P+H AC   +I++VK L++++ N+ +++ + + P+H+AA  GH  IV LL++N  
Sbjct:  688 LSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGA 791          
BLAST of Protein kinase-like domain vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 262.307 bits (669), Expect = 3.139e-72
Identity = 141/507 (27.81%), Postives = 250/507 (49.31%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCN---------------IEVSDTENAR------------------PLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            + P+H A   G+V + +  ++    I A ++    PIH A + +H++ V+LL++ + +I+ ++     P+H AA  GH ++ KLL+      NARA   +  +H AC   H+ +++LL+++   +    +    P+  A   G++ IV+ L+      +V S     P+H+A R  H DV   LIQNK  + A  + +  P+HCA + GH E+V+LL++NG+  D        P+H  +  G  +   LLL+ +    ++T+  + P+H+    G ++  +LL++ +     A +    P+H A Y+ H  IVR+L++   +               ++    + AR                  PLH A   G+ D+V +L+    ++   +K    P+H+A + GHL I ++L+       A T   + P+H+AC  GN  +V  L+  + N+ A T   + PLH A + GH DIV LL++ G   +    N  +P+ IAK+  Y
Sbjct:  231 LTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGY 737          

HSP 2 Score: 251.521 bits (641), Expect = 9.621e-69
Identity = 124/448 (27.68%), Postives = 231/448 (51.56%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            + P+H A   G+  V K  ++K    NA +   + P+H AC+ +HI +++LL+++  +I++++     P+H A+F GHL IVK L+Q     N  + K    +H A    H D+   LI+N   V    K+   P+  A +SG+ E+V LL+ N    D  +     P+H+  R GH    ++L+ N+    ++T+  + P+H A KYG ++I +LL++  +  ++ G+    P+H A     + ++ LLL K           + P+H+   +  ++  + L+ +       + +   P+H A   GH ++V +L+    N+ + +  +  PLH A   G+L+I  VL+ +   + A +++ + P+HVAC  G++++VK L++      A T+  + P+H A   G+ DIV LL+ +       +++   PL IA R G+  +  +L
Sbjct:  297 LTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 744          

HSP 3 Score: 248.825 bits (634), Expect = 7.643e-68
Identity = 137/524 (26.15%), Postives = 247/524 (47.14%), Query Frame = 1
Query:  169 KDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPI-----------------------------HYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH--ACCNC 1647
            +  K   P++ A    ++ VVKF +E   N N  +E  + P+                             H A  N+      +L++N  N + LS   + P+H AA Y +L + +LL+    ++N   +     +H A    +V +V+LL++    +    K++  P+  A ++G+V I E+L+++   I  K++    PIH+A +  HLD V++L+Q +  I+ +T  +  P+H A   GH  + KLL+  G+  +A   N + P+H A     + ++ LLL+    ++AVTE    P+H+    GHL  VK L+       + + K   P+H A    H ++   LI +   +     ++  PLH A  +G+ ++V +L+EN    D P+     P+H+  R GH +  ++L+       + T+  + P+H+A   G   I  LL+    +  +       PLH+A  + H +IV+LL+ +G +     +N Y+P+ +A K    +    L+   A CN 
Sbjct:   65 QSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNA 588          

HSP 4 Score: 243.432 bits (620), Expect = 4.661e-66
Identity = 140/539 (25.97%), Postives = 257/539 (47.68%), Query Frame = 1
Query:   79 MNDFQNFIEAVKSNKIKDIRRLF-KVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIV-----------------------------KLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            MN       + K   +K +  L  K   LE    K    +H A   G  +VV+  +    N+N+ S+  + P++ A + NH+ +VK L+EN  N    +   + P+  A   GH  +V                              +L+QN+ + +  ++  +  +H A   +++++ +LL+    +V    +     +  A + GNV +V LL++   +ID  ++    P+H A R+GH+ + ++L+ +   I+A T+    PIH A +  H++ V+LL+Q  + +D    ++  P+H A+  G   +  LLL+K     A     + P+HI C K H+  ++LL+     I+  TE    P+H A + GH  IV+ L+    +  V   +   PLH A    + D+ + LI+N   ++A +K D  P+H A RSGH E+V++L+  G   +  T     P+H+    G+     LL+ ++    + T   + PLH+A +YG   I +LL+++  + +   K   +P+ +A  +N+
Sbjct:    1 MNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNH 539          

HSP 5 Score: 234.958 bits (598), Expect = 2.531e-63
Identity = 127/482 (26.35%), Postives = 233/482 (48.34%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIE--NHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            P+H A    N+ V +  + +  N+N   +     +H A    ++ +V+LL++    I++ +  E  P+H A   GH++I ++L+ +   I A+ +     IH A    H+D V+LL++   H D +  D     P+  A   G+  + +LL++   K + ++   + P+H+AC+  H+ V+++L+++   I+AVTE    P+H A   GH+ IVK L+Q G++ +        P+H A+     ++   L++ K  V A  +    P+H     GH E V+LL++     +  T     P+H     GH +   +L+D+         +   PLH A   G + I  +L+E     ++  K    P+HVA    HL IV++L+ KG          + P+H+A    + D    L+       A ++    PLH+A + GH D+V LL+ +  N  + +K+  +P+ +A +  +  I   L+
Sbjct:  167 PLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDH--LTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLV 646          

HSP 6 Score: 226.483 bits (576), Expect = 1.442e-60
Identity = 128/527 (24.29%), Postives = 251/527 (47.63%), Query Frame = 1
Query:  292 IHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLIN-----------------------------NNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIFL 1785
            +H + +  H+++V  L+     +E+ +      +H AA  G   +V+ L+ +  ++N++++K +  ++ A    H+ +VK L+EN  +  +  ++   P+  A + G+  +V  LI+                             N+   DV S+  + P+H+A  + +L+V ++L+    ++    +     +H A + G+V +V+LL+  G+ +DAC ++   P+H A   G V +  +LL+    ++A T+    PIH+     HL+ V+LL+ Y+  I+  T     P+H A + GH+ + ++L+D              PLH AC   ++ ++ +L+++   IDA ++    P+HVA   GHL IVK L++KG     ++     P+H+A    + D+ + LI ++  + A   DD  PLH A R GH ++V+LL++ G + D      ++P+ +  +  + +    L+                   +  A + S+T        +A   GK  I+E+ L
Sbjct:    7 LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLL-------------------DNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLL 514          

HSP 7 Score: 68.9366 bits (167), Expect = 3.786e-11
Identity = 27/104 (25.96%), Postives = 60/104 (57.69%), Query Frame = 1
Query:  142 LFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNC 453
            L K   + + +  ++ P+H A   G++ + +  +    ++ A +   + P+H AC   +I++VK L++++ N+ +++ + + P+H+AA  GH  IV LL++N  
Sbjct:  613 LSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGA 716          
BLAST of Protein kinase-like domain vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 261.922 bits (668), Expect = 3.962e-72
Identity = 141/507 (27.81%), Postives = 250/507 (49.31%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCN---------------IEVSDTENAR------------------PLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            + P+H A   G+V + +  ++    I A ++    PIH A + +H++ V+LL++ + +I+ ++     P+H AA  GH ++ KLL+      NARA   +  +H AC   H+ +++LL+++   +    +    P+  A   G++ IV+ L+      +V S     P+H+A R  H DV   LIQNK  + A  + +  P+HCA + GH E+V+LL++NG+  D        P+H  +  G  +   LLL+ +    ++T+  + P+H+    G ++  +LL++ +     A +    P+H A Y+ H  IVR+L++   +               ++    + AR                  PLH A   G+ D+V +L+    ++   +K    P+H+A + GHL I ++L+       A T   + P+H+AC  GN  +V  L+  + N+ A T   + PLH A + GH DIV LL++ G   +    N  +P+ IAK+  Y
Sbjct:  306 LTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGY 812          

HSP 2 Score: 251.136 bits (640), Expect = 1.581e-68
Identity = 124/448 (27.68%), Postives = 231/448 (51.56%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            + P+H A   G+  V K  ++K    NA +   + P+H AC+ +HI +++LL+++  +I++++     P+H A+F GHL IVK L+Q     N  + K    +H A    H D+   LI+N   V    K+   P+  A +SG+ E+V LL+ N    D  +     P+H+  R GH    ++L+ N+    ++T+  + P+H A KYG ++I +LL++  +  ++ G+    P+H A     + ++ LLL K           + P+H+   +  ++  + L+ +       + +   P+H A   GH ++V +L+    N+ + +  +  PLH A   G+L+I  VL+ +   + A +++ + P+HVAC  G++++VK L++      A T+  + P+H A   G+ DIV LL+ +       +++   PL IA R G+  +  +L
Sbjct:  372 LTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 819          

HSP 3 Score: 249.21 bits (635), Expect = 6.507e-68
Identity = 137/524 (26.15%), Postives = 247/524 (47.14%), Query Frame = 1
Query:  169 KDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPI-----------------------------HYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH--ACCNC 1647
            +  K   P++ A    ++ VVKF +E   N N  +E  + P+                             H A  N+      +L++N  N + LS   + P+H AA Y +L + +LL+    ++N   +     +H A    +V +V+LL++    +    K++  P+  A ++G+V I E+L+++   I  K++    PIH+A +  HLD V++L+Q +  I+ +T  +  P+H A   GH  + KLL+  G+  +A   N + P+H A     + ++ LLL+    ++AVTE    P+H+    GHL  VK L+       + + K   P+H A    H ++   LI +   +     ++  PLH A  +G+ ++V +L+EN    D P+     P+H+  R GH +  ++L+       + T+  + P+H+A   G   I  LL+    +  +       PLH+A  + H +IV+LL+ +G +     +N Y+P+ +A K    +    L+   A CN 
Sbjct:  140 QSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNA 663          

HSP 4 Score: 242.276 bits (617), Expect = 1.061e-65
Identity = 137/517 (26.50%), Postives = 249/517 (48.16%), Query Frame = 1
Query:  142 LFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLI-----------------------------QNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            L K   LE    K    +H A   G  +VV+  +    N+N+ S+  + P++ A + NH+ +VK L+EN  N    +   + P+  A   GH  +V  LI                             QN+ + +  ++  +  +H A   +++++ +LL+    +V    +     +  A + GNV +V LL++   +ID  ++    P+H A R+GH+ + ++L+ +   I+A T+    PIH A +  H++ V+LL+Q  + +D    ++  P+H A+  G   +  LLL+K     A     + P+HI C K H+  ++LL+     I+  TE    P+H A + GH  IV+ L+    +  V   +   PLH A    + D+ + LI+N   ++A +K D  P+H A RSGH E+V++L+  G   +  T     P+H+    G+     LL+ ++    + T   + PLH+A +YG   I +LL+++  + +   K   +P+ +A  +N+
Sbjct:   98 LHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNH 614          

HSP 5 Score: 234.958 bits (598), Expect = 2.585e-63
Identity = 127/482 (26.35%), Postives = 233/482 (48.34%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIE--NHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            P+H A    N+ V +  + +  N+N   +     +H A    ++ +V+LL++    I++ +  E  P+H A   GH++I ++L+ +   I A+ +     IH A    H+D V+LL++   H D +  D     P+  A   G+  + +LL++   K + ++   + P+H+AC+  H+ V+++L+++   I+AVTE    P+H A   GH+ IVK L+Q G++ +        P+H A+     ++   L++ K  V A  +    P+H     GH E V+LL++     +  T     P+H     GH +   +L+D+         +   PLH A   G + I  +L+E     ++  K    P+HVA    HL IV++L+ KG          + P+H+A    + D    L+       A ++    PLH+A + GH D+V LL+ +  N  + +K+  +P+ +A +  +  I   L+
Sbjct:  242 PLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDH--LTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLV 721          

HSP 6 Score: 232.646 bits (592), Expect = 1.687e-62
Identity = 133/531 (25.05%), Postives = 256/531 (48.21%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIFL 1785
            +H +   G+V++V   + K   +   ++     +H A      ++V+ L+ +  N+ S S   + P++ AA   HL +VK L++N  + N   E  +  +  A    H ++V  LI       ++ K +   +  A ++ +     +L+ N+   DV S+  + P+H+A  + +L+V ++L+    ++    +     +H A + G+V +V+LL+  G+ +DAC ++   P+H A   G V +  +LL+    ++A T+    PIH+     HL+ V+LL+ Y+  I+  T     P+H A + GH+ + ++L+D              PLH AC   ++ ++ +L+++   IDA ++    P+HVA   GHL IVK L++KG     ++     P+H+A    + D+ + LI ++  + A   DD  PLH A R GH ++V+LL++ G + D      ++P+ +  +  + +    L+                   +  A + S+T        +A   GK  I+E+ L
Sbjct:   82 LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLI----SYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLL-------------------DNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLL 589          

HSP 7 Score: 194.897 bits (494), Expect = 2.565e-50
Identity = 122/443 (27.54%), Postives = 208/443 (46.95%), Query Frame = 1
Query:  397 KAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVED--KEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLI-----------------------------QNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            +AA  G+L      ++N  DIN   +     +H +    HV +V  L+  H D+V+E   K+    +  A  +G  ++V  L+N+   ++ +SQ  + P+++A +  HL VVK L++N  +    TE  + P+  A + GH  +V  LI                             QN    D   +  + P+H A+   ++ +  LLL +  +V    +     +HI   +G++  V+LL+D    I+  T+ E  P+H A   GH  I  IL+D    I+        P+H A    +LD V +L++    ID  +     P+HVA   GH  + K+L+ KG K+ A     + P+HIAC   +  ++ LL+ S  +I+A T     PLH+A   GH  IVK L+Q+G + +V      +P+ +A +  + ++ + LI 
Sbjct:   51 RAARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELL--HKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQ 491          

HSP 8 Score: 68.5514 bits (166), Expect = 4.510e-11
Identity = 27/104 (25.96%), Postives = 60/104 (57.69%), Query Frame = 1
Query:  142 LFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNC 453
            L K   + + +  ++ P+H A   G++ + +  +    ++ A +   + P+H AC   +I++VK L++++ N+ +++ + + P+H+AA  GH  IV LL++N  
Sbjct:  688 LSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGA 791          
BLAST of Protein kinase-like domain vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 261.922 bits (668), Expect = 4.046e-72
Identity = 141/507 (27.81%), Postives = 250/507 (49.31%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCN---------------IEVSDTENAR------------------PLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            + P+H A   G+V + +  ++    I A ++    PIH A + +H++ V+LL++ + +I+ ++     P+H AA  GH ++ KLL+      NARA   +  +H AC   H+ +++LL+++   +    +    P+  A   G++ IV+ L+      +V S     P+H+A R  H DV   LIQNK  + A  + +  P+HCA + GH E+V+LL++NG+  D        P+H  +  G  +   LLL+ +    ++T+  + P+H+    G ++  +LL++ +     A +    P+H A Y+ H  IVR+L++   +               ++    + AR                  PLH A   G+ D+V +L+    ++   +K    P+H+A + GHL I ++L+       A T   + P+H+AC  GN  +V  L+  + N+ A T   + PLH A + GH DIV LL++ G   +    N  +P+ IAK+  Y
Sbjct:  269 LTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGY 775          

HSP 2 Score: 250.751 bits (639), Expect = 1.674e-68
Identity = 124/448 (27.68%), Postives = 231/448 (51.56%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            + P+H A   G+  V K  ++K    NA +   + P+H AC+ +HI +++LL+++  +I++++     P+H A+F GHL IVK L+Q     N  + K    +H A    H D+   LI+N   V    K+   P+  A +SG+ E+V LL+ N    D  +     P+H+  R GH    ++L+ N+    ++T+  + P+H A KYG ++I +LL++  +  ++ G+    P+H A     + ++ LLL K           + P+H+   +  ++  + L+ +       + +   P+H A   GH ++V +L+    N+ + +  +  PLH A   G+L+I  VL+ +   + A +++ + P+HVAC  G++++VK L++      A T+  + P+H A   G+ DIV LL+ +       +++   PL IA R G+  +  +L
Sbjct:  335 LTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 782          

HSP 3 Score: 248.825 bits (634), Expect = 6.892e-68
Identity = 137/524 (26.15%), Postives = 247/524 (47.14%), Query Frame = 1
Query:  169 KDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPI-----------------------------HYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH--ACCNC 1647
            +  K   P++ A    ++ VVKF +E   N N  +E  + P+                             H A  N+      +L++N  N + LS   + P+H AA Y +L + +LL+    ++N   +     +H A    +V +V+LL++    +    K++  P+  A ++G+V I E+L+++   I  K++    PIH+A +  HLD V++L+Q +  I+ +T  +  P+H A   GH  + KLL+  G+  +A   N + P+H A     + ++ LLL+    ++AVTE    P+H+    GHL  VK L+       + + K   P+H A    H ++   LI +   +     ++  PLH A  +G+ ++V +L+EN    D P+     P+H+  R GH +  ++L+       + T+  + P+H+A   G   I  LL+    +  +       PLH+A  + H +IV+LL+ +G +     +N Y+P+ +A K    +    L+   A CN 
Sbjct:  103 QSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNA 626          

HSP 4 Score: 242.276 bits (617), Expect = 1.123e-65
Identity = 136/517 (26.31%), Postives = 250/517 (48.36%), Query Frame = 1
Query:  142 LFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIV-----------------------------KLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            L K   LE    K    +H A   G  +VV+  +    N+N+ S+  + P++ A + NH+ +VK L+EN  N    +   + P+  A   GH  +V                              +L+QN+ + +  ++  +  +H A   +++++ +LL+    +V    +     +  A + GNV +V LL++   +ID  ++    P+H A R+GH+ + ++L+ +   I+A T+    PIH A +  H++ V+LL+Q  + +D    ++  P+H A+  G   +  LLL+K     A     + P+HI C K H+  ++LL+     I+  TE    P+H A + GH  IV+ L+    +  V   +   PLH A    + D+ + LI+N   ++A +K D  P+H A RSGH E+V++L+  G   +  T     P+H+    G+     LL+ ++    + T   + PLH+A +YG   I +LL+++  + +   K   +P+ +A  +N+
Sbjct:   61 LHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNH 577          

HSP 5 Score: 234.958 bits (598), Expect = 2.616e-63
Identity = 127/482 (26.35%), Postives = 233/482 (48.34%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIE--NHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            P+H A    N+ V +  + +  N+N   +     +H A    ++ +V+LL++    I++ +  E  P+H A   GH++I ++L+ +   I A+ +     IH A    H+D V+LL++   H D +  D     P+  A   G+  + +LL++   K + ++   + P+H+AC+  H+ V+++L+++   I+AVTE    P+H A   GH+ IVK L+Q G++ +        P+H A+     ++   L++ K  V A  +    P+H     GH E V+LL++     +  T     P+H     GH +   +L+D+         +   PLH A   G + I  +L+E     ++  K    P+HVA    HL IV++L+ KG          + P+H+A    + D    L+       A ++    PLH+A + GH D+V LL+ +  N  + +K+  +P+ +A +  +  I   L+
Sbjct:  205 PLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDH--LTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLV 684          

HSP 6 Score: 232.646 bits (592), Expect = 1.647e-62
Identity = 133/531 (25.05%), Postives = 256/531 (48.21%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIFL 1785
            +H +   G+V++V   + K   +   ++     +H A      ++V+ L+ +  N+ S S   + P++ AA   HL +VK L++N  + N   E  +  +  A    H ++V  LI       ++ K +   +  A ++ +     +L+ N+   DV S+  + P+H+A  + +L+V ++L+    ++    +     +H A + G+V +V+LL+  G+ +DAC ++   P+H A   G V +  +LL+    ++A T+    PIH+     HL+ V+LL+ Y+  I+  T     P+H A + GH+ + ++L+D              PLH AC   ++ ++ +L+++   IDA ++    P+HVA   GHL IVK L++KG     ++     P+H+A    + D+ + LI ++  + A   DD  PLH A R GH ++V+LL++ G + D      ++P+ +  +  + +    L+                   +  A + S+T        +A   GK  I+E+ L
Sbjct:   45 LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLI----SYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLL-------------------DNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLL 552          

HSP 7 Score: 194.897 bits (494), Expect = 2.621e-50
Identity = 121/443 (27.31%), Postives = 209/443 (47.18%), Query Frame = 1
Query:  397 KAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVED--KEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIV-----------------------------KLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            +AA  G+L      ++N  DIN   +     +H +    HV +V  L+  H D+V+E   K+    +  A  +G  ++V  L+N+   ++ +SQ  + P+++A +  HL VVK L++N  +    TE  + P+  A + GH  +V                              +L+QN    D   +  + P+H A+   ++ +  LLL +  +V    +     +HI   +G++  V+LL+D    I+  T+ E  P+H A   GH  I  IL+D    I+        P+H A    +LD V +L++    ID  +     P+HVA   GH  + K+L+ KG K+ A     + P+HIAC   +  ++ LL+ S  +I+A T     PLH+A   GH  IVK L+Q+G + +V      +P+ +A +  + ++ + LI 
Sbjct:   14 RAARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELL--HKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQ 454          

HSP 8 Score: 68.9366 bits (167), Expect = 4.270e-11
Identity = 27/104 (25.96%), Postives = 60/104 (57.69%), Query Frame = 1
Query:  142 LFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNC 453
            L K   + + +  ++ P+H A   G++ + +  +    ++ A +   + P+H AC   +I++VK L++++ N+ +++ + + P+H+AA  GH  IV LL++N  
Sbjct:  651 LSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGA 754          
BLAST of Protein kinase-like domain vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 269.626 bits (688), Expect = 1.394e-75
Identity = 133/448 (29.69%), Postives = 235/448 (52.46%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            +  +H A   G+  V K  ++K  N NA +   + P+H AC+ N I++++LL++   +I++++     P+H AAF GHL IV LL+QN    +    +    +H A     V++V+ L+ N   V    +E+  P+  A + G  EIV+LL+ +    D  +   + P+H++ R G +DV  VL++        T+  + P+H A KYG +++ KLL+Q  +  D+ G+N   P+H A+   + ++  LLLEK     A  +  + P+HI   K  ++    L++Y  +    T++   P+H A   GH ++V +L+D   NI +S       LH A     +++ ++L ++  D DA +KL + P+ VAC  G++++V  L+++G    A T+  + P+H A   G+  I+N+L+       A T +    L IA R G+  +V  L
Sbjct:  345 LTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 792          

HSP 2 Score: 250.751 bits (639), Expect = 3.448e-69
Identity = 146/554 (26.35%), Postives = 254/554 (45.85%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQN-------------------------------NCDINAR------AEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDA--------------CGE-------------------NNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            K    +H A   G  EVVK  +++  NINA S+  + P++ A + NHI++VK L+EN  N  + +   + P+  A   GH Q V +L++N                               N D+ ++       E  +  +H A    +V++  LL+     V    +    P+  A K GN  +V+LL++   +ID K++    P+H A R GH  VV++L++ K  + A T+    P+H A +  HVE VK L+Q  + +D               CG                    N + P+H A     ++++ LL++    ++A+TE    PIH+    GHL  V LL+      ++   +    +H A   G  E+VR L+ +   ++    E   PLH A   G  +IV +L+++    DA +   + P+H++ R G +++  +L+  G      T+  + P+H+A   G+ D+  LL+  R   ++   +   PLH+A  Y +  +  LL+++G +     KN Y+P+ IA K N  +I + L+
Sbjct:   75 KGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLL 628          

HSP 3 Score: 248.054 bits (632), Expect = 2.745e-68
Identity = 129/491 (26.27%), Postives = 247/491 (50.31%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            ++ K    + P+H A   G+ +VV+  +E+   + A ++    P+H A + +H+E VK L++ +  ++ ++      +H AA  GH ++ KLL+    + NARA   +  +H AC    + +++LL++    +    +    PI  A   G++ IV LL+ N    DV +      +H+A R G ++VV+ L++N   ++A       P+H A + G  EIV+LL+Q+ +  DA   N + P+H ++  G V++ ++LLE        T+  + P+H+    G L+  KLL+  +   + A +    P+H A +Y + ++  +L++   +   +      PLH A     + I + L+    + +  +K    P+H+A + GH ++V +L+ KG      T+     +H+A      ++ ++L     + +A T   + PL +AC YG+  +V  L++QG N +   KN Y+P+  A +  +  I N L+ 
Sbjct:  271 IDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 761          

HSP 4 Score: 236.884 bits (603), Expect = 1.739e-64
Identity = 136/558 (24.37%), Postives = 257/558 (46.06%), Query Frame = 1
Query:  169 KDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCK-----------------------------IDVKSQF--------NWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVAC---------------------------------RSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            K D N   +  A   GN++ V  +++   +IN  ++     +H A +  H+ +V+ L+    +++S +      +H A+  G  ++VK+L++   +INA+++  +  ++ A    H+D+VK L+EN  +     ++   P+  A + G+ + V +L+ N+ K                              DV+S+          + P+H+A  +G+++V  +L+     ++        P+H A K G+  +VKLL+  G  +DA   +   P+H A+  G  +++ LLLE+K  + A T+    P+H+     H+E VK L+ YK  ++  T      +H A + GHY + ++L+D   N          PLH AC    + ++ +L++    I A ++    PIHVA                                  R+G +E+V+ L+R G   +A    +  P+HIA  +G  +IV LL+    + +A T + + PLHI+ R G  D+  +L++ G    +  K  ++P+ +A KY   ++   L+ 
Sbjct:    7 KSDSNASFLR-AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQ 563          

HSP 5 Score: 234.572 bits (597), Expect = 1.126e-63
Identity = 125/474 (26.37%), Postives = 229/474 (48.31%), Query Frame = 1
Query:  175 DKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKK 1596
            +    P+H A   GNV V    + +   ++  +     P+H A +  +  +VKLL++    I++ +     P+H AA  GH Q+V+LL++    + AR +     +H A    HV+ VK L++    V     +    +  A   G+  + +LL++     + ++   + P+H+AC+   + V+++L++    I+A+TE    PIH A   GH+ IV LL+QNG++ D         +H A+  G VE++  LL     V+A    +  P+HI    G  E V+LL+ +    + AT     P+H +   G  ++  +L+++     ++  +   PLH A   G+LD+  +L++     D+  K    P+HVA    + ++  +L+ KG    A  +  + P+HIA       I + L++        T     PLH+A + GH D+V LL+ +G N  +  K+  + + +A +
Sbjct:  210 ESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQ 683          

HSP 6 Score: 216.468 bits (550), Expect = 1.114e-57
Identity = 121/489 (24.74%), Postives = 231/489 (47.24%), Query Frame = 1
Query:  259 INAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLH 1725
            +N  +E  + P+H A    ++ +  LL+     ++  +     P+H A+  G+  +VKLL+     I+A+       +H A  + H  +V+LL+E    ++   K    P+  A +  +VE V+ L+     +D  +      +HVA   GH  V K+L+  + +  A     + P+H ACK   +++++LL++ G+++ A  E+   PIH A+ +G + ++ LLL+     +         +H+    G +E V+ L+     ++    +E+ P+H A   G  EIV++L+    + + + T    PLH +   G +D+ +VL+E        +K  + P+HVA + G L++ K+L+++    ++  +    P+H+A    N  +  LL+    +  A   + + PLHIA +     I   L+  G  T+ + K   +P+ +A +    E   D++    +   NI  + KS           LTSLH
Sbjct:  205 VNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQ----EGHTDMVTLLLDKGANIHMSTKS----------GLTSLH 679          

HSP 7 Score: 144.05 bits (362), Expect = 1.591e-34
Identity = 81/336 (24.11%), Postives = 166/336 (49.40%), Query Frame = 1
Query:  556 VVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLM--DYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSD-------TENA-RPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQ 1533
             +++  +       A ++GN++ V   +     I+  +Q     +H+A + GH+ +V+ L+     +++ T+     +H A   G  E+VK+L++ G+ ++A  +N + P++ A+    ++++  LLE   +    TE  + P+ +   +GH + V +L+  D K  + +        +H A      +   +L+ ++ N +V         TE+   PLH A   GN+++  +L+     +D  ++    P+HVA + G+  +VK+L+ +G + +A T     P+H A   G+  +V LL+  +  + A T +   PLH+A +  H + VK L+Q
Sbjct:    3 TMLQKSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPA------LHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQ 332          
BLAST of Protein kinase-like domain vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 268.855 bits (686), Expect = 4.129e-75
Identity = 133/448 (29.69%), Postives = 235/448 (52.46%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            +  +H A   G+  V K  ++K  N NA +   + P+H AC+ N I++++LL++   +I++++     P+H AAF GHL IV LL+QN    +    +    +H A     V++V+ L+ N   V    +E+  P+  A + G  EIV+LL+ +    D  +   + P+H++ R G +DV  VL++        T+  + P+H A KYG +++ KLL+Q  +  D+ G+N   P+H A+   + ++  LLLEK     A  +  + P+HI   K  ++    L++Y  +    T++   P+H A   GH ++V +L+D   NI +S       LH A     +++ ++L ++  D DA +KL + P+ VAC  G++++V  L+++G    A T+  + P+H A   G+  I+N+L+       A T +    L IA R G+  +V  L
Sbjct:  362 LTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 809          

HSP 2 Score: 250.751 bits (639), Expect = 7.130e-69
Identity = 146/554 (26.35%), Postives = 254/554 (45.85%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQN-------------------------------NCDINAR------AEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDA--------------CGE-------------------NNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            K    +H A   G  EVVK  +++  NINA S+  + P++ A + NHI++VK L+EN  N  + +   + P+  A   GH Q V +L++N                               N D+ ++       E  +  +H A    +V++  LL+     V    +    P+  A K GN  +V+LL++   +ID K++    P+H A R GH  VV++L++ K  + A T+    P+H A +  HVE VK L+Q  + +D               CG                    N + P+H A     ++++ LL++    ++A+TE    PIH+    GHL  V LL+      ++   +    +H A   G  E+VR L+ +   ++    E   PLH A   G  +IV +L+++    DA +   + P+H++ R G +++  +L+  G      T+  + P+H+A   G+ D+  LL+  R   ++   +   PLH+A  Y +  +  LL+++G +     KN Y+P+ IA K N  +I + L+
Sbjct:   92 KGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLL 645          

HSP 3 Score: 248.054 bits (632), Expect = 5.951e-68
Identity = 129/491 (26.27%), Postives = 247/491 (50.31%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            ++ K    + P+H A   G+ +VV+  +E+   + A ++    P+H A + +H+E VK L++ +  ++ ++      +H AA  GH ++ KLL+    + NARA   +  +H AC    + +++LL++    +    +    PI  A   G++ IV LL+ N    DV +      +H+A R G ++VV+ L++N   ++A       P+H A + G  EIV+LL+Q+ +  DA   N + P+H ++  G V++ ++LLE        T+  + P+H+    G L+  KLL+  +   + A +    P+H A +Y + ++  +L++   +   +      PLH A     + I + L+    + +  +K    P+H+A + GH ++V +L+ KG      T+     +H+A      ++ ++L     + +A T   + PL +AC YG+  +V  L++QG N +   KN Y+P+  A +  +  I N L+ 
Sbjct:  288 IDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 778          

HSP 4 Score: 236.498 bits (602), Expect = 3.703e-64
Identity = 133/547 (24.31%), Postives = 253/547 (46.25%), Query Frame = 1
Query:  202 ACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCK-----------------------------IDVKSQF--------NWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVAC---------------------------------RSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            A   GN++ V  +++   +IN  ++     +H A +  H+ +V+ L+    +++S +      +H A+  G  ++VK+L++   +INA+++  +  ++ A    H+D+VK L+EN  +     ++   P+  A + G+ + V +L+ N+ K                              DV+S+          + P+H+A  +G+++V  +L+     ++        P+H A K G+  +VKLL+  G  +DA   +   P+H A+  G  +++ LLLE+K  + A T+    P+H+     H+E VK L+ YK  ++  T      +H A + GHY + ++L+D   N          PLH AC    + ++ +L++    I A ++    PIHVA                                  R+G +E+V+ L+R G   +A    +  P+HIA  +G  +IV LL+    + +A T + + PLHI+ R G  D+  +L++ G    +  K  ++P+ +A KY   ++   L+ 
Sbjct:   34 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQ 580          

HSP 5 Score: 234.187 bits (596), Expect = 2.412e-63
Identity = 125/474 (26.37%), Postives = 229/474 (48.31%), Query Frame = 1
Query:  175 DKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKK 1596
            +    P+H A   GNV V    + +   ++  +     P+H A +  +  +VKLL++    I++ +     P+H AA  GH Q+V+LL++    + AR +     +H A    HV+ VK L++    V     +    +  A   G+  + +LL++     + ++   + P+H+AC+   + V+++L++    I+A+TE    PIH A   GH+ IV LL+QNG++ D         +H A+  G VE++  LL     V+A    +  P+HI    G  E V+LL+ +    + AT     P+H +   G  ++  +L+++     ++  +   PLH A   G+LD+  +L++     D+  K    P+HVA    + ++  +L+ KG    A  +  + P+HIA       I + L++        T     PLH+A + GH D+V LL+ +G N  +  K+  + + +A +
Sbjct:  227 ESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQ 700          

HSP 6 Score: 216.468 bits (550), Expect = 1.653e-57
Identity = 121/489 (24.74%), Postives = 231/489 (47.24%), Query Frame = 1
Query:  259 INAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLH 1725
            +N  +E  + P+H A    ++ +  LL+     ++  +     P+H A+  G+  +VKLL+     I+A+       +H A  + H  +V+LL+E    ++   K    P+  A +  +VE V+ L+     +D  +      +HVA   GH  V K+L+  + +  A     + P+H ACK   +++++LL++ G+++ A  E+   PIH A+ +G + ++ LLL+     +         +H+    G +E V+ L+     ++    +E+ P+H A   G  EIV++L+    + + + T    PLH +   G +D+ +VL+E        +K  + P+HVA + G L++ K+L+++    ++  +    P+H+A    N  +  LL+    +  A   + + PLHIA +     I   L+  G  T+ + K   +P+ +A +    E   D++    +   NI  + KS           LTSLH
Sbjct:  222 VNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQ----EGHTDMVTLLLDKGANIHMSTKS----------GLTSLH 696          

HSP 7 Score: 143.28 bits (360), Expect = 2.745e-34
Identity = 81/324 (25.00%), Postives = 162/324 (50.00%), Query Frame = 1
Query:  592 FYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLM--DYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSD-------TENA-RPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQ 1533
              A ++GN++ V   +     I+  +Q     +H+A + GH+ +V+ L+     +++ T+     +H A   G  E+VK+L++ G+ ++A  +N + P++ A+    ++++  LLE   +    TE  + P+ +   +GH + V +L+  D K  + +        +H A      +   +L+ ++ N +V         TE+   PLH A   GN+++  +L+     +D  ++    P+HVA + G+  +VK+L+ +G + +A T     P+H A   G+  +V LL+  +  + A T +   PLH+A +  H + VK L+Q
Sbjct:   32 LRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPA------LHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQ 349          
BLAST of Protein kinase-like domain vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 258.07 bits (658), Expect = 8.702e-71
Identity = 153/522 (29.31%), Postives = 260/522 (49.81%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQN-------------------------------NCDINAR------AEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            K    +H A   G  EVVK  +++  NINA S+  + P++ A + NHI++VK L+EN  N  + +   + P+  A   GH Q V +L++N                               N D+ ++       E  +  +H A    +V++  LL+     V    +    P+  A K GN  +V+LL++   +ID K++    P+H A R GH  VV++L++ K  + A T+    P+H A +  HVE VK L+Q  + +D    +    +H A+  G   +  LLL+K+ +  A     + P+HI C K  ++ ++LL+ Y   I+  TE    PIH A + GH  IV +L+ +  + +V++      LH A   G +++V  L+ N   +DA ++ +  P+H+A R G  EIV++L++     +A T   + P+HI+   G  D+ ++L+ +       T   + PLH+A +YG  D+ KLL+Q+    D   KN Y+P+ IA K N  +I + L++
Sbjct:   75 KGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLN 596          

HSP 2 Score: 237.654 bits (605), Expect = 3.399e-64
Identity = 132/489 (26.99%), Postives = 245/489 (50.10%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDL 1626
            ++ K    + P+H A   G+ +VV+  +E+   + A ++    P+H A + +H+E VK L++ +  ++ ++      +H AA  GH ++ KLL+    + NARA   +  +H AC    + +++LL++    +    +    PI  A   G++ IV LL+ N    DV +      +H+A R G ++VV+ L++N   ++A       P+H A + G  EIV+LL+Q+ +  DA   N + P+H ++  G V++ ++LLE        T+  + P+H+    G L+  KLL+  +   + A +    P+H A      +I   L++          +   PLH A   G+ D+V +L++   +I   +K     +H+A +   + +  +L + G   +AYT+  + P+ +AC  GN  +VN L+    N+ A T + + PLH A + GH  I+ +L+Q G   +    N  + + IAK+  Y  + + L
Sbjct:  271 IDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 759          

HSP 3 Score: 233.032 bits (593), Expect = 1.209e-62
Identity = 130/483 (26.92%), Postives = 237/483 (49.07%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            + P+H A   GN  +VK  +++   I+A +     P+H A  + H ++V+LL+E +  + + +     P+H AA   H++ VK L+Q    ++         +H A    H  + KLL++   +          P+  ACK   ++++ELL+     I   ++    PIHVA   GHL++V +L+QN    +         +H A + G VE+V+ L++NG+ +DA       P+H AS LG  E++ LLL+     +A T   + P+HI   +G ++   +L++      +AT+K   P+H A  YG  ++ ++L+      + +      PLH A     + I + L+    + +  +K    P+H+A + GH ++V +L+ KG      T+     +H+A      ++ ++L     + +A T   + PL +AC YG+  +V  L++QG N +   KN Y+P+  A +  +  I N L+ 
Sbjct:  246 ITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 728          

HSP 4 Score: 219.164 bits (557), Expect = 3.715e-58
Identity = 134/526 (25.48%), Postives = 253/526 (48.10%), Query Frame = 1
Query:  169 KDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCK-----------------------------IDVKSQF--------NWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHA 1635
            K D N   +  A   GN++ V  +++   +IN  ++     +H A +  H+ +V+ L+    +++S +      +H A+  G  ++VK+L++   +INA+++  +  ++ A    H+D+VK L+EN  +     ++   P+  A + G+ + V +L+ N+ K                              DV+S+          + P+H+A  +G+++V  +L+     ++        P+H A K G+  +VKLL+  G  +DA   +   P+H A+  G  +++ LLLE+K  + A T+    P+H+     H+E VK L+ YK  ++  T      +H A + GHY + ++L+D   N          PLH AC    + ++ +L++    I A ++    PIHVA   GHL IV +L++ G   +         +H+A   G  ++V  L+ +   ++A   ++  PLHIA R G  +IV+LL+Q   + D    N Y+P+ I+ +    ++ + L+ A
Sbjct:    7 KSDSNASFLR-AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEA 531          
BLAST of Protein kinase-like domain vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 255.373 bits (651), Expect = 4.433e-70
Identity = 120/445 (26.97%), Postives = 230/445 (51.69%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            +H A   G+ +V K  ++K  + NA +   + P+H AC+ N I +++LL+++  +I++++     P+H AAF GH+ IV  L+ +    N    +    +H A  +   ++V+ L+++   V  + K+   P+  + + G  +IV+ L+      +  +   + P+H+A R GH DV   L+ +   +   T+  + P+H A KYG +E+  LL+Q  ++ DA G++   P+H A+   + ++  LLL++     A  +  + P+HI   K  ++    L++Y  D    T +    +H A   GH ++V +L+  N N+ +S+     PLH A     +++  VL+     +DA +K+ + P+HV C  G+++IV  L++   K  A T+  +  +H A   G+  I+N+L+ +  +    T++    L IA R G+  +V  L
Sbjct:  365 LHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 809          

HSP 2 Score: 243.817 bits (621), Expect = 2.492e-66
Identity = 125/500 (25.00%), Postives = 237/500 (47.40%), Query Frame = 1
Query:  133 IRRLFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            + R   V F    D   + P+H A   GN  +VK  +++   I+A +     P+H    + H ++V++L++    I S +     P+H A    HL  V+LL+Q+N  ++         +H A    H  + K+L++       +      P+  ACK   + ++ELL+ +   I   ++    PIHVA   GH+++V  L+ +              +H A + G  E+V+ L+Q+G+ ++A  +++  P+H ++ LG  +++  LL++     A T   + P+H+   +GH +    L+D+   + I T+K   P+H A  YG  E+  +L+  + + + +      PLH A    N  +  +L++      A +K  + P+H+A +   ++I   L+  G    A T      +H+A   G+ D+V+LL+S   N+         PLH+A +    ++ ++L+ QG + D   K  Y+P+ +   Y   +I N L+ 
Sbjct:  249 LNRAAAVDFTARND---ITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQ 745          

HSP 3 Score: 243.432 bits (620), Expect = 3.305e-66
Identity = 133/519 (25.63%), Postives = 246/519 (47.40%), Query Frame = 1
Query:   82 NDFQNFIEAVKSNKIKDIRRLF---KVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            N F     A + N ++ +R L      Q L  +D     P+  A   G+ +VV   +E     +   +     +H A   +  +   LL++N  N +  S   + P+H AA YG++ +  LL+     ++  A  +   +H A    + ++VKLL++    +  + ++   P+    +SG+ ++VE+L++ +  I  K++    P+H+A +  HL+ V++L+Q+   ++ VT      +H A   GH ++ K+L+   ++ +A   N + P+H A     + ++ LLL+    ++AVTE    PIH+    GH+  V  LM +         +    +H A   G  E+VR L+     +E    ++  PLH +   G  DIV  L++     +A +   + P+H+A R GH ++   L+  G      T+  + P+H+A   G  ++ +LL+    + +A       PLH+A  Y +  +  LL+ QG +     KN Y+P+ IA K N  +I   L+
Sbjct:  133 NGFTPLYMAAQENHLEVVRFLLDNGASQSLATED--GFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLL 645          

HSP 4 Score: 242.662 bits (618), Expect = 7.099e-66
Identity = 124/511 (24.27%), Postives = 250/511 (48.92%), Query Frame = 1
Query:  169 KDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCK-----------------------------IDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            K D N   +  A   G++E    +I+   ++N  ++     +H A +  H+E+V  L++   N+++ +      +H A+  G  ++VK+L+ N  ++NA+++  +  ++ A    H+++V+ L++N     +  ++   P+  A + G+ ++V LL+ N+ K                              DV+S+  + P+H+A  +G+++V  +L+     ++     +  P+H A K G+  +VKLL+  G+ +DA   +   P+H  +  G  +++ +LL++   + + T+    P+H+     HL  V+LL+ +   ++  T      +H A + GHY++ ++L+D   +          PLH AC    + ++ +L+++   I A ++    PIHVA   GH+ IV  L+  G             +H+A   G  ++V  L+     +EA   DD  PLHI+ R G ADIV+ L+QQG + +    + Y+P+ +A +  + ++
Sbjct:   32 KSDANASYLR-AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDV 541          

HSP 5 Score: 236.884 bits (603), Expect = 4.478e-64
Identity = 122/522 (23.37%), Postives = 251/522 (48.08%), Query Frame = 1
Query:   70 FIIMNDFQNFIEAVKSNKIKDIRRLF-KVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            F   ND      A K      ++ L  +   ++ K    + P+H     G+ +VV+  +++   I + ++    P+H A + +H+  V+LL+++   ++ +++     +H AA  GH ++ K+L+      NA+A   +  +H AC    + +++LL+++   +    +    PI  A   G+V IV  L+++    +  +      +H+A R G  +VV+ L+Q+   +EA  + +  P+H + + G  +IV+ L+Q G++ +A   + + P+H A+  G  ++   LL+    +   T+  + P+H+    G LE   LL+      + A +    P+H A +Y + ++  +L+D   +   +      PLH A     +DI   L+E   D +A ++     +H+A + GH+++V +L+ +        +    P+H+A      ++  +L++   +++A T   + PLH+ C YG+  IV  L+Q     +   KN Y+ +  A +  +  I N L+ 
Sbjct:  257 FTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQ 778          

HSP 6 Score: 218.009 bits (554), Expect = 7.042e-58
Identity = 112/495 (22.63%), Postives = 230/495 (46.46%), Query Frame = 1
Query:  163 EMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNC 1647
            + K    +  +H A    + +     ++   N +  S+  + P+H A    +I +  LL+     ++  +  +  P+H A+  G+  +VKLL+     I+A+       +H    + H  +V++L++    ++ + K    P+  A +  ++  V+LL+ +N  +D  +      +HVA   GH  V KVL+  K    A     + P+H ACK   + +++LL+++G+++ A  E+   PIH A+ +G V +++ L+                +H+    G  E V+ L+     +E   + ++ P+H +   G  +IV+ L+    +   + T    PLH A   G+ D+   L+++   +   +K  + P+HVA + G LE+  +L++K    +A  +    P+H+A    N  +  LL+    +  A   + + PLHIA +    DI   L++ G + + + +   + V +A +  + ++ + L+    N 
Sbjct:  190 DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANV 684          

HSP 7 Score: 135.576 bits (340), Expect = 9.156e-32
Identity = 64/258 (24.81%), Postives = 127/258 (49.22%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLL 933
            L +   K   P+H A   G +EV    ++K  + +A  +    P+H A   ++ ++  LL++   +  + +   + P+H AA    + I   L++   D NA   +    +H A    HVD+V LL+  + +V + +K    P+  A +   V + E+L+N    +D +++  + P+HV C +G++ +V  L+Q+   + A T+  +  +H A + GH  I+ +L+QN ++ +    N    +  A  LG + ++  L
Sbjct:  552 LSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 809          
BLAST of Protein kinase-like domain vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 254.988 bits (650), Expect = 5.103e-70
Identity = 120/445 (26.97%), Postives = 230/445 (51.69%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            +H A   G+ +V K  ++K  + NA +   + P+H AC+ N I +++LL+++  +I++++     P+H AAF GH+ IV  L+ +    N    +    +H A  +   ++V+ L+++   V  + K+   P+  + + G  +IV+ L+      +  +   + P+H+A R GH DV   L+ +   +   T+  + P+H A KYG +E+  LL+Q  ++ DA G++   P+H A+   + ++  LLL++     A  +  + P+HI   K  ++    L++Y  D    T +    +H A   GH ++V +L+  N N+ +S+     PLH A     +++  VL+     +DA +K+ + P+HV C  G+++IV  L++   K  A T+  +  +H A   G+  I+N+L+ +  +    T++    L IA R G+  +V  L
Sbjct:  354 LHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 2 Score: 243.432 bits (620), Expect = 3.287e-66
Identity = 125/500 (25.00%), Postives = 237/500 (47.40%), Query Frame = 1
Query:  133 IRRLFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            + R   V F    D   + P+H A   GN  +VK  +++   I+A +     P+H    + H ++V++L++    I S +     P+H A    HL  V+LL+Q+N  ++         +H A    H  + K+L++       +      P+  ACK   + ++ELL+ +   I   ++    PIHVA   GH+++V  L+ +              +H A + G  E+V+ L+Q+G+ ++A  +++  P+H ++ LG  +++  LL++     A T   + P+H+   +GH +    L+D+   + I T+K   P+H A  YG  E+  +L+  + + + +      PLH A    N  +  +L++      A +K  + P+H+A +   ++I   L+  G    A T      +H+A   G+ D+V+LL+S   N+         PLH+A +    ++ ++L+ QG + D   K  Y+P+ +   Y   +I N L+ 
Sbjct:  238 LNRAAAVDFTARND---ITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQ 734          

HSP 3 Score: 243.047 bits (619), Expect = 4.359e-66
Identity = 133/519 (25.63%), Postives = 246/519 (47.40%), Query Frame = 1
Query:   82 NDFQNFIEAVKSNKIKDIRRLF---KVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            N F     A + N ++ +R L      Q L  +D     P+  A   G+ +VV   +E     +   +     +H A   +  +   LL++N  N +  S   + P+H AA YG++ +  LL+     ++  A  +   +H A    + ++VKLL++    +  + ++   P+    +SG+ ++VE+L++ +  I  K++    P+H+A +  HL+ V++L+Q+   ++ VT      +H A   GH ++ K+L+   ++ +A   N + P+H A     + ++ LLL+    ++AVTE    PIH+    GH+  V  LM +         +    +H A   G  E+VR L+     +E    ++  PLH +   G  DIV  L++     +A +   + P+H+A R GH ++   L+  G      T+  + P+H+A   G  ++ +LL+    + +A       PLH+A  Y +  +  LL+ QG +     KN Y+P+ IA K N  +I   L+
Sbjct:  122 NGFTPLYMAAQENHLEVVRFLLDNGASQSLATED--GFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLL 634          

HSP 4 Score: 242.276 bits (617), Expect = 8.946e-66
Identity = 121/500 (24.20%), Postives = 246/500 (49.20%), Query Frame = 1
Query:  202 ACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCK-----------------------------IDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            A   G++E    +I+   ++N  ++     +H A +  H+E+V  L++   N+++ +      +H A+  G  ++VK+L+ N  ++NA+++  +  ++ A    H+++V+ L++N     +  ++   P+  A + G+ ++V LL+ N+ K                              DV+S+  + P+H+A  +G+++V  +L+     ++     +  P+H A K G+  +VKLL+  G+ +DA   +   P+H  +  G  +++ +LL++   + + T+    P+H+     HL  V+LL+ +   ++  T      +H A + GHY++ ++L+D   +          PLH AC    + ++ +L+++   I A ++    PIHVA   GH+ IV  L+  G             +H+A   G  ++V  L+     +EA   DD  PLHI+ R G ADIV+ L+QQG + +    + Y+P+ +A +  + ++
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDV 530          

HSP 5 Score: 236.884 bits (603), Expect = 5.152e-64
Identity = 122/522 (23.37%), Postives = 251/522 (48.08%), Query Frame = 1
Query:   70 FIIMNDFQNFIEAVKSNKIKDIRRLF-KVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            F   ND      A K      ++ L  +   ++ K    + P+H     G+ +VV+  +++   I + ++    P+H A + +H+  V+LL+++   ++ +++     +H AA  GH ++ K+L+      NA+A   +  +H AC    + +++LL+++   +    +    PI  A   G+V IV  L+++    +  +      +H+A R G  +VV+ L+Q+   +EA  + +  P+H + + G  +IV+ L+Q G++ +A   + + P+H A+  G  ++   LL+    +   T+  + P+H+    G LE   LL+      + A +    P+H A +Y + ++  +L+D   +   +      PLH A     +DI   L+E   D +A ++     +H+A + GH+++V +L+ +        +    P+H+A      ++  +L++   +++A T   + PLH+ C YG+  IV  L+Q     +   KN Y+ +  A +  +  I N L+ 
Sbjct:  246 FTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQ 767          

HSP 6 Score: 217.624 bits (553), Expect = 8.390e-58
Identity = 112/495 (22.63%), Postives = 230/495 (46.46%), Query Frame = 1
Query:  163 EMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNC 1647
            + K    +  +H A    + +     ++   N +  S+  + P+H A    +I +  LL+     ++  +  +  P+H A+  G+  +VKLL+     I+A+       +H    + H  +V++L++    ++ + K    P+  A +  ++  V+LL+ +N  +D  +      +HVA   GH  V KVL+  K    A     + P+H ACK   + +++LL+++G+++ A  E+   PIH A+ +G V +++ L+                +H+    G  E V+ L+     +E   + ++ P+H +   G  +IV+ L+    +   + T    PLH A   G+ D+   L+++   +   +K  + P+HVA + G LE+  +L++K    +A  +    P+H+A    N  +  LL+    +  A   + + PLHIA +    DI   L++ G + + + +   + V +A +  + ++ + L+    N 
Sbjct:  179 DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANV 673          

HSP 7 Score: 135.191 bits (339), Expect = 1.087e-31
Identity = 64/258 (24.81%), Postives = 127/258 (49.22%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLL 933
            L +   K   P+H A   G +EV    ++K  + +A  +    P+H A   ++ ++  LL++   +  + +   + P+H AA    + I   L++   D NA   +    +H A    HVD+V LL+  + +V + +K    P+  A +   V + E+L+N    +D +++  + P+HV C +G++ +V  L+Q+   + A T+  +  +H A + GH  I+ +L+QN ++ +    N    +  A  LG + ++  L
Sbjct:  541 LSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          
BLAST of Protein kinase-like domain vs. UniProt/SwissProt
Match: sp|P16157|ANK1_HUMAN (Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3)

HSP 1 Score: 255.758 bits (652), Expect = 2.200e-69
Identity = 141/517 (27.27%), Postives = 250/517 (48.36%), Query Frame = 1
Query:  169 KDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPI-----------------------------HYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            +  K   P++ A    ++EVVKF +E   N N  +E  + P+                             H A  N+      +L++N  N + LS   + P+H AA Y +L + +LL+     +N   +     +H A    +V +V+LL++    +  + K++  P+  A ++G+V I E+L+++   I  K++    PIH+A +  HLD V++L+Q   +I+ +T  +  P+H A   GH  + K+L+  G+  ++   N + P+H A     V ++ LLL+    ++AVTE    P+H+    GHL  VK L+       ++  K   P+H A   GH E+ + L+ +   +     ++  PLH A   G+ ++V +L+EN+ + +  +     P+H+A R GH+E V  L+ K       T+  + P+H+A   G   +  LL+    +  A   +   PLH+A  + + DIVKLL+ +G +      N Y+P+ IA K N  E+   L+ 
Sbjct:  107 QSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQ 623          

HSP 2 Score: 255.758 bits (652), Expect = 2.200e-69
Identity = 131/467 (28.05%), Postives = 244/467 (52.25%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGH---ADIVKLLIQQGCNTDVLDKNRYS 1575
            + P+H A   G+  V K  ++K    N+ +   + P+H AC+ NH+ +++LL++   +I++++     P+H A+F GHL IVK L+Q     N    K    +H A    H ++ K L++N   V  + K+   P+  A + G+  +V+LL+ NN   ++ +     P+H+A R GH++ V  L++ +     +T+  + P+H A KYG V + +LL++  +  +A G+N   P+H A    +++++ LLL +     +     + P+HI   +  +E  + L+ Y       + +   P+H A   GH E+V +L+    N  + +     PLH     G++ + +VLI++   +DA +++ + P+HVA   G++++VK L++      A T+  + P+H A   G+ DIV LL+ +  +    + D   PL IA R G+    D++K++  +     V DK+R S
Sbjct:  339 LTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHRMS 805          

HSP 3 Score: 250.751 bits (639), Expect = 1.120e-67
Identity = 135/515 (26.21%), Postives = 253/515 (49.13%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCN--------------------IEVSDT-------------ENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            +E K    + P+H A   G+V + +  ++    I A ++    PIH A + +H++ V+LL++    I+ ++     P+H AA  GH ++ K+L+      N+RA   +  +H AC   HV +++LL++    +    +    P+  A   G++ IV+ L+      +V +     P+H+A R GH +V K L+QNK  + A  + +  P+HCA + GH  +VKLL++N +  +        P+H A+  G VE +  LLEK+     +T+  + P+H+    G +   +LL++       A +    P+H A ++ + +IV++L+    +                    +EV+ +             +   PLH A   G+ ++V +L+    + +  +K    P+H+  + GH+ +  +LI+ G   +A T   + P+H+A   GN  +V  L+  + ++ A T   + PLH A + GH DIV LL++ G + + +  +  +P+ IAK+  Y
Sbjct:  265 IETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGY 779          

HSP 4 Score: 247.669 bits (631), Expect = 1.010e-66
Identity = 137/487 (28.13%), Postives = 235/487 (48.25%), Query Frame = 1
Query:  142 LFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
            L K   LE    K    +H A   G  EVV+  +    N+NA S+  + P++ A + NH+E+VK L+EN  N    +   + P+  A   GH  +V  LI    +   + +     +H A  N       +L++N  +  V  K    P+  A    N+ + +LL+N    ++   Q    P+H+A R G++ +V++L+     IE  T+    P+HCA + GHV I ++L+ +G+ + A  +N   PIH A+    ++ + LLL+   +++ +T     P+H+  H GH    K+L+D              P+H AC   H  ++ +L+ +  +I+        PLH A   G+L IV  L++     +  +     P+H+A R+GH E+ K L++   K  A  +    P+H A  IG+ ++V LL+ +  N    T     PLHIA R GH + V  L+++  +   + K  ++P+ +A KY 
Sbjct:   65 LHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYG 547          

HSP 5 Score: 239.965 bits (611), Expect = 3.999e-64
Identity = 126/504 (25.00%), Postives = 242/504 (48.02%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHC---------------------------------ACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
            P+H A    N+ V +  + +  ++N   +    P+H A    ++ +V+LL++    IE+ +  E  P+H AA  GH++I ++L+ +   I A+ +     IH A    H+D V+LL++   ++     +   P+  A   G+  + ++L++   K + ++   + P+H+AC+  H+ V+++L++    I+AVTE    P+H                                  A + GH E+ K L+QN + ++A  +++  P+H A+ +G   ++ LLLE   +    T     P+HI   +GH+E V  L++ +      T+K   P+H A  YG   +  +L++ + +   +      PLH A  + NLDIV +L+       +P+   + P+H+A +   +E+ + L++ G    A +     P+H+A   G+ ++V LL+S + N          PLH+  + GH  +  +LI+ G   D   +  Y+P+ +A  Y 
Sbjct:  209 PLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYG 712          

HSP 6 Score: 226.483 bits (576), Expect = 8.215e-60
Identity = 126/487 (25.87%), Postives = 241/487 (49.49%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNE-----IENDLIHAC 1638
            +H A   G+V++V   + K   +   ++     +H A      E+V+ L+    N+ + S   + P++ AA   HL++VK L++N  + N   E  +  +  A    H ++V  LI    +   + K +   +  A ++ +     +L+ N+   DV S+  + P+H+A  + +L+V ++L+     +    +    P+H A + G+V +V+LL+  G+ ++   ++   P+H A+  G V +  +LL+    ++A T+    PIH+     HL+ V+LL+ Y  +I+  T     P+H A + GH+ + ++L+D              PLH AC   ++ ++ +L++    IDA ++    P+HVA   GHL IVK L+++G            P+H+A   G+ ++   L+ ++  + A   DD  PLH A R GH ++VKLL++   N ++     ++P+ IA +  + E     +E +   AC
Sbjct:   49 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQAC 531          

HSP 7 Score: 221.861 bits (564), Expect = 2.721e-58
Identity = 119/481 (24.74%), Postives = 242/481 (50.31%), Query Frame = 1
Query:  202 ACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            A   GN++     +    +IN  ++     +H A +  H+++V  L+     +E+ +      +H AA  G  ++V+ L+    ++NA+++K +  ++ A    H+++VK L+EN  +  V  ++   P+  A + G+  +V  LIN   K  V+       +H+A R+       VL+QN  + + +++  + P+H A  Y ++ + +LL+  G++++   +N   P+H AS  G+V ++ LLL++   +E  T+ +  P+H     GH+   ++L+D+   I+  T+    PIH A    H + VR+L+  +  I+    ++  PLH A   G+  +  VL++     ++ +   + P+H+AC+  H+ ++++L++ G   +A TE    P+H+A  +G+  IV  L+    +     +    PLH+A R GH ++ K L+Q     +   K+  +P+  A +  +  +   L+    N
Sbjct:   19 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVR----LPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNAN 495          

HSP 8 Score: 204.142 bits (518), Expect = 1.666e-52
Identity = 110/418 (26.32%), Postives = 200/418 (47.85%), Query Frame = 1
Query:   79 MNDFQNFIEAVKSNKIKDIRRLFKV-QFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKML 1329
            +N F     A K N ++ +  L K    ++   +  + P+H A   G++ +VK  +++  + N  +     P+H A    H E+ K L++N+  + + +  +  P+H AA  GH  +VKLL++NN + N         +H A    HV+ V  L+E         K+   P+  A K G V + ELL+  +   +   +    P+HVA  H +LD+VK+L+       +     + P+H A K   VE+ + L+Q G + +A       P+H A+  G  E++ LLL K+ +     +    P+H+V  +GH+    +L+ +   ++  T     P+H A +YG+ ++V+ L+    ++         PLH A   G+ DIV +L++N    +  S     P+ +A R G++ +  +L
Sbjct:  369 LNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          

HSP 9 Score: 196.438 bits (498), Expect = 4.084e-50
Identity = 121/443 (27.31%), Postives = 209/443 (47.18%), Query Frame = 1
Query:  397 KAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVED--KEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIV-----------------------------KLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            +AA  G+L      ++N  DIN   +     +H A    HV +V  L+  H ++++E   K+    +  A  +G  E+V  L+N    ++ +SQ  + P+++A +  HL+VVK L++N  +    TE  + P+  A + GH  +V                              +L+QN    D   +  + P+H A+   ++ +  LLL +   V    +    P+HI   +G++  V+LL+D    IE  T+ E  P+H A   GH  I  IL+D    I+        P+H A    +LD V +L++   +ID  +     P+HVA   GH  + K+L+ KG K  +     + P+HIAC   +  ++ LL+ +  +I+A T     PLH+A   GH  IVK L+Q+G + +V +    +P+ +A +  + E+   L+ 
Sbjct:   18 RAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELL--HKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQ 458          
BLAST of Protein kinase-like domain vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 9.595e-69
Identity = 120/445 (26.97%), Postives = 230/445 (51.69%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            +H A   G+ +V K  ++K  + NA +   + P+H AC+ N I +++LL+++  +I++++     P+H AAF GH+ IV  L+ +    N    +    +H A  +   ++V+ L+++   V  + K+   P+  + + G  +IV+ L+      +  +   + P+H+A R GH DV   L+ +   +   T+  + P+H A KYG +E+  LL+Q  ++ DA G++   P+H A+   + ++  LLL++     A  +  + P+HI   K  ++    L++Y  D    T +    +H A   GH ++V +L+  N N+ +S+     PLH A     +++  VL+     +DA +K+ + P+HV C  G+++IV  L++   K  A T+  +  +H A   G+  I+N+L+ +  +    T++    L IA R G+  +V  L
Sbjct:  354 LHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 2 Score: 242.276 bits (617), Expect = 6.373e-65
Identity = 125/500 (25.00%), Postives = 237/500 (47.40%), Query Frame = 1
Query:  133 IRRLFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            + R   V F    D   + P+H A   GN  +VK  +++   I+A +     P+H    + H ++V++L++    I S +     P+H A    HL  V+LL+Q+N  ++         +H A    H  + K+L++       +      P+  ACK   + ++ELL+ +   I   ++    PIHVA   GH+++V  L+ +              +H A + G  E+V+ L+Q+G+ ++A  +++  P+H ++ LG  +++  LL++     A T   + P+H+   +GH +    L+D+   + I T+K   P+H A  YG  E+  +L+  + + + +      PLH A    N  +  +L++      A +K  + P+H+A +   ++I   L+  G    A T      +H+A   G+ D+V+LL+S   N+         PLH+A +    ++ ++L+ QG + D   K  Y+P+ +   Y   +I N L+ 
Sbjct:  238 LNRAAAVDFTARND---ITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQ 734          

HSP 3 Score: 241.891 bits (616), Expect = 8.604e-65
Identity = 133/519 (25.63%), Postives = 246/519 (47.40%), Query Frame = 1
Query:   82 NDFQNFIEAVKSNKIKDIRRLF---KVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            N F     A + N ++ +R L      Q L  +D     P+  A   G+ +VV   +E     +   +     +H A   +  +   LL++N  N +  S   + P+H AA YG++ +  LL+     ++  A  +   +H A    + ++VKLL++    +  + ++   P+    +SG+ ++VE+L++ +  I  K++    P+H+A +  HL+ V++L+Q+   ++ VT      +H A   GH ++ K+L+   ++ +A   N + P+H A     + ++ LLL+    ++AVTE    PIH+    GH+  V  LM +         +    +H A   G  E+VR L+     +E    ++  PLH +   G  DIV  L++     +A +   + P+H+A R GH ++   L+  G      T+  + P+H+A   G  ++ +LL+    + +A       PLH+A  Y +  +  LL+ QG +     KN Y+P+ IA K N  +I   L+
Sbjct:  122 NGFTPLYMAAQENHLEVVRFLLDNGASQSLATED--GFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLL 634          

HSP 4 Score: 241.121 bits (614), Expect = 1.471e-64
Identity = 121/500 (24.20%), Postives = 246/500 (49.20%), Query Frame = 1
Query:  202 ACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCK-----------------------------IDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            A   G++E    +I+   ++N  ++     +H A +  H+E+V  L++   N+++ +      +H A+  G  ++VK+L+ N  ++NA+++  +  ++ A    H+++V+ L++N     +  ++   P+  A + G+ ++V LL+ N+ K                              DV+S+  + P+H+A  +G+++V  +L+     ++     +  P+H A K G+  +VKLL+  G+ +DA   +   P+H  +  G  +++ +LL++   + + T+    P+H+     HL  V+LL+ +   ++  T      +H A + GHY++ ++L+D   +          PLH AC    + ++ +L+++   I A ++    PIHVA   GH+ IV  L+  G             +H+A   G  ++V  L+     +EA   DD  PLHI+ R G ADIV+ L+QQG + +    + Y+P+ +A +  + ++
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDV 530          

HSP 5 Score: 235.343 bits (599), Expect = 1.172e-62
Identity = 122/522 (23.37%), Postives = 251/522 (48.08%), Query Frame = 1
Query:   70 FIIMNDFQNFIEAVKSNKIKDIRRLF-KVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            F   ND      A K      ++ L  +   ++ K    + P+H     G+ +VV+  +++   I + ++    P+H A + +H+  V+LL+++   ++ +++     +H AA  GH ++ K+L+      NA+A   +  +H AC    + +++LL+++   +    +    PI  A   G+V IV  L+++    +  +      +H+A R G  +VV+ L+Q+   +EA  + +  P+H + + G  +IV+ L+Q G++ +A   + + P+H A+  G  ++   LL+    +   T+  + P+H+    G LE   LL+      + A +    P+H A +Y + ++  +L+D   +   +      PLH A     +DI   L+E   D +A ++     +H+A + GH+++V +L+ +        +    P+H+A      ++  +L++   +++A T   + PLH+ C YG+  IV  L+Q     +   KN Y+ +  A +  +  I N L+ 
Sbjct:  246 FTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQ 767          

HSP 6 Score: 216.468 bits (550), Expect = 1.451e-56
Identity = 111/484 (22.93%), Postives = 227/484 (46.90%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            +H A    + +     ++   N +  S+  + P+H A    +I +  LL+     ++  +  +  P+H A+  G+  +VKLL+     I+A+       +H    + H  +V++L++    ++ + K    P+  A +  ++  V+LL+ +N  +D  +      +HVA   GH  V KVL+  K    A     + P+H ACK   + +++LL+++G+++ A  E+   PIH A+ +G V +++ L+                +H+    G  E V+ L+     +E   + ++ P+H +   G  +IV+ L+    +   + T    PLH A   G+ D+   L+++   +   +K  + P+HVA + G LE+  +L++K    +A  +    P+H+A    N  +  LL+    +  A   + + PLHIA +    DI   L++ G + + + +   + V +A +  + ++ + L+    N
Sbjct:  189 LHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNAN 672          

HSP 7 Score: 134.806 bits (338), Expect = 1.258e-30
Identity = 64/258 (24.81%), Postives = 127/258 (49.22%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLL 933
            L +   K   P+H A   G +EV    ++K  + +A  +    P+H A   ++ ++  LL++   +  + +   + P+H AA    + I   L++   D NA   +    +H A    HVD+V LL+  + +V + +K    P+  A +   V + E+L+N    +D +++  + P+HV C +G++ +V  L+Q+   + A T+  +  +H A + GH  I+ +L+QN ++ +    N    +  A  LG + ++  L
Sbjct:  541 LSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          
BLAST of Protein kinase-like domain vs. UniProt/SwissProt
Match: sp|Q01484|ANK2_HUMAN (Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=4)

HSP 1 Score: 252.677 bits (644), Expect = 2.950e-68
Identity = 134/448 (29.91%), Postives = 236/448 (52.68%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            +  +H A   G+  V K  ++K  N NA +   + P+H AC+ N I++++LL++   +I++++     P+H AAF GHL IV LL+QN    +    +    +H A     V++V+ L+ N   V    +E+  P+  A + G  EIV+LL+ +    D  +   + P+H++ R G +DV  VL++        T+  + P+H A KYG +++ KLL+Q  +  D+ G+N   P+H A+   + ++  LLLEK     A  +  + P+HI   K  ++    L++Y  +  I T++   P+H A   GH ++V +L+D   NI +S       LH A     +++ ++L ++  D DA +KL + P+ VAC  G++++V  L+++G    A T+  + P+H A   G+  I+N+L+       A T +    L IA R G+  +V  L
Sbjct:  366 LTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 813          

HSP 2 Score: 231.491 bits (589), Expect = 2.704e-61
Identity = 129/491 (26.27%), Postives = 248/491 (50.51%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            ++ K    + P+H A   G+ +VV+  +E+   + A ++    P+H A + +H+E VK L++++  ++ ++      +H AA  GH ++ KLL+    + NARA   +  +H AC    + +++LL++    +    +    PI  A   G++ IV LL+ N    DV +      +H+A R G ++VV+ L++N   ++A       P+H A + G  EIV+LL+Q+ +  DA   N + P+H ++  G V++ ++LLE        T+  + P+H+    G L+  KLL+  +   + A +    P+H A +Y + ++  +L++   +   +      PLH A     + I + L+    + +  +K    P+H+A + GH ++V +L+ KG      T+     +H+A      ++ ++L     + +A T   + PL +AC YG+  +V  L++QG N +   KN Y+P+  A +  +  I N L+ 
Sbjct:  292 IDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 782          

HSP 3 Score: 216.853 bits (551), Expect = 1.631e-56
Identity = 126/518 (24.32%), Postives = 246/518 (47.49%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIEN-------------------------------------RCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            P++ A    +++VVK+ +E   N +  +E  + P+  A +  H + V +L+EN                                     +  +   +   + P+H AA YG++ +  LL+     ++  A      +H A    + ++VKLL++    +  + ++   P+  A +SG+ ++VELL+     +  +++    P+H+A +  H++ VK L+Q+K  ++ VT      +H A   GH  + KLL+   +  +A   N + P+H A     ++++ LL++    ++A+TE    PIH+    GHL  V LL+      ++   +    +H A   G  E+VR L+ +   ++    E   PLH A   G  +IV +L+++    DA +   + P+H++ R G +++  +L+  G      T+  + P+H+A   G+ D+  LL+  R   ++   +   PLH+A  Y +  +  LL+++G +     KN Y+P+ IA K N  +I + L++
Sbjct:  133 PLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLN 650          

HSP 4 Score: 216.083 bits (549), Expect = 2.923e-56
Identity = 131/504 (25.99%), Postives = 242/504 (48.02%), Query Frame = 1
Query:  175 DKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDED 1686
            +    P+H A   GNV V    + +   ++  +     P+H A +  +  +VKLL++    I++ +     P+H AA  GH Q+V+LL++    + AR +     +H A    HV+ VK L+++   V     +    +  A   G+  + +LL++     + ++   + P+H+AC+   + V+++L++    I+A+TE    PIH A   GH+ IV LL+QNG++ D         +H A+  G VE++  LL     V+A    +  P+HI    G  E V+LL+ +    + AT     P+H +   G  ++  +L+++     ++  +   PLH A   G+LD+  +L++     D+  K    P+HVA    + ++  +L+ KG    A  +  + P+HIA       I + L++        T     PLH+A + GH D+V LL+ +G N  +  K+  + + +A        + D ++     + +ILT   +D+D
Sbjct:  231 ESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAA-------QEDKVN-----VADILTKHGADQD 722          

HSP 5 Score: 214.542 bits (545), Expect = 7.985e-56
Identity = 132/526 (25.10%), Postives = 252/526 (47.91%), Query Frame = 1
Query:  169 KDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCK-----------------------------IDVKSQF--------NWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHA 1635
            K D N   +  A   GN++ V  +++   +IN  ++     +H A +  H+ +V+ L+    +++S +      +H A+  G  ++VK+L++   +INA+++  +  ++ A    H+D+VK L+EN  +     ++   P+  A + G+ + V +L+ N+ K                              DV+S+          + P+H+A  +G+++V  +L+     ++        P+H A K G+  +VKLL+  G  +DA   +   P+H A+  G  +++ LLLE+   + A T+    P+H+     H+E VK L+ +K  ++  T      +H A + GHY + ++L+D   N          PLH AC    + ++ +L++    I A ++    PIHVA   GHL IV +L++ G   +         +H+A   G  ++V  L+ +   ++A   ++  PLHIA R G  +IV+LL+Q   + D    N Y+P+ I+ +    ++ + L+ A
Sbjct:   28 KSDSNASFLR-AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEA 552          

HSP 6 Score: 199.134 bits (505), Expect = 7.612e-51
Identity = 114/465 (24.52%), Postives = 226/465 (48.60%), Query Frame = 1
Query:  259 INAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIH 1653
            +N  +E  + P+H A    ++ +  LL+     ++  +     P+H A+  G+  +VKLL+     I+A+       +H A  + H  +V+LL+E    ++   K    P+  A +  +VE V+ L+ +   +D  +      +HVA   GH  V K+L+  + +  A     + P+H ACK   +++++LL++ G+++ A  E+   PIH A+ +G + ++ LLL+     +         +H+    G +E V+ L+     ++    +E+ P+H A   G  EIV++L+    + + + T    PLH +   G +D+ +VL+E        +K  + P+HVA + G L++ K+L+++    ++  +    P+H+A    N  +  LL+    +  A   + + PLHIA +     I   L+  G  T+++ K   +P+ +A +  + ++   L+    N IH
Sbjct:  226 VNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGAN-IH 689          

HSP 7 Score: 108.612 bits (270), Expect = 1.478e-22
Identity = 57/252 (22.62%), Postives = 122/252 (48.41%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLL 933
            K   P+H A   G+++V K  +++    ++  +    P+H A   ++ ++  LL+E   +  + +   + P+H AA    +QI   L+    + N   ++    +H A    H D+V LL++   ++ +  K     +  A +   V + ++L  +    D  ++  + P+ VAC +G++ +V  L++   ++ A T+  + P+H A + GH  I+ +L+Q+G+  +A   N    +  A  LG + ++  L
Sbjct:  562 KGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 813          
BLAST of Protein kinase-like domain vs. UniProt/SwissProt
Match: sp|Q8C8R3|ANK2_MOUSE (Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2)

HSP 1 Score: 250.366 bits (638), Expect = 1.809e-67
Identity = 133/448 (29.69%), Postives = 235/448 (52.46%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            +  +H A   G+  V K  ++K  N NA +   + P+H AC+ N I++++LL++   +I++++     P+H AAF GHL IV LL+QN    +    +    +H A     V++V+ L+ N   V    +E+  P+  A + G  EIV+LL+ +    D  +   + P+H++ R G +DV  VL++        T+  + P+H A KYG +++ KLL+Q  +  D+ G+N   P+H A+   + ++  LLLEK     A  +  + P+HI   K  ++    L++Y  +    T++   P+H A   GH ++V +L+D   NI +S       LH A     +++ ++L ++  D DA +KL + P+ VAC  G++++V  L+++G    A T+  + P+H A   G+  I+N+L+       A T +    L IA R G+  +V  L
Sbjct:  366 LTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 813          

HSP 2 Score: 231.491 bits (589), Expect = 2.552e-61
Identity = 129/491 (26.27%), Postives = 247/491 (50.31%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            ++ K    + P+H A   G+ +VV+  +E+   + A ++    P+H A + +H+E VK L++ +  ++ ++      +H AA  GH ++ KLL+    + NARA   +  +H AC    + +++LL++    +    +    PI  A   G++ IV LL+ N    DV +      +H+A R G ++VV+ L++N   ++A       P+H A + G  EIV+LL+Q+ +  DA   N + P+H ++  G V++ ++LLE        T+  + P+H+    G L+  KLL+  +   + A +    P+H A +Y + ++  +L++   +   +      PLH A     + I + L+    + +  +K    P+H+A + GH ++V +L+ KG      T+     +H+A      ++ ++L     + +A T   + PL +AC YG+  +V  L++QG N +   KN Y+P+  A +  +  I N L+ 
Sbjct:  292 IDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 782          

HSP 3 Score: 230.72 bits (587), Expect = 5.216e-61
Identity = 146/555 (26.31%), Postives = 255/555 (45.95%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQN-------------------------------NCDINAR------AEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLD--------------ACGE-------------------NNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            K    +H A   G  EVVK  +++  NINA S+  + P++ A + NHI++VK L+EN  N  + +   + P+  A   GH Q V +L++N                               N D+ ++       E  +  +H A    +V++  LL+     V    +    P+  A K GN  +V+LL++   +ID K++    P+H A R GH  VV++L++ K  + A T+    P+H A +  HVE VK L+Q  + +D               CG                    N + P+H A     ++++ LL++    ++A+TE    PIH+    GHL  V LL+      ++   +    +H A   G  E+VR L+ +   ++    E   PLH A   G  +IV +L+++    DA +   + P+H++ R G +++  +L+  G      T+  + P+H+A   G+ D+  LL+  R   ++   +   PLH+A  Y +  +  LL+++G +     KN Y+P+ IA K N  +I + L++
Sbjct:   96 KGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLN 650          

HSP 4 Score: 219.164 bits (557), Expect = 2.599e-57
Identity = 134/526 (25.48%), Postives = 253/526 (48.10%), Query Frame = 1
Query:  169 KDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCK-----------------------------IDVKSQF--------NWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHA 1635
            K D N   +  A   GN++ V  +++   +IN  ++     +H A +  H+ +V+ L+    +++S +      +H A+  G  ++VK+L++   +INA+++  +  ++ A    H+D+VK L+EN  +     ++   P+  A + G+ + V +L+ N+ K                              DV+S+          + P+H+A  +G+++V  +L+     ++        P+H A K G+  +VKLL+  G  +DA   +   P+H A+  G  +++ LLLE+K  + A T+    P+H+     H+E VK L+ YK  ++  T      +H A + GHY + ++L+D   N          PLH AC    + ++ +L++    I A ++    PIHVA   GHL IV +L++ G   +         +H+A   G  ++V  L+ +   ++A   ++  PLHIA R G  +IV+LL+Q   + D    N Y+P+ I+ +    ++ + L+ A
Sbjct:   28 KSDSNASFLR-AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEA 552          

HSP 5 Score: 214.927 bits (546), Expect = 6.245e-56
Identity = 125/474 (26.37%), Postives = 229/474 (48.31%), Query Frame = 1
Query:  175 DKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKK 1596
            +    P+H A   GNV V    + +   ++  +     P+H A +  +  +VKLL++    I++ +     P+H AA  GH Q+V+LL++    + AR +     +H A    HV+ VK L++    V     +    +  A   G+  + +LL++     + ++   + P+H+AC+   + V+++L++    I+A+TE    PIH A   GH+ IV LL+QNG++ D         +H A+  G VE++  LL     V+A    +  P+HI    G  E V+LL+ +    + AT     P+H +   G  ++  +L+++     ++  +   PLH A   G+LD+  +L++     D+  K    P+HVA    + ++  +L+ KG    A  +  + P+HIA       I + L++        T     PLH+A + GH D+V LL+ +G N  +  K+  + + +A +
Sbjct:  231 ESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQ 704          

HSP 6 Score: 197.593 bits (501), Expect = 2.585e-50
Identity = 114/465 (24.52%), Postives = 224/465 (48.17%), Query Frame = 1
Query:  259 INAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIH 1653
            +N  +E  + P+H A    ++ +  LL+     ++  +     P+H A+  G+  +VKLL+     I+A+       +H A  + H  +V+LL+E    ++   K    P+  A +  +VE V+ L+     +D  +      +HVA   GH  V K+L+  + +  A     + P+H ACK   +++++LL++ G+++ A  E+   PIH A+ +G + ++ LLL+     +         +H+    G +E V+ L+     ++    +E+ P+H A   G  EIV++L+    + + + T    PLH +   G +D+ +VL+E        +K  + P+HVA + G L++ K+L+++    ++  +    P+H+A    N  +  LL+    +  A   + + PLHIA +     I   L+  G  T+ + K   +P+ +A +  + ++   L+    N IH
Sbjct:  226 VNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGAN-IH 689          
BLAST of Protein kinase-like domain vs. UniProt/SwissProt
Match: sp|Q02357|ANK1_MOUSE (Ankyrin-1 OS=Mus musculus OX=10090 GN=Ank1 PE=1 SV=2)

HSP 1 Score: 246.128 bits (627), Expect = 2.967e-66
Identity = 133/484 (27.48%), Postives = 249/484 (51.45%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGH---ADIVKLLIQQGCNTDVLDKNRYS-PVDIAKKYNYNEIEND 1623
            + P+H A   G+  V K  ++K    N+ +   + P+H AC+ NHI +++LL++   +I++++     P+H A+F GHL IVK L+Q     N    K    +H A    H ++ K L++N      + K+   P+  A + G+  +V+LL+ N    ++ +     P+H A R GH+D    L++ +     +T+  + P+H A KYG V + +LL+++ +  +A G+N   P+H A    +++++ LLL +     +     + P+HI   +  +E  + L+ Y       + +   P+H A   GH E+V +L+    N  + +     PLH     G++ + +VLI++   +DA +++ + P+HVA   G++++VK L++      A T+  + P+H A   G+ DIV LL+ +  +    + +   PL IA R G+    D++K++  +     V DK+R S P  + +  + +E E D
Sbjct:  335 LTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVLKVVTDETSVVLVSDKHRMSYPETVDEILDVSEDEGD 818          

HSP 2 Score: 245.743 bits (626), Expect = 4.195e-66
Identity = 138/517 (26.69%), Postives = 243/517 (47.00%), Query Frame = 1
Query:  169 KDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPI-----------------------------HYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            +  K   P++ A    ++EVVKF +E   N N  +E  + P+                             H A  N+      +L++N  N + LS   + P+H AA Y +L + +LL+     +N   +     +H A    +V +V+LL++    +    K++  P+  A ++G+V I E+L+++   I  K++    PIH+A +  HLD V++L+Q   +I+ +T  +  P+H A   GH  + K+L+  G+  ++   N + P+H A     + ++ LLL+    ++AVTE    P+H+    GHL  VK L+       ++  K   P+H A   GH E+ + L+ +         ++  PLH A   G+  +V +L+EN    +  +     P+H A R GH++    L+ K       T+  + P+H+A   G   +  LL+    +  A   +   PLH+A  + + DIVKLL+ +G +      N Y+P+ IA K N  E+   L+ 
Sbjct:  103 QSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQ 619          

HSP 3 Score: 244.588 bits (623), Expect = 1.218e-65
Identity = 135/515 (26.21%), Postives = 254/515 (49.32%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCN--------------------IEVSDT-------------ENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            +E +    + P+H A   G+V + +  ++    I A ++    PIH A + +H++ V+LL++    I+ ++     P+H AA  GH ++ K+L+      N+RA   +  +H AC   H+ +++LL++    +    +    P+  A   G++ IV+ L+      +V +     P+H+A R GH +V K L+QNK    A  + +  P+HCA + GH  +VKLL++NG++ +        P+H A+  G V+    LLEK+     +T+  + P+H+    G +   +LL+++      A +    P+H A ++ + +IV++L+    +                    IEV+ +             +   PLH A   G+ ++V +L+    + +  +K    P+H+  + GH+ +  +LI+ G   +A T   + P+H+A   GN  +V  L+  + ++ A T   + PLH A + GH DIV LL++ G + + +  N  +P+ IAK+  Y
Sbjct:  261 IETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGY 775          

HSP 4 Score: 237.654 bits (605), Expect = 2.113e-63
Identity = 135/487 (27.72%), Postives = 232/487 (47.64%), Query Frame = 1
Query:  142 LFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
            L K   LE    K    +H A   G  EVV+  +    N+NA S+  + P++ A + NH+E+VK L+EN  N    +   + P+  A   GH  +V  LI    +   + +     +H A  N       +L++N  +  V  K    P+  A    N+ + +LL+N    ++   Q    P+H+A R G++ +V++L+     IE  T+    P+HCA + GHV I ++L+ +G+ + A  +N   PIH A+    ++ + LLL+   +++ +T     P+H+  H GH    K+L+D              P+H AC   H  ++ +L+ +  +I+        PLH A   G+L IV  L++     +  +     P+H+A R+GH E+ K L++   K  A  +    P+H A  IG+  +V LL+ +  +    T     PLH A R GH D    L+++  +   + K  ++P+ +A KY 
Sbjct:   61 LHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYG 543          

HSP 5 Score: 231.106 bits (588), Expect = 2.982e-61
Identity = 123/504 (24.40%), Postives = 239/504 (47.42%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACG---------------------------------ENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
            P+H A    N+ V +  + +  ++N   +    P+H A    ++ +V+LL++    IE+ +  E  P+H AA  GH++I ++L+ +   I A+ +     IH A    H+D V+LL++ + ++     +   P+  A   G+  + ++L++   K + ++   + P+H+AC+  H+ V+++L++    I+AVTE    P+H A   GH+ IVK L+Q G++ +                                    +++  P+H A+ +G   ++ LLLE        T     P+H    +GH++    L++ +      T+K   P+H A  YG   +  +L++ + +   +      PLH A  + NLDIV +L+       +P+   + P+H+A +   +E+ + L++ G    A +     P+H+A   G+ ++V LL+S + N          PLH+  + GH  +  +LI+ G   D   +  Y+P+ +A  Y 
Sbjct:  205 PLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYG 708          

HSP 6 Score: 220.32 bits (560), Expect = 9.282e-58
Identity = 124/509 (24.36%), Postives = 251/509 (49.31%), Query Frame = 1
Query:  202 ACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLHS 1728
            A   GN++     +    +IN  ++     +H A +  H+++V  L+     +E+ +      +H AA  G  ++V+ L+    ++NA+++K +  ++ A    H+++VK L+EN  +  V  ++   P+  A + G+  +V  LIN   K  V+       +H+A R+       VL+QN  + + +++  + P+H A  Y ++ + +LL+  G++++   +N   P+H AS  G+V ++ LLL++   +E  T+ +  P+H     GH+   ++L+D+   I+  T+    PIH A    H + VR+L+  N  I+    ++  PLH A   G+  +  VL++     ++ +   + P+H+AC+  H+ ++++L++ G   +A TE    P+H+A  +G+  IV  L+    +     +    PLH+A R GH ++ K L+Q     +   K+  +P+  A +  +  +   L+                  + G +PN + T+ H+
Sbjct:   15 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVR----LPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLL------------------ENGASPNLATTAGHT 501          

HSP 7 Score: 218.779 bits (556), Expect = 2.613e-57
Identity = 121/471 (25.69%), Postives = 233/471 (49.47%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            +H A   G+V++V   + K   +   ++     +H A      E+V+ L+    N+ + S   + P++ AA   HL++VK L++N  + N   E  +  +  A    H ++V  LI    +   + K +   +  A ++ +     +L+ N+   DV S+  + P+H+A  + +L+V ++L+     +    +    P+H A + G+V +V+LL+  G+ ++   ++   P+H A+  G V +  +LL+    ++A T+    PIH+     HL+ V+LL+ Y  +I+  T     P+H A + GH+ + ++L+D              PLH AC   ++ ++ +L++    IDA ++    P+HVA   GHL IVK L+++G            P+H+A   G+ ++   L+ ++    A   DD  PLH A R GH  +VKLL++ G + ++     ++P+  A +  +
Sbjct:   45 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGH 511          

HSP 8 Score: 195.667 bits (496), Expect = 7.228e-50
Identity = 121/443 (27.31%), Postives = 210/443 (47.40%), Query Frame = 1
Query:  397 KAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVED--KEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIV-----------------------------KLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            +AA  G+L      ++N  DIN   +     +H A    HV +V  L+  H ++++E   K+    +  A  +G  E+V  L+N    ++ +SQ  + P+++A +  HL+VVK L++N  +    TE  + P+  A + GH  +V                              +L+QN    D   +  + P+H A+   ++ +  LLL +   V    +    P+HI   +G++  V+LL+D    IE  T+ E  P+H A   GH  I  IL+D    I+        P+H A    +LD V +L++ + +ID  +     P+HVA   GH  + K+L+ KG K  +     + P+HIAC   +  ++ LL+ +  +I+A T     PLH+A   GH  IVK L+Q+G + +V +    +P+ +A +  + E+   L+ 
Sbjct:   14 RAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELL--HKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQ 454          

HSP 9 Score: 195.282 bits (495), Expect = 1.031e-49
Identity = 109/418 (26.08%), Postives = 197/418 (47.13%), Query Frame = 1
Query:   79 MNDFQNFIEAVKSNKIKDIRRLFKV-QFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKML 1329
            +N F     A K N I+ +  L K    ++   +  + P+H A   G++ +VK  +++  + N  +     P+H A    H E+ K L++N+    + +  +  P+H AA  GH  +VKLL++N    N         +H A    HVD    L+E         K+   P+  A K G V + ELL+ ++   +   +    P+HVA  H +LD+VK+L+       +     + P+H A K   +E+ + L+Q G + +A       P+H A+  G  E++ LLL K+ +     +    P+H+V  +GH+    +L+ +   ++  T     P+H A +YG+ ++V+ L+    ++         PLH A   G+ DIV +L++N    +  S     P+ +A R G++ +  +L
Sbjct:  365 LNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVL 782          
BLAST of Protein kinase-like domain vs. TrEMBL
Match: Q16FI9 (AAEL014742-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AAEL014742 PE=4 SV=1)

HSP 1 Score: 403.675 bits (1036), Expect = 4.356e-124
Identity = 181/507 (35.70%), Postives = 299/507 (58.97%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNI---------EVSDTENA--RPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNC 1647
            ++ + D+   P+H A   G +EVVK  I+   N++   +  W P+H A EN H+E+VKLLI+NR N+++  +  W P+H A+  GHL++VKLLI+N  +++ +  + W  +H+A  N H+++VK LI+N  +V     E   P+  A ++G++E+V+LLI N   +D K    W P+H A ++GHL+VVK LI N+ +++   +  W P+H A + GH+E+VKLLI+N + +D      W P+H AS  G +E++  L++ + +V+      W P+H+    GHLE VKLL+D K +++    K   P+H+A   GH E+V++LID+  N+          V  T+N    PLH+A  NG+L++V +LIEN  ++       W P+H A R+GHLE+VK+LI      +      W P+++A + G+ ++V LLI++R N++    + W PL++A + GH ++VKLLI    N D      ++P+ +A +  + E+   LI    N 
Sbjct:   45 VDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANV 551          

HSP 2 Score: 374.015 bits (959), Expect = 8.526e-113
Identity = 175/507 (34.52%), Postives = 290/507 (57.20%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLI-----------QNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNC 1647
            ++ K +    P+H A   G++EVVKF I+   N++      W P+H A +N H+E+VKLLI+N+ N+++  +    P+H A+  GHL++VKLLI           +N  +++    K    +H+A  N H+++VKLLIEN  +V     E   P+ +A ++G++E+V+LLI N   +D      W P++VA  +GHL+VVK+LI N+ +++      W P++ A K GH+E+VKLLI N + +D      W P+H AS  G +E++ LL++ + +V+        P+++    GHLE VKLL+D K +++    +   P+H A   GH E+V++LI++  N++ +  +   PLH+A  NG+L++V +LI+N  ++D      W P+HVA ++GHLE+VK+LI      +        P+H A   G+ ++V LLI +R N++    + W PLH+A + GH ++VKLLI    N D       +P+ +A    + E+   LI    N 
Sbjct:  276 VDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGITPLYVASINGHLEVVKLLIDNRANV 782          

HSP 3 Score: 369.007 bits (946), Expect = 5.968e-111
Identity = 171/507 (33.73%), Postives = 288/507 (56.80%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLI-----------QNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNC 1647
            ++   D+   P+H A   G++EVVK  IE   N++      W P+H+A +N H+E+VK LI+NR N+++     W P+H AA  GHL++VKLLI+N  +++ +    W  +H A  N H+++VK LI+N  +V     E   P+  A ++G++E+V+LLI+N   +D        P+H A ++GHL+VVK+LI           +N+ +++        P+H A + GH+E+VKLLI+N + +       W P+H+AS  G +E++ LL+E + +V+      W P+++    GHLE VKLL++ + +++    +   P++ A   GH E+V++LID+  N++ +  E   PLH A  NG+L++V +LI+N  ++D        P++VA ++GHLE+VK+LI      +      W P+H+A   G+ ++V LLI +R N++        PLH A + GH ++VKLLI    N D      ++P+ +A +  + E+   LI    N 
Sbjct:  177 VDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANV 683          

HSP 4 Score: 365.925 bits (938), Expect = 8.945e-110
Identity = 170/466 (36.48%), Postives = 272/466 (58.37%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLI-----------ENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDV 1554
            P+H A   G++EVVK  I+   N++        P+H+A +N H+E+VKLLI           ENR N+++  +    P+H A+  GHL++VKLLI+N  ++     + W  +H+A  N H+++VKLLIEN  +V     E   P++ A  +G++E+V+LLINN   +D      W P++VA ++GHL+VVK+LI NK +++      W P+H A + GH+E+VKLLI N + +D        P++ AS  G +E++ LL++ K +V+      W P+H+    GHLE VKLL++ + +++    K   P+H+A   GH E+V++LID+  N++ +  E   PLH A  NG+L++V +LIEN  ++D        P+H A ++GHLE+VK+LI      +      W P+H+A   G+ ++V LLI +R N++        PL++A   GH ++VKLLI    N D 
Sbjct:  319 PLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGITPLYVASINGHLEVVKLLIDNRANVDT 784          

HSP 5 Score: 357.066 bits (915), Expect = 1.691e-106
Identity = 167/485 (34.43%), Postives = 276/485 (56.91%), Query Frame = 1
Query:  226 VVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLE-----------IVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNC 1647
            +VKF I+   NI+  +     P+H A +N H+++VKLLI+N  N+++     W P+H AA  G+L++VKLLI N  +++   ++ W  +H A  N H+++VKLLI+N  +V  +      P+  A ++G++E+V+LLI N   +D K    W P+H A ++GHL+VVK LI N+ +++   +  W P+H A + GH+E+VKLLI+N + +D      W P+H+AS  G +E++  L++ + +V+   +  W P+H+    GHLE VKLL++ + +++        P+H A   GH E+V+ LID+  N++ +  E   PLH A  NG+L++V +LI+N  ++D        P+H A ++GHLE           +VK+LI      +        P+H A   G+ ++V LLI +R N+     + W PLH A R GH ++VKLLI+   N D      ++P+ +A    + E+   LI+   N 
Sbjct:    1 MVKFLIDHNANIDTANNGGRTPLHVASQNGHLKVVKLLIDNGANVDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANV 485          

HSP 6 Score: 292.738 bits (748), Expect = 1.461e-82
Identity = 134/404 (33.17%), Postives = 229/404 (56.68%), Query Frame = 1
Query:  523 IVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRS 1734
            +VK LI+++ ++   +     P+  A ++G++++V+LLI+N   +D +    W P+H+A  +G+L+VVK+LI N  +++   +  W P+H A + GH+E+VKLLI N + +D      W P+H AS  G +E++ LL+E + +V+      W P+H     GHLE VK L+D + +++   ++   P+H A   GH E+V++LI++  N++    E   PLH+A  NG+L++V  LI+N  ++D      W P+H+A  +GHLE+VK+LI      +    G W P+H+A   G+ ++V  LI +R N++    + W PLH+A + GH ++VKLLI    N D       +P+  A +  + E+   LI    N +  +L   +++ D     N  +T LH  S
Sbjct:    1 MVKFLIDHNANIDTANNGGRTPLHVASQNGHLKVVKLLIDNGANVDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVV-KLLIENRANVDT--TQNKGITPLHFAS 401          

HSP 7 Score: 264.618 bits (675), Expect = 2.542e-72
Identity = 117/327 (35.78%), Postives = 198/327 (60.55%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTE 1170
            P++ A   G++EVVK  I    N++      W P++ A +N H+E+VKLLI+N+ N+++  +  W P+H A+  GHL++VKLLI N  +++    K    ++ A  N H+++VKLLI+N  +V   D E   P+  A ++G++E+V+LLI N   +D        P+H A ++GHL+VVK+LI N+ +++      W P+H A + GH+E+VKLLI+N + +D        P+H+AS  G +E++ LL++ + +V+      W P+H+    GHLE VKLL+D + +++    K   P++ A   GH E+V++LID+  N++ +  E
Sbjct:  462 PLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGITPLYVASINGHLEVVKLLIDNRANVDTTQNE 788          
BLAST of Protein kinase-like domain vs. TrEMBL
Match: A0A182GGY8 (ANK_REP_REGION domain-containing protein OS=Aedes albopictus OX=7160 GN=RP20_CCG009719 PE=4 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 2.629e-112
Identity = 179/485 (36.91%), Postives = 309/485 (63.71%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            +E  +  N  P+H AC  G+ EVV+  I++  NI+A +E  + P+H AC   H E V++LI  + NI++L   ++ P+HKA   GH ++V++L++   +I+A AEK +  +H AC N H ++V++LI    ++    ++K  P+  AC++G+ E+VE+LI     I+  +Q NW P+H AC +GH +VV++LI+ K +IEA+ + NW P+H +C++GH E+V++LI+    ++A  ++NW P+H A   G  E++ +L+ ++ ++EA+ +  + P+HI    GH + V++L+  K +IE   ++   P+H AC  GH E+V ILI    NIE    +N  PLH AC NG+ ++V +L++   +IDA ++  + P+H+AC++GH E+V++LI +    +A TE K  P+H+AC  G+ ++V +L+  + NIEA   D+W PLH+AC  GH ++VK+LI +  N D L + + +P+ +A +  + E+
Sbjct: 1260 IEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEV 1744          

HSP 2 Score: 379.022 bits (972), Expect = 1.568e-108
Identity = 172/476 (36.13%), Postives = 301/476 (63.24%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIE 1617
            P+H AC  G+ E V+  I +  NI+A  E  + P+H AC+N H E+V++L++ + NI++L+  ++ P+H A   GH ++V++LI    +I+A  EK    +H AC N H ++V++LI    ++   ++    P+ +AC +G+ E+VE+LI     I+  +Q NW P+H++CRHGH +VV++LI+ K +IEA+ + NW P+H AC+ GH E+V++LI+  + ++A  + N+ P+H AS  G  +++ +L+ +K ++EA+ +  W P+H+ C  GH E V++L+  K +IE  T+    P+H AC  GH E+V IL+    NI+    +   PLH AC NG+ ++V +LI    +IDA ++    P+H+AC++GH E+V++L+ +    EA  +  W P+H+AC  G+ ++V +LI  + NI+A T     PLH+AC+ GH ++V++ +++  N   LD  + +P+++A +  + E+E
Sbjct: 1303 PLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVVEIFLRKNANIAALDDEKCTPLNLASQNGHTEVE 1778          

HSP 3 Score: 375.941 bits (964), Expect = 1.882e-107
Identity = 178/491 (36.25%), Postives = 299/491 (60.90%), Query Frame = 1
Query:  172 DDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            D     P+H+AC  G  EVV+  I    NI+A ++    P+H+AC+N   E+V++LI  + NIE+L+   W P+H A   GH ++V++LI+ N +I+A  E  +  +H AC   H + V++LI    ++   D+ K  P+  AC++G+ E+VE+L+     ID  ++  + P+H+AC++GH +VV++LI  K +I+A+TE    P+H AC+ GH E+V++LI+  + ++A  + NW P+H+A   G  E++ +L+ +K ++EA+ +  W P+H+ C  GH E V++L+  K +IE   +    P+H AC  GH E+V ILI    NIE  +  N  PLH A  NG+  +V +LI    +I+A  + +W P+H+ACR+GH E+V++LIR     EA T+  W P+H AC  G+ ++V +L+  + NI+A     + PLH+AC+ GH ++V++LI +  N D L + + +P+ +A +  + E+   L+    N
Sbjct: 1198 DTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKAN 1688          

HSP 4 Score: 357.066 bits (915), Expect = 6.024e-101
Identity = 170/495 (34.34%), Postives = 302/495 (61.01%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKS 1677
            +H + + G+  +V+  ++   N+NA     + P+H+AC +   E+V++LI  + NI++L+  +  P+H A   G  ++V++LI+   +I A  + NW  +H AC N H ++V++LI+ + ++    + K  P+  AC  G+ E V++LI     ID   +  + P+H AC++GH +VV++L++ K +I+A+ E  + P+H AC+ GH E+V++LI   + +DA  E    P+H A   G  E++ +L+  K ++EA+ ++ W P+H  CH GH E V++L+  K +IE   +    P+H +C +GH E+V ILI    NIE  + +N  PLH AC +G+ ++V +LI    +I+A ++ ++ P+H+A  +GH ++V++LIR+    EA  +  W P+H+AC  G+ ++V +LI  + NIEA T D+W PLH AC+ GHA++V++L+++  N D L + +++P+ +A +  + E+   LI    N   + LT  KS
Sbjct: 1172 LHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANI--DALTEKKS 1664          

HSP 5 Score: 352.058 bits (902), Expect = 2.817e-99
Identity = 161/456 (35.31%), Postives = 285/456 (62.50%), Query Frame = 1
Query:  172 DDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQG 1539
            D+    P+H AC  G+ EVV+  +++  NI+A +E  + P+H AC+N H E+V++LI  + NI++L+  +  P+H A   GH ++V++LI+   +I A  + NW  +H+AC N H ++V++LI    ++   +++   P+  +C+ G+ E+VE+LI     I+  +Q NW P+H+AC+ GH +VV++LI+ + +IEA+ + N+ P+H A   GH ++V++LI+  + ++A G+ NW P+H A   G  E++ +L+  K ++EA+T+  W P+H  C  GH E V++L+  K +I+   EK+  P+H AC  GH E+V ILI    NI+    + + PLH AC NG+ ++V +L+    +I+A ++ +W P+H+AC  GH E+VK+LI +    +A T+ K  P+H+AC  G+ ++V + +    NI A   +   PL++A + GH ++ K++ ++ 
Sbjct: 1330 DENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVVEIFLRKNANIAALDDEKCTPLNLASQNGHTEVEKIMKEKA 1785          

HSP 6 Score: 348.977 bits (894), Expect = 3.204e-98
Identity = 176/526 (33.46%), Postives = 312/526 (59.32%), Query Frame = 1
Query:   73 IIMNDFQNFIEAVKSNKIKDIRRLFKVQFLEMKDDKNMQP--IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            II + FQ  ++   S+    ++ + K +F E    K++    +H A   G +E VK  I    N+NAPS   +  +H +  + H  IV+LL++N  N+ +  + E+ P+H A   G  ++V++LI    +I+A A+     +H+AC N   ++V++LI    ++   ++    P+  AC++G+ E+VE+LI  N  ID  ++  + P+H+AC  GH + V++LI  K +I+A+ E  + P+H AC+ GH E+V++L++  + +DA  E  + P+H A   G  E++ +L+ +K +++A+TE K  P+H+ C  GH E V++L+  K +IE   +    P+H+AC+ GH E+V ILI    NIE  + +N  PLH +C +G+ ++V +LI    +I+A ++ +W P+H+AC+ GH E+V++LIR+    EA  +  + P+HIA   G+  +V +LI  + NIEA   ++W PLH+ACR GH ++V++LI+   N + L ++ ++P+  A +  + E+   L+    N
Sbjct: 1101 IIDSAFQTAVQYGHSS----VQDMLKRKFPEHAFTKDIDGPLMHIAAGDGIIEEVKRLINNGANVNAPSVAGYTALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKAN 1622          

HSP 7 Score: 260.381 bits (664), Expect = 2.033e-68
Identity = 159/557 (28.55%), Postives = 280/557 (50.27%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIE-------SLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLI------------------------NNNCKIDVKSQF---------NWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNG---------------------------------STLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            I +AC    VE++K+ + ++     P+      I  A EN   +I   LI N C +         L+++ W     A  YGH  +V++L++   DIN R  + W  +H+A  ++ + I K LI+   +V  + +E   P+  A   G+ E+V LLI                        +++ +  +K +F         +   +H+A   G ++ VK LI N  ++ A +   +  +H +   GH  IV+LL+ NG                                 + +DA  +N   P+H+A   G  E++ +L+ +K ++EA+ +  W P+H+ C  GH E V++L+    +I+  TE +  P+H AC  GH E V+ILI    NI+  D     PLH AC NG+ ++V +L++   +IDA ++  + P+H+AC++GH E+V++LI +    +A TE K  P+H+AC  G+ ++V +LI  + NIEA    +W PLH AC  GH ++V++LI++  N + L+++ ++P+ ++ ++ + E+   LI    N
Sbjct:  943 ILWACECNAVELLKYVLPQIYFFR-PNGTKMLKI--AIENGSDKICAYLI-NDCKVHPDVKFDGGLAALIW-----AVIYGHKNLVRILLEKGADINIRNTEGWSALHYAVHHKRIAISKFLIDKGINVNYQTREGKTPLNLAAARGHTEVVILLIEKLIEQFPSRNIIDSAFQTAVQYGHSSVQDMLKRKFPEHAFTKDIDGPLMHIAAGDGIIEEVKRLINNGANVNAPSVAGYTALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVN 1490          
BLAST of Protein kinase-like domain vs. TrEMBL
Match: Q16FR1 (AAEL014668-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AAEL014668 PE=4 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 7.292e-110
Identity = 181/518 (34.94%), Postives = 294/518 (56.76%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLI--RKGCKTEAYTEGKW--------------------RPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNC 1647
            ++ KDD+   P+HYA   GN+E+VK  I+   N++      W P+HYA +N HI++VKLLI+NR N+++  +    P+HKAA  GHL +VKLLI N  +++    + W  +H+A  N ++++VKLLI+N  +V     E   P+ YA ++G +++V+LLI+N   +D        P+H A ++G+L++VK+LI N+ +++      W P+H A + G +++VKLLI N + +D        P+HYAS  G++EL+ LL++ + +V+      W P+H     G L+ VKLL+D + +++    +   P+H+A   G+ E+V++LID+  N++ +  E   PLHYA  NG LD+V +LI+N  ++D        P+H A R+G+LE+VK+LI  R    T  Y EG W                     P+H A   GN ++V LLI +R N++    + W PLH + + GH  +VKLLI+   N D      ++P+  A +  + E+   LI    N 
Sbjct:   25 IDTKDDEGCTPLHYASRNGNLEMVKLLIDNRANVDTTQNEGWTPLHYASQNGHIDVVKLLIDNRANVDTTQNEGCTPLHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQY-EG-WTPLHYASRNANVDTTQNEGCTPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANV 540          

HSP 2 Score: 355.14 bits (910), Expect = 4.987e-105
Identity = 169/484 (34.92%), Postives = 274/484 (56.61%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDW--------------------RPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPV 1581
            P+H A   GN+E+VK  I+   NI+   +    P+HYA  N ++E+VKLLI+NR N+++  +  W P+H A+  GH+ +VKLLI N  +++    +    +H A  N H+D+VKLLI+N  +V     E   P+ YA ++GN+E+V+LLI+N   +D      W P+H A R+G LDVVK+LI N+ +++        P+H A + G++E+VKLLI N + +D      W P+HYAS  G ++++ LL++ + +V+        P+H     G+LE VKLL+D + +++ A  +   P+H+A   G  ++V++LID+  N++ +  E   PLHYA  NGNL++V +LI+N  ++D      W P+H A ++G L++VK+LI      +        P+H A   GN ++V LLI +R N++    + W                     PLH A R G+ ++VKLLI+   N D      ++P+
Sbjct:    2 PLHTAAGKGNIEMVKLLIDHNANIDTKDDEGCTPLHYASRNGNLEMVKLLIDNRANVDTTQNEGWTPLHYASQNGHIDVVKLLIDNRANVDTTQNEGCTPLHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNANVDTTQNEGCTPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPL 485          

HSP 3 Score: 341.273 bits (874), Expect = 7.188e-100
Identity = 172/541 (31.79%), Postives = 272/541 (50.28%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRH--------------------GHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVE---------------------------------LITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPS-------------------KL--------------DWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDV 1554
            P+HYA   GN+E+VK  I+   N++      W P+HYA  N  +++VKLLI+NR N+++  +    P+H A+  G+L++VKLLI N  +++    + W  +H+A  N  +D+VKLLI+N  +V     E C P+ YA ++GN+E+V+LLI+N   +D      W P+H A R+                    G+L++VK+LI+N+ +++      W P+H + + GH+++VKLLI+N + +D      W P+HYA   G +E                                 L+ LL++ + +V+      W P+H     GHLE VK L+D   + +    +     H A   G  E+V++LID+  N++ ++ E   PLHYA  NG+L++V +LI+N  ++D  +                   KL               W P+H A R+GHLE+VK+LI  G   +          HIA   G  ++V LLI +  N++    + W PLH A R GH ++VKLLI  G N D 
Sbjct:  266 PLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNANVDTTQNEGCTPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDT 806          

HSP 4 Score: 332.028 bits (850), Expect = 2.546e-96
Identity = 159/467 (34.05%), Postives = 252/467 (53.96%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACEN--------------------NHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLI 1530
            P+HYA   GN+E+VK  I+   N++      W P+HYA  N                     ++E+VKLLIENR N+++  +  W P+H ++  GHL++VKLLI+N  +++    + W  +H+A  N H+++VK LI+N  +V   +           ++G + +V+LLI+N   +D      W P+H A ++GHL+VVK LI N  + +          H A K G +E+VKLLI NG+ +D      W P+HYAS  G +E++ LL++   +V+          HIV   G LE VKLL+D + +++    +   P+H+A   GH E+V++LID+  N++  +T  +   H A  NG L++V +LI+N  ++D  +   W P+H A R+GHLE+VK+LI  G   +          HI    G  ++V LLI +  N++    + W  LH A   GH ++VKL I
Sbjct:  398 PLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNANVDTTQNEGCTPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNGANVDTTYNERWTLLHDASLNGHLEVVKLSI 864          

HSP 5 Score: 326.635 bits (836), Expect = 2.500e-94
Identity = 164/515 (31.84%), Postives = 264/515 (51.26%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVD--------------------IVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAV-TEGN--------------------------------WKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYS 1575
            P+HYA   GN+E+VK  I+   N++      W P+HYA +N  +++VKLLI+NR N+++  +    P+H A+  G+L++VKLLI N  +++    + W  +H+A  N +VD                    +VKLLIEN  +V     E   P+ Y+ ++G++++V+LLI N   +D      W P+H A ++GHL+VVK LI N  +++ + T G+                                W P+H A + GH+E+VK LI NG+  D          H AS  G +E++ LL++   +V+      W P+H     GHLE VKLL+D   +++    +     H     G  E+V++LID+  N++ +D E   PLHYA  NG+L++V +LI+N  ++D  +       H+A ++G LE+VK+LI  G   +      W P+H A   G+ ++V LLI +  N++          HI  + G  ++VKLLI  G N D     R++
Sbjct:  332 PLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNANVDTTQNEGCTPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNGANVDTTYNERWT 846          

HSP 6 Score: 250.366 bits (638), Expect = 9.937e-67
Identity = 122/382 (31.94%), Postives = 202/382 (52.88%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVK---------------------------------LLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIE 1236
            P+HY+   G+++VVK  IE   N++      W P+HYA +N H+E+VK                                 LLI+NR N+++  +  W P+H A+  GHL++VK LI N  + + +  +     H A  N  +++VKLLI+N  +V   + E   P+ YA ++G++E+V+LLI+N   +D K+       H+  ++G L+VVK+LI N+ +++      W P+H A + GH+E+VKLLI NG+ +D          H AS  G +E++ LL++   +V+      W P+H     GHLE VKLL+D   +++    +     H     G  E+V++LID+  N++ +  E    LH A  NG+L++V + I+
Sbjct:  484 PLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNGANVDTTYNERWTLLHDASLNGHLEVVKLSID 865          
BLAST of Protein kinase-like domain vs. TrEMBL
Match: A0A4Q2UZ94 (Ankyrin-3 (Fragment) OS=Fusarium oxysporum f. sp. narcissi OX=451672 GN=BFJ63_vAg19653 PE=4 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 6.980e-104
Identity = 153/479 (31.94%), Postives = 277/479 (57.83%), Query Frame = 1
Query:  166 MKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
            + +D  M P+H A   G++   K  +EK  ++ A  +  W P+H A  N H+++VK LIE+   I  ++     P+H AA  GH+ + KLL+++   + A  +  W  +H    N H+++V LLI+     +   ++   P+  A ++G+V+  +LLI     + V  Q    P+H+A ++GH+DVVK+L+ +  +IEA TE    P+H A   GH+++ +LL+++G+      E+   P+H+AS  G ++++ LL+EK  +V ++ +  W P+H+  + G+ + VKLL++   D  +A+     P+++A   GH ++V++LI+   +I  ++ +  +PLH A  NG++D+  +LIE    + A ++  W P+H + ++GHL+IV++LI KG    A     W P+H++   G+ D+  LL+    +I+A + D   PLH+A   GH DIVKLLI++G +   +D N ++P+ +A  + 
Sbjct:   15 ITEDGAM-PLHLASENGHINAAKLLMEKGASVTAVDQHGWAPLHLASRNGHVDLVKFLIEHGAGIAVITEDGATPLHLAAENGHINVAKLLVEHGASVTAINQDGWTPLHLTSFNGHINVVDLLIDEGASTIARAQDGRTPLHLASRNGHVDSAKLLIKGCAGVAVIDQHGATPLHLASKNGHIDVVKLLVVHGANIEATTEDCATPLHLASWNGHIDVFRLLVEHGAGTAVTTEHGATPLHWASQNGHIDIVRLLIEKGANVTSIDQYGWTPLHLASYNGYTDVVKLLVEKGTDTALASNSGSTPLYFASGNGHIDVVKLLIEYGASIAATNQDGEQPLHLAIENGHIDVAKLLIEQGASVTAVAQNGWTPLHSSSQNGHLDIVELLIGKGASVTAVDHNGWTPLHLSSWNGHIDVFKLLVVDGGSIDATSEDGATPLHLASSNGHFDIVKLLIERGASVTSIDHNGWTPLHLASVHG 492          

HSP 2 Score: 171.4 bits (433), Expect = 6.662e-42
Identity = 103/342 (30.12%), Postives = 173/342 (50.58%), Query Frame = 1
Query:  820 IVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKW-RPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIFLFKTQTDFFFAVKRISMDDV 1842
            +VKLLI+ G+++    E+   P+H AS  G +    LL+EK   V AV +  W P+H+    GH++ VK L+++   I + TE    P+H A   GH  + ++L++   ++   + +   PLH    NG++++V++LI+      A ++    P+H+A R+GH++  K+LI KGC   A  +     P+H+A   G+ D+V LL+    NIEA T D   PLH+A   GH D+ +LL++ G  T V  ++  +P+  A +  + +I   LI    N          S +  G  P   L S +  +  +   + KGT + +      T  +FA     +D V
Sbjct:    1 MVKLLIEEGASIAVITEDGAMPLHLASENGHINAAKLLMEKGASVTAVDQHGWAPLHLASRNGHVDLVKFLIEHGAGIAVITEDGATPLHLAAENGHINVAKLLVEHGASVTAINQDGWTPLHLTSFNGHINVVDLLIDEGASTIARAQDGRTPLHLASRNGHVDSAKLLI-KGCAGVAVIDQHGATPLHLASKNGHIDVVKLLVVHGANIEATTEDCATPLHLASWNGHIDVFRLLVEHGAGTAVTTEHGATPLHWASQNGHIDIVRLLIEKGANV--------TSIDQYGWTP-LHLASYNGYTDVVKLLVEKGTDTALASNSGSTPLYFASGNGHIDVV 332          
BLAST of Protein kinase-like domain vs. TrEMBL
Match: A0A182H2I6 (Uncharacterized protein OS=Aedes albopictus OX=7160 GN=RP20_CCG020406 PE=4 SV=1)

HSP 1 Score: 347.436 bits (890), Expect = 1.660e-97
Identity = 171/481 (35.55%), Postives = 290/481 (60.29%), Query Frame = 1
Query:  172 DDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            D+K   P+H AC  G+ EVV+  I +  NI+A +  N+ P+H AC N   E+V++LI  + NI++L+     P+H A+  GH ++V++L     +I+A   +N   +H ACLN H ++ ++LI    +V   D++K  P+  AC++G+ E+VE+LI     I      N  P+H+AC +GH +VV++L++ K +I+A+   N  P+H AC+ GH+E+V++LI+  S +DA    N  P+H A + G  E+  +L+ K  +V A+ E K  P+H+ C  GH E V++L+  K +I+    +   P+H AC+ GH E+V IL+    NI+  +  N  PLH AC NG++++V +LI    ++DA +  +  P+H+AC +GH E+ ++LIRK     A  E K  P+H+AC  G+ ++V +LI  + +I+A  ++++ PLH+AC  G  ++V++LI++  N D L     +P+ +A    + E+
Sbjct: 1363 DEKKSTPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEV 1843          

HSP 2 Score: 344.739 bits (883), Expect = 1.114e-96
Identity = 176/494 (35.63%), Postives = 294/494 (59.51%), Query Frame = 1
Query:  133 IRRLFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            IR++  V  L   D+K   P+H AC  G+ EVV+  I    NI+A    N  P+H AC N H E+V++L+  + NI++L      P+H A   GH+++V++LI+   +++A A +N   +H ACLN H ++ ++LI    +V   D++K  P+  AC++G+ E+VE+LI     ID  +  N+ P+H+AC +G  +VV+VLI+ K +I+A+   N  PIH A   GH E+V++L +  + +DA    N  P+H A + G  E+  +L+ K  +V A+ E K  P+H+ C  GH E V++L+  K +I+    +   P+H AC+ GH E+V IL+    NI+  +  N  PLH AC NG++++V +LI    ++DA +  +  P+H+AC +GH E+ ++LIRK     A  E K  P+H+AC  G+ ++V +LI  + +I+A  ++++ PLH+AC  G  ++V++LI++  N D L     +P+ +A    + E+
Sbjct: 1617 IRKVANVNAL---DEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEV 2107          

HSP 3 Score: 341.658 bits (875), Expect = 1.262e-95
Identity = 179/504 (35.52%), Postives = 292/504 (57.94%), Query Frame = 1
Query:  133 IRRLFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            IR++  V  L   D+K   P+H AC  G+ EVV+  I    NI A    N  P+H AC N H E+V++L+  + NI++L      P+H A   GH+++V++LI+   +++A A +N   +H ACLN H ++ ++LI    +V   D++K  P+  AC++G+ E+VE+LI     ID     N  P+H+AC +GH +VV++L++ K +I+A+   N  P+H AC+ GH+E+V++LI+  S +DA    N  P+H A + G  E+  +L+ K  +V A+ E K  P+H+ C  GH E V++L+  K  I+    +   P+H AC  G  E+V +LI    NI+    EN  P+H A  NG+ ++V +L     +IDA    +  P+H+AC +GH E+ ++LIRK     A  E K  P+H+AC  G+ ++V +LI  + NI+A    +  PLH+AC  GH ++V++L+++  N D L+    +P+ +A +  + E+   LI    N
Sbjct: 1485 IRKVANVNAL---DEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSN 1985          

HSP 4 Score: 339.732 bits (870), Expect = 6.260e-95
Identity = 172/489 (35.17%), Postives = 288/489 (58.90%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            +N  P+H AC  G+ E+V+  I +  NI+A +  N  P+H AC N H E+V++LI+ + N+++L   +  P+H A   GH ++V++LI+   +INA A +N+  +H ACLN H ++VK+LI    ++     E C P+  AC +G+ E+ E+LI     ID     N  P+H+AC +GH +VV++LI+ K +I+A+   N+ P+H AC+ G  E+VK+L++    ++A    N  P+H A + G  E++ +L+ +K +++A+ E K  P+H+ C  GH E V++L+  K +I+    +   P+H AC  G  E+V +LI    NI+    EN  P+H A  NG+ ++V +L     +IDA    +  P+H+AC +GH E+ ++LIRK     A  E K  P+H+AC  G+ ++V +LI  + NI A    +  PLH+AC  GH ++V++L+++  N D L+    +P+ +A +  + E+   LI    N
Sbjct: 1101 ENCTPLHLACLNGHKEIVEILIRRKANIDALALENSTPLHLACLNGHKEVVEILIKEKANVDTLDERKLTPLHFACHKGHKEVVEVLIREEANINALAFENFTPLHLACLNGHKEVVKVLIREKANIEALALENCTPLHLACLNGHKEVAEILIREKSNIDALELKNCTPLHLACLNGHNEVVEILIRGKANIDAMALENYTPLHLACQNGQKEVVKVLVREKININALALENCTPLHLACLNGHKEVVEILVREKANIDALDEKKSTPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSN 1589          

HSP 5 Score: 338.191 bits (866), Expect = 2.195e-94
Identity = 174/489 (35.58%), Postives = 289/489 (59.10%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            +N  P+H AC  G+ EV +  I +  NI+A    N  P+H AC N H E+V++LI  + NI++++   + P+H A   G  ++VK+L++   +INA A +N   +H ACLN H ++V++L+    ++   D++K  P+  AC++G+ E+VE+LI     ID  +  N+ P+H+AC +G  +VV+VLI+ K +I+A+   N  PIH A   GH E+V++L    + +DA    N  P+H A + G  E+  +L+ K  +V A+ E K  P+H+ C  GH E V++L+  K +I     +   P+H AC+ GH E+V IL+    NI+  +  N  PLH AC NG++++V +LI    ++DA +  +  P+H+AC +GH E+ ++LIRK     A  E K  P+H+AC  G+ ++V +LI  + NI+A    +  PLH+AC  GH ++V++L+++  N D L+    +P+ +A +  + E+   LI    N
Sbjct: 1233 ENCTPLHLACLNGHKEVAEILIREKSNIDALELKNCTPLHLACLNGHNEVVEILIRGKANIDAMALENYTPLHLACQNGQKEVVKVLVREKININALALENCTPLHLACLNGHKEVVEILVREKANIDALDEKKSTPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSN 1721          

HSP 6 Score: 337.421 bits (864), Expect = 3.572e-94
Identity = 167/491 (34.01%), Postives = 291/491 (59.27%), Query Frame = 1
Query:  172 DDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            D++ + P+H+AC  G+ EVV+  I +  NINA +  N+ P+H AC N H E+VK+LI  + NIE+L+     P+H A   GH ++ ++LI+   +I+A   KN   +H ACLN H ++V++LI    ++     E   P+  AC++G  E+V++L+     I+  +  N  P+H+AC +GH +VV++L++ K +I+A+ E    P+H AC+ GH E+V++LI+  + +DA    N+ P+H A + G  E++ +L+ +K +++A+      PIH+    GH E V++L   K +I+    +   P+H AC  GH E+  +LI    N+   D + A PLH AC NG+ ++V +LI    +I A    +  P+H+AC +GH E+V++L+R+    +A       P+H+AC  G+ ++V +LI  + N++A   ++  PLH+AC  GH ++ ++LI++  N + LD+ + +P+ +A +  + E+   LI    N
Sbjct: 1165 DERKLTPLHFACHKGHKEVVEVLIREEANINALAFENFTPLHLACLNGHKEVVKVLIREKANIEALALENCTPLHLACLNGHKEVAEILIREKSNIDALELKNCTPLHLACLNGHNEVVEILIRGKANIDAMALENYTPLHLACQNGQKEVVKVLVREKININALALENCTPLHLACLNGHKEVVEILVREKANIDALDEKKSTPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKAN 1655          

HSP 7 Score: 336.65 bits (862), Expect = 6.147e-94
Identity = 164/471 (34.82%), Postives = 277/471 (58.81%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIA 1590
            +N  P+H AC  G+ EV +  I K+ N+NA  E    P+H AC+N H E+V++LI  + NI++       P+H A F GH ++V++L++   +I+A   +N   +H AC N H+++V++LI    +V     E C P+  AC +G+ E+ E+LI     ++   +    P+H+AC++GH +VV++LI+ K  I+A+   N+ P+H AC  G  E+V++LI+  + +DA    N  PIH AS+ G  E++ +L  +K +++A       P+H+ C  GH E  ++L+    ++    EK+  P+H AC  GH E+V ILI    NI+ +D  N  PLH AC NG+ ++V +L+    +IDA    +  P+H+AC++GH+E+V++LIR+    +A       P+H+ACL G+ ++  +LI    N+ A       PLH+AC+ GH ++V++LI+   + D +    Y+P+ +A
Sbjct: 1596 ENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLA 2066          

HSP 8 Score: 333.569 bits (854), Expect = 7.066e-93
Identity = 167/471 (35.46%), Postives = 275/471 (58.39%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIA 1590
            +N  P+H AC  G+ EVVK  I +  NI A +  N  P+H AC N H E+ ++LI  + NI++L      P+H A   GH ++V++LI+   +I+A A +N+  +H AC N   ++VK+L+    ++     E C P+  AC +G+ E+VE+L+     ID   +    P+H+AC++GH +VV++LI+ K +I+A+   N+ P+H AC  G  E+V++LI+  + +DA    N  PIH AS+ G  E++ +L  +K +++A       P+H+ C  GH E  ++L+    ++    EK+  P+H AC  GH E+V ILI    NI  +D  N  PLH AC NG+ ++V +L+    +IDA    +  P+H+AC++GH+E+V++LIR+    +A       P+H+ACL G+ ++  +LI    N+ A       PLH+AC+ GH ++V++LI+   N D  D    +P+ +A
Sbjct: 1200 ENFTPLHLACLNGHKEVVKVLIREKANIEALALENCTPLHLACLNGHKEVAEILIREKSNIDALELKNCTPLHLACLNGHNEVVEILIRGKANIDAMALENYTPLHLACQNGQKEVVKVLVREKININALALENCTPLHLACLNGHKEVVEILVREKANIDALDEKKSTPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLA 1670          

HSP 9 Score: 332.798 bits (852), Expect = 1.412e-92
Identity = 171/504 (33.93%), Postives = 288/504 (57.14%), Query Frame = 1
Query:  133 IRRLFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            IRR   +  L ++   N  P+H AC  G+ EVV+  I++  N++   E    P+H+AC   H E+V++LI    NI +L+   + P+H A   GH ++VK+LI+   +I A A +N   +H ACLN H ++ ++LI    ++   + + C P+  AC +G+ E+VE+LI     ID  +  N+ P+H+AC++G  +VVKVL++ K +I A+   N  P+H AC  GH E+V++L++  + +DA  E    P+H A   G  E++ +L+ +K +++A+    + P+H+ C  G  E V++L+  K +I+    +   PIH A   GH E+V IL     NI+ +D  N  PLH AC NG+ ++  VLI    +++A  +    P+H+AC++GH E+V++LIR      A       P+H+AC  G+ ++V +L+  + NI+A    +  PLH+AC+ GH ++V++LI++  N D L     +P+ +A    + E+   LI    N
Sbjct: 1122 IRRKANIDALALE---NSTPLHLACLNGHKEVVEILIKEKANVDTLDERKLTPLHFACHKGHKEVVEVLIREEANINALAFENFTPLHLACLNGHKEVVKVLIREKANIEALALENCTPLHLACLNGHKEVAEILIREKSNIDALELKNCTPLHLACLNGHNEVVEILIRGKANIDAMALENYTPLHLACQNGQKEVVKVLVREKININALALENCTPLHLACLNGHKEVVEILVREKANIDALDEKKSTPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVAN 1622          

HSP 10 Score: 330.487 bits (846), Expect = 7.885e-92
Identity = 166/491 (33.81%), Postives = 283/491 (57.64%), Query Frame = 1
Query:  172 DDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            D +N  P+H AC  G+ EVV+  + +  NI+A    N  P+H AC+N HIE+V++LI  + N+++L+     P+H A   GH ++ ++LI+   ++NA  EK    +H AC N H ++V++LI    ++   D   C P+  AC +G+ E+VE+L+     ID     N  P+H+AC++GH++VV++LI+ K +++A+   N  P+H AC  GH E+ ++LI+  + ++A  E    P+H A   G  E++ +L+  K  ++A+    + P+H+ C  G  E V++L+  K +I+    +   PIH A   GH E+V IL     NI+ +D  N  PLH AC NG+ ++  VLI    +++A  +    P+H+AC++GH E+V++LIR     +A       P+H+AC  G+ ++V +L+  + NI+A    +  PLH+AC+ GH ++V++LI++  N D L     +P+ +A    + E+   LI    N
Sbjct: 1528 DFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVAN 2018          

HSP 11 Score: 330.102 bits (845), Expect = 9.417e-92
Identity = 160/486 (32.92%), Postives = 286/486 (58.85%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHA 1635
            +N  P+H AC  G++EVV+  I +  N++A +  N  P+H AC N H E+ ++LI    N+ +L   +  P+H A   GH ++V++LI+   +I+A   +N   +H AC N H ++V++L+    ++   +   C P+  AC++G++E+VE+LI     +D  +  N  P+H+AC +GH +V +VLI+   ++ A+ E    P+H AC+ GH E+V++LI+  +++DA    N+ P+H A + G  E++ +L+ +K +++A+      PIH+    GH E V++L   K +I+    +   P+H AC  GH E+  +LI    N+   D + A PLH AC NG+ ++V +LI    +IDA    +  P+H+AC +GH E+V++L+R+    +A       P+H+AC  G+ ++V +LI  + N++A   ++  PLH+AC  GH ++ ++LI++  N + LD+ + +P+ +A +  + E+   LI  
Sbjct: 1563 RNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRG 2048          

HSP 12 Score: 329.331 bits (843), Expect = 2.008e-91
Identity = 164/486 (33.74%), Postives = 283/486 (58.23%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHA 1635
            +N  P+H AC  G  EVVK  + +  NINA +  N  P+H AC N H E+V++L+  + NI++L   +  P+H A   GH ++V++LI+   +I+A A +N+  +H ACLN   ++V++LI    ++     E C PI  A  +G+ E+VE+L      ID     N  P+H+AC +GH +V +VLI+   ++ A+ E    P+H AC+ GH E+V++LI+  + + A    N  P+H A   G  E++ +L+ +K +++A+      P+H+ C  GH+E V++L+  K +++    +   P+H AC  GH E+  +LI    N+   D + A PLH AC NG+ ++V +LI    +IDA    +  P+H+AC +GH E+V++L+R+    +A       P+H+AC  G+ ++V +LI  + N++A   ++  PLH+AC  GH ++ ++LI++  N + LD+ + +P+ +A +  + E+   LI  
Sbjct: 1299 ENYTPLHLACQNGQKEVVKVLVREKININALALENCTPLHLACLNGHKEVVEILVREKANIDALDEKKSTPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRG 1784          

HSP 13 Score: 327.791 bits (839), Expect = 6.046e-91
Identity = 161/471 (34.18%), Postives = 277/471 (58.81%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIA 1590
            +N  P+H AC  G+ EVV+  + +  NI+A  E    P+H AC+N H E+V++LI  + NI++++   + P+H A   G  ++V++LI+   +I+A A +N   IH A LN H ++V++L     ++   D   C P+  AC +G+ E+ E+LI     ++   +    P+H+AC++GH +VV++LI+ K +I A    N  P+H AC  GH E+V++L++  + +DA    N  P+H A   G +E++ +L+ +K +V+A+      P+H+ C  GH E  ++L+    ++    EK+  P+H AC  GH E+V ILI    NI+ +D  N  PLH AC NG+ ++V +L+    +IDA    +  P+H+AC++GH+E+V++LIR+    +A       P+H+ACL G+ ++  +LI    N+ A       PLH+AC+ GH ++V++LI+   + D +    Y+P+ +A
Sbjct: 1332 ENCTPLHLACLNGHKEVVEILVREKANIDALDEKKSTPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLA 1802          

HSP 14 Score: 322.398 bits (825), Expect = 3.889e-89
Identity = 164/489 (33.54%), Postives = 277/489 (56.65%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            +N  P+H AC  G  EVV+  I +  NI+A +  N  PIH A  N H E+V++L   + NI++       P+H A   GH ++ ++LI+   ++NA  EK    +H AC N H ++V++LI    ++   D   C P+  AC +G+ E+VE+L+     ID     N  P+H+AC++GH++VV++LI+ K +++A+   N  P+H AC  GH E+ ++LI+  + ++A  E    P+H A   G  E++ +L+  K +++A       P+H+ C  GH E V++L+  K +I+    +   P+H AC  GH E+V ILI    N++    EN  PLH AC NG+ ++  VLI    +++A  +    P+H+AC++GH E+V++LIR     +A     + P+H+ACL G  ++V +LI  + NI+A  +++  P+H+A   GH ++V++L ++  N D  D    +P+ +A    + E+   LI    N
Sbjct: 1398 ENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVAN 1886          

HSP 15 Score: 320.857 bits (821), Expect = 1.236e-88
Identity = 161/489 (32.92%), Postives = 280/489 (57.26%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            +N  PIH A   G+ EVV+    +  NI+A    N  P+H AC N H E+ ++LI    N+ +L   +  P+H A   GH ++V++LI+   +I A   +N   +H AC N H ++V++L+    ++   +   C P+  AC++G++E+VE+LI     +D  +  N  P+H+AC +GH +V +VLI+   ++ A+ E    P+H AC+ GH E+V++LI+  + +DA    N  P+H A   G  E++ +L+ +K +++A+      P+H+ C  GH+E V++L+  K +++    +   P+H AC  GH E+  +LI    N+   D + A PLH AC NG+ ++V +LI     IDA +  ++ P+H+AC +G  E+V++LIR+    +A       PIH+A L G+ ++V +L   + NI+A    +  PLH+AC  GH ++ ++LI++  N + LD+ + +P+ +A +  + E+   LI    N
Sbjct: 1431 ENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKAN 1919          

HSP 16 Score: 318.161 bits (814), Expect = 1.036e-87
Identity = 161/474 (33.97%), Postives = 271/474 (57.17%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPV 1581
            ++  D +N  P+H AC  G+ EVV+  + +  NI+A    N  P+H AC+N HIE+V++LI  + N+++L+     P+H A   GH ++ ++LI+   ++NA  EK    +H AC N H ++V++LI     +     E   P+  AC +G  E+VE+LI     ID  +  N  PIH+A  +GH +VV++L + K +I+A    N  P+H AC  GH E+ ++LI+  + ++A  E    P+H A   G  E++ +L+  K +++A       P+H+ C  GH E V++L+  K +I+    +   P+H AC  GH E+V ILI    N++    EN  PLH AC NG+ ++  VLI    +++A  +    P+H+AC++GH E+V++LIR     +A     + P+H+ACL G  ++V +LI  + NI+A  +++  P+H+A   GH ++V++L ++  N D  D    +P+
Sbjct: 1656 IDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPL 2129          

HSP 17 Score: 296.59 bits (758), Expect = 1.920e-80
Identity = 158/467 (33.83%), Postives = 263/467 (56.32%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIA 1590
            P+ ++  G N       I+   NI A +  N  P+H AC N H EIV++LI  + NI++L+     P+H A   GH ++V++LI+   +++   E+    +H+AC   H ++V++LI    ++     E   P+  AC +G+ E+V++LI     I+  +  N  P+H+AC +GH +V ++LI+ K +I+A+   N  P+H AC  GH E+V++LI+  + +DA    N+ P+H A   G  E++ +L+ +K ++ A+      P+H+ C  GH E V++L+  K +I+   EK+  P+H AC  GH E+V ILI    NI+    EN  PLH AC NG  ++V VLI    +IDA +  +  PIH+A  +GH E+V++L  +    +A       P+H+ACL G+ ++  +LI    N+ A       PLH+AC+ GH ++V++LI+   N    D    +P+ +A
Sbjct: 1073 PLQFSLFG-NKGAEDIIIKGNVNIGALTHENCTPLHLACLNGHKEIVEILIRRKANIDALALENSTPLHLACLNGHKEVVEILIKEKANVDTLDERKLTPLHFACHKGHKEVVEVLIREEANINALAFENFTPLHLACLNGHKEVVKVLIREKANIEALALENCTPLHLACLNGHKEVAEILIREKSNIDALELKNCTPLHLACLNGHNEVVEILIRGKANIDAMALENYTPLHLACQNGQKEVVKVLVREKININALALENCTPLHLACLNGHKEVVEILVREKANIDALDEKKSTPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIGATDFRNCTPLHLA 1538          

HSP 18 Score: 295.434 bits (755), Expect = 4.302e-80
Identity = 149/436 (34.17%), Postives = 250/436 (57.34%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLH 1485
            +N  P+H AC  G++EVV+  I +  N++A +  N  P+H AC N H E+ ++LI    N+ +L   +  P+H A   GH ++V++LI+    I+A A +N+  +H ACLN   ++V++LI    ++     E C PI  A  +G+ E+VE+L      ID     N  P+H+AC +GH +V +VLI+   ++ A+ E    P+H AC+ GH E+V++LI+  + +DA    N  P+H A   G  E++ +L+ +K +++A+      P+H+ C  GH+E V++L+  K +++    +   P+H AC  GH E+  +LI    N+   D + A PLH AC NG+ ++V +LI     IDA +  ++ P+H+AC +G  E+V++LIR+    +A       PIH+A L G+ ++V +L   + NI+A    +  PLH
Sbjct: 1695 RNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLH 2130          

HSP 19 Score: 285.804 bits (730), Expect = 6.944e-77
Identity = 155/498 (31.12%), Postives = 270/498 (54.22%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEF--NWCPIHYACENNHIEIVKLLIENRCNIESL-------SSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            K  + +  A   G+ ++  + I+  C ++   E    + P+H A E +   IV+LLIE   ++          + I  KP  + + +G+     ++I+ N +I A   +N   +H ACLN H +IV++LI    ++     E   P+  AC +G+ E+VE+LI     +D   +    P+H AC  GH +VV+VLI+ + +I A+   N+ P+H AC  GH E+VK+LI+  + ++A    N  P+H A + G  E+  +L+ +K +++A+      P+H+ C  GH E V++L+  K +I+    +   P+H AC  G  E+V++L+    NI     EN  PLH AC NG+ ++V +L+    +IDA  +    P+H+AC++GH E+V++LIR+    +A     + P+H+ACL G  ++V +LI  + NI+A  +++  P+H+A   GH ++V++L  +  N D  D    +P+ +A    + E+   LI    N
Sbjct:  994 KEEEMLQIAIINGSDKICSYLIDD-CQVHPDVELYGGFAPLHVAIEGDQRHIVQLLIEKGADVNIRDAKLNFDTPISAKPPLQFSLFGNKGAEDIIIKGNVNIGALTHENCTPLHLACLNGHKEIVEILIRRKANIDALALENSTPLHLACLNGHKEVVEILIKEKANVDTLDERKLTPLHFACHKGHKEVVEVLIREEANINALAFENFTPLHLACLNGHKEVVKVLIREKANIEALALENCTPLHLACLNGHKEVAEILIREKSNIDALELKNCTPLHLACLNGHNEVVEILIRGKANIDAMALENYTPLHLACQNGQKEVVKVLVREKININALALENCTPLHLACLNGHKEVVEILVREKANIDALDEKKSTPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAGEKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVAN 1490          

HSP 20 Score: 261.922 bits (668), Expect = 6.783e-69
Identity = 136/385 (35.32%), Postives = 223/385 (57.92%), Query Frame = 1
Query:  133 IRRLFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIH 1287
            IR++  V  L   D+K   P+H AC  G+ EVV+  I    +I+A +  N+ P+H AC N   E+V++LI  + NI++L+     P+H A+  GH ++V++L +   +I+A   +N   +H ACLN H ++ ++LI    +V   D++K  P+  AC++G+ E+VE+LI     ID     N  P+H+AC +GH +VV++L++ K +I+A+   N  P+H AC+ GH+E+V++LI+  S +DA    N  P+H A + G  E+  +L+ K  +V A+ E K  P+H+ C  GH E V++L+  K  I+    +   P+H AC  G  E+V +LI    NI+    EN  P+H A  NG+ ++V +L     +IDA    +  P+H
Sbjct: 1749 IRKVANVNAL---DEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKANIDATDFRNCTPLHLACFNGHKEVVEILVREKANIDALEFRNCTPLHLACQNGHIEVVEILIREKSNVDALAFENCTPLHLACLNGHKEVAEVLIRKVANVNALDEKKATPLHLACQNGHKEVVEILIRGKASIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEVVEILAREKANIDATDFRNCTPLH 2130          

HSP 21 Score: 260.381 bits (664), Expect = 2.213e-68
Identity = 154/490 (31.43%), Postives = 262/490 (53.47%), Query Frame = 1
Query:  259 INAPSEFNWCPIHYACENNHIEIVKLLI--ENR--CNIESLSSIE---------------------------WKPVHKAAFYGHLQIVKLLIQNNCDINAR-AEKNWRLIHWA------CLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            +   S F+   + +ACE+N IE+ K +I  EN+     E +  I                            + P+H A       IV+LLI+   D+N R A+ N+     A       L  +     ++I+ + ++     E C P+  AC +G+ EIVE+LI     ID  +  N  P+H+AC +GH +VV++LI+ K +++ + E    P+H AC  GH E+V++LI+  + ++A    N+ P+H A + G  E++ +L+ +K ++EA+      P+H+ C  GH E  ++L+  K +I+    K   P+H AC  GH E+V ILI    NI+    EN  PLH AC NG  ++V VL+    +I+A +  +  P+H+AC +GH E+V++L+R+    +A  E K  P+H+AC  G+ ++V +LI  + NI+A  ++++ PLH+AC  G  ++V++LI++  N D L     +P+ +A    + E+
Sbjct:  958 VQEASLFSEEFVLWACESNAIELFKFVISKENQRWTKEEEMLQIAIINGSDKICSYLIDDCQVHPDVELYGGFAPLHVAIEGDQRHIVQLLIEKGADVNIRDAKLNFDTPISAKPPLQFSLFGNKGAEDIIIKGNVNIGALTHENCTPLHLACLNGHKEIVEILIRRKANIDALALENSTPLHLACLNGHKEVVEILIKEKANVDTLDERKLTPLHFACHKGHKEVVEVLIREEANINALAFENFTPLHLACLNGHKEVVKVLIREKANIEALALENCTPLHLACLNGHKEVAEILIREKSNIDALELKNCTPLHLACLNGHNEVVEILIRGKANIDAMALENYTPLHLACQNGQKEVVKVLVREKININALALENCTPLHLACLNGHKEVVEILVREKANIDALDEKKSTPLHLACQNGHKEVVEILIREKANIDAMALENYTPLHLACLNGQKEVVEVLIREKANIDALALENCTPIHLASLNGHKEV 1447          
BLAST of Protein kinase-like domain vs. Ensembl Cavefish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 268.855 bits (686), Expect = 6.869e-75
Identity = 143/510 (28.04%), Postives = 249/510 (48.82%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLI-----------------------------QNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
            LE    K    +H A   G  +VV   +    N+NA S+  + P++ A + NH+E+VK L+EN  N    +   + P+  A   GH  +V LLI                             QN+ + +  ++  +  +H A   +++ + +LL+    +V    K    P+  A + GNV +V LL++   +ID +++    P+H A R+GH+ V+++L+     I+A T+    PIH A +  H++ V+ L+Q  + +D    ++  P+H A+  G   +  +LL+K     A     + P+HI C K H+  + LL+ +   +E  TE    P+H A + GH  IV+ L+    +   S+ +   PLH A   G+ ++   L++N   +DA +K D  P+H A R GH E+VK+L+      ++ T     P+HIA   G+     +L+         T   + PLH+AC+YG  D+ +LL+++G N +   KN  +P+ +A  +N
Sbjct:   46 LETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHN 555          

HSP 2 Score: 266.929 bits (681), Expect = 2.635e-74
Identity = 142/522 (27.20%), Postives = 254/522 (48.66%), Query Frame = 1
Query:  169 KDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLI-----------------------------ENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNC 1647
            +  K   P++ A    ++EVVKF +E   N + P+E  + P+  A +  H  +V LLI                             +N  N + LS   + P+H AA Y +L + +LL+    ++N   +     +H A    +V +V+LL++    +    K++  P+  A ++G+V ++E+L++    I  K++    PIH+A +  H+D V+ L+Q   +I+ +T  +  P+H A   GH  + K+L+  G+  +A   N + P+H A     +  + LLL+    +EAVTE    P+H+    GHL  VK L+        +  K   P+H A   GH E+ + L+ +   ++    ++  PLH A   G+ ++V +L+E+  + D+ +     P+H+A R GH    ++L+    +    T+  + P+H+AC  G  D+  LL+    N  A   +   PLH+A  + + D+VKLL+ +G +     +N Y+P+ IA K N  E+ + L+    N 
Sbjct:   82 QSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANA 603          

HSP 3 Score: 255.373 bits (651), Expect = 2.071e-70
Identity = 130/460 (28.26%), Postives = 236/460 (51.30%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNR 1569
            P+H A    N+ V +  + +  N+N   +    P+H A    ++ +V+LL++    I++ +  E  P+H AA  GH++++++L+     I A+ +     IH A    H+D V+ L++ + ++     +   P+  A   G+  + ++L++   K + ++   + P+H+AC+  H+  + +L+++   +EAVTE    P+H A   GH+ IVK L+Q G++ +A       P+H A+  G  E+   LL+    V+A  +    P+H     GH E VKLL+++K + + AT     P+H A   GH    RIL+D N        +   PLH AC  G +D+  +L+E   + +A  K    P+HVA    +L++VK+L+ KG    +     + P+HIA      ++ + L+    N  + ++    PLH+A + G  D+V LLI +  N ++ +K R
Sbjct:  184 PLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVR 643          

HSP 4 Score: 240.736 bits (613), Expect = 1.578e-65
Identity = 130/520 (25.00%), Postives = 244/520 (46.92%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWAC---------------------------------LNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWR-----PIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            ++ +    + P+H A   G+V V++  +++   I A ++    PIH A + +H++ V+ L++    I+ ++     P+H AA  GH ++ K+L+      NARA   +  +H AC                                    H++IVK L++        + +   P+  A ++G+ E+ + L+ N  ++D K++ +  P+H A R GH ++VK+L+++K + ++ T     P+H A + GH    ++L+   +      +  + P+H A   G V++  LLLE+  +  A  +    P+H+  H  +L+ VKLL+               P+H A      E+   L+    N      +   PLH A   G  D+V +LI    +++  +K+  +     P+H+  + GH+ I  ML+++G    + +   +  +H+AC  GN  +V  L+  + ++   T   + PLH A + GH DIV LL++ G   + +  N  SP+ IAK+  Y
Sbjct:  240 IDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGY 759          

HSP 5 Score: 239.195 bits (609), Expect = 5.517e-65
Identity = 123/453 (27.15%), Postives = 229/453 (50.55%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENAR-----PLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            + P+H A   G+  + K  ++K    NA +   + P+H AC+ NH+  + LL+++  ++E+++     P+H AAF GHL IVK L+Q     NA   K    +H A    H ++ + L++N   V  + K+   P+  A + G+ E+V+LL+ +    D  +     P+H+A R GH    ++L+        +T+  + P+H ACKYG V++ +LL++ G+  +A G+N   P+H A    +++++ LL+ K     +     + P+HI   +  LE    L+    +    + +   P+H A   G  ++V +LI    N+ + +    +     PLH     G++ I ++L++    + + S++ +  +HVAC  G++++VK L+++       T   + P+H A   G+ DIV LL+         T +   PL IA R G+  ++ +L
Sbjct:  314 LTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 766          

HSP 6 Score: 233.032 bits (593), Expect = 5.913e-63
Identity = 124/478 (25.94%), Postives = 241/478 (50.42%), Query Frame = 1
Query:  259 INAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLIN-----------------------------NNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            IN  ++     +H A +  H+++V  L+ +  ++E+ +      +H AA  G  ++V  L+    ++NA+++K +  ++ A    H+++VK L+EN  +  +  ++   P+  A + G+  +V LLIN                             N+   DV S+  + P+H+A  + +L V ++L+    ++    +    P+H A + G+V +V+LL+  G+ +DA  ++   P+H A+  G V +I +LL++   ++A T+    PIH+     H++ V+ L+ Y  +I+  T     P+H A + GH+ + ++L+D              PLH AC   ++  +++L+++S  ++A ++    P+HVA   GHL IVK L+++G    A       P+H+A   G+ ++   L+ +   ++A   DD  PLH A R GH ++VKLL++   N D      ++P+ IA +  +
Sbjct:   13 INTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGH 490          

HSP 7 Score: 201.06 bits (510), Expect = 1.462e-52
Identity = 110/454 (24.23%), Postives = 219/454 (48.24%), Query Frame = 1
Query:  340 IENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVV-----------------------------KVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            I+N   I + +      +H A+  GH+++V  L+ +  D+    +K    +H A L     +V  L+    +V  + ++   P++ A +  ++E+V+ L+ N     + ++  + P+ VA + GH +VV                              VL+QN  + + +++  + P+H A  Y ++ + +LL+  G+ ++   +N   P+H A+  G+V ++ LLL++   ++A T+ +  P+H     GH+  +++L+D    I+  T+    PIH A    H + VR L+  N  I+    ++  PLH A   G+  +  VL++     +A +   + P+H+AC+  H+  + +L++     EA TE    P+H+A  +G+ +IV  L+    +  A  +    PLH+A R GH ++ + L+Q     D   K+  +P+  A +  + E+
Sbjct:    7 IKNGIAINTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKEL 460          

HSP 8 Score: 191.815 bits (486), Expect = 1.295e-49
Identity = 113/427 (26.46%), Postives = 200/427 (46.84%), Query Frame = 1
Query:  439 IQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLI-----------------------------QNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            I+N   IN   +     +H A    HV +V  L+ +  D+    K+    +  A  +G  ++V  L++    ++ +SQ  + P+++A +  HL+VVK L++N  +    TE  + P+  A + GH  +V LLI                             QN    D   +  + P+H A+   ++ +  LLL +  +V    +    P+HI   +G++  V+LL+D    I+  T+ E  P+H A   GH  ++ IL+D    I+        P+H A    ++D V  L++ + +ID  +     P+HVA   GH  + K+L+ KG K  A     + P+HIAC   +   ++LL+    ++EA T     PLH+A   GH +IVK L+Q+G + +  +    +P+ +A +  + E+   L+ 
Sbjct:    7 IKNGIAINTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQ 433          

HSP 9 Score: 140.198 bits (352), Expect = 2.423e-33
Identity = 72/257 (28.02%), Postives = 132/257 (51.36%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQ-----PIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLL 933
            K   P+H AC  G V+V +  +E+  N NA  +    P+H A  +N++++VKLL+    +  S +   + P+H AA    L++   L+Q   + N+ + +    +H A      D+V LLI    +V + +K + Q     P+    + G+V I ++L+     +   S+  +  +HVAC +G++ +VK L+Q +  +   T   + P+H A + GH +IV LL+++G+  +    N   P+  A  LG + +I +L
Sbjct:  510 KGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 766          
BLAST of Protein kinase-like domain vs. Ensembl Cavefish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 258.84 bits (660), Expect = 1.562e-71
Identity = 142/496 (28.63%), Postives = 247/496 (49.80%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKA-----AFYGHLQIVKLLIQNNCD-INARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            LE    K    +H A   G  +VV   +    N+NA S+  + P++ A + NH+E+VK L+EN  N    + ++   V  A       Y       + ++N C  I A     +  +H A   +++++ +LL+    +V    K    P+  A + GNV +V LL++    ID K++    P+H A R+GH+ ++++L+     I+A T+    PIH A +  H++ V+ L+Q  + +D    ++  P+H A+  G   +  +LL+K           + P+HI C K HL  + LL+ +   +E  TE    P+H A + GH  IV+IL+    +   S+ +   PLH A   G+ ++   L++N+  +DA +K D   +H A R GH E+VK+L+       + T     P+HIA   G+   V +L+         T   + PLH+A +YG  D+ +LL+++G N +   KN  +P+ +A  +N  ++ N L+
Sbjct:   69 LETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITA---TGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLV 561          

HSP 2 Score: 257.684 bits (657), Expect = 3.274e-71
Identity = 136/511 (26.61%), Postives = 250/511 (48.92%), Query Frame = 1
Query:  181 NMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIE---------------------------------ACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
             + P+H A   GNV +V+  +++   I+A ++    P+H A  N H+ I+++L++    I++ +     P+H AA   H+  V+ L+Q N +I+     +   +H A    H  + K+L++              P+  ACK  ++ +++LL+ ++  ++  ++    P+HVA   GHL++VK+L+Q      A       P+H A + GH E+ + L+QN + +DA  +++   +H A+ +G  EL+ LLLE K +  + T     P+HI   +GH + V++L+D        T+K   P+H A  YG  ++  +L++   N   +      PLH A  + NLD+VN+L+       + ++  + P+H+A +   +E+   L++ G    A +     P+H+A   G  D+V+LLIS + N+                                  A T   + PLH+AC YG+  +VK L+QQ  N +   +  Y+P+  A +  + +I
Sbjct:  211 GITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDI 721          

HSP 3 Score: 256.914 bits (655), Expect = 7.736e-71
Identity = 134/480 (27.92%), Postives = 246/480 (51.25%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            P+H A    N+ V +  + +  N+N   +    P+H A    ++ +V+LL++    I++ +  E  P+H AA  GH++I+++L+     I A+ +     IH A    H+D V+ L++ + ++     +   P+  A   G+  + ++L++   K + ++   + P+H+AC+  HL V+ +L+++   +EAVTE    P+H A   GH+ IVK+L+Q G++ +A       P+H AS  G  E+   LL+    V+A  +     +H     GH E VKLL+++K +    T     P+H A   GH + VRIL+D N        +   PLH A   G +D+  +L+E   + +A  K    P+HVA    +L++V +L+ KG    +     + P+HIA      ++ + L+    +  A ++    PLH+A + G AD+V LLI +  N ++ +K+  +P+ +  +  +  I + L+
Sbjct:  181 PLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILV 660          

HSP 4 Score: 252.292 bits (643), Expect = 2.461e-69
Identity = 131/515 (25.44%), Postives = 243/515 (47.18%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWAC---------------------------------LNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            ++ K    + P+H A   G+V +++  +++   I A ++    PIH A + +H++ V+ L++    I+ ++     P+H AA  GH ++ K+L+      N RA   +  +H AC                                    H++IVK+L++        + +   P+  A ++G+ E+ E L+ N   +D K++ +   +H A R GH ++VK+L+++K +  + T     P+H A + GH + V++L+   +      +  + P+H A+  G V++  LLLE+  +  A  +    P+H+  H  +L+ V LL+        A      P+H A      E+   L+    +      +   PLH A   G  D+V++LI    +++  +K    P+H+  + GH+ I  +L+++G    A T   + P+H+AC  GN  +V  L+  + N+   T   + PLH A + GH DIV LL++ G   + +  N  S + IAK+  Y
Sbjct:  237 IDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITTNGTSALAIAKRLGY 751          

HSP 5 Score: 248.44 bits (633), Expect = 4.846e-68
Identity = 119/448 (26.56%), Postives = 228/448 (50.89%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            + P+H A   G+  + K  ++K    N  +   + P+H AC+ NH+ ++ LL+++  ++E+++     P+H A+F GHL IVK+L+Q     NA   K    +H A    H ++ + L++N   V  + K+    +  A + G+ E+V+LL+ +    +  +     P+H+A R GH   V++L+        +T+  + P+H A KYG V++ +LL++ G+  +A G+N   P+H A    +++++ LL+ K     +     + P+HI   +  +E    L+ Y       + +   P+H A   G  ++V +LI    N+ + +     PLH     G++ I ++L++    + A +++ + P+HVAC  G++++VK L+++       T   + P+H A   G+ DIV LL+         T +    L IA R G+  ++ +L
Sbjct:  311 LTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITTNGTSALAIAKRLGYISVIDVL 758          

HSP 6 Score: 201.06 bits (510), Expect = 1.143e-52
Identity = 107/418 (25.60%), Postives = 203/418 (48.56%), Query Frame = 1
Query:   79 MNDFQNFIEAVKSNKIKDIRRLFK-VQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKML 1329
            +N F     A K N ++ +  L K    LE   +  + P+H A   G++ +VK  ++K  + NA +     P+H A    H E+ + L++N   +++ +  +   +H AA  GH ++VKLL+++  + N+        +H A    H   V++L++ +       K+   P+  A K G V++ ELL+      +   +    P+HVA  H +LDVV +L+       +     + P+H A K   VE+   L+Q G++ +A       P+H A+  G  ++++LL+ K+ +V    +    P+H+V  +GH+    +L+     +  AT     P+H AC+YG+ ++V+ L+    N+         PLH A   G+ DIV +L+++    +  +      + +A R G++ ++ +L
Sbjct:  341 LNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITTNGTSALAIAKRLGYISVIDVL 758          

HSP 7 Score: 192.2 bits (487), Expect = 9.271e-50
Identity = 111/442 (25.11%), Postives = 206/442 (46.61%), Query Frame = 1
Query:  397 KAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTE------------------------------------GNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            +AA  G+L      I+N  DIN   +     +H A    HV +V  L+ N   +    K+    +  A  +G  ++V  L+N    ++ +SQ  + P+++A +  HL+VVK L++N  +    TE                                      + P+H A  Y ++ + +LL+  G+ ++   +N   P+H AS  G+V ++ LLL++   ++A T+ +  P+H     GH+  +++L+D    I+  T+    PIH A    H + VR L+  N  I+    ++  PLH A   G+  +  VL++     +  +   + P+H+AC+  HL ++ +L++     EA TE    P+H+A  +G+ +IV +L+    +  A  +    PLH+A R GH ++ + L+Q     D   K+  + +  A +  + E+
Sbjct:   16 RAARSGNLDKALDHIKNGIDINTANQNGLNGLHLASKEGHVKMVLELLHNGVVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKEL 457          

HSP 8 Score: 159.073 bits (401), Expect = 2.604e-39
Identity = 94/369 (25.47%), Postives = 177/369 (47.97%), Query Frame = 1
Query:  553 DVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWR----------PIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
             + V   +       A +SGN++     I N   I+  +Q     +H+A + GH+ +V  L+ N   +E  T+     +H A   G  ++V  L+  G+ ++A  +  + P++ A+    +E++  LLE   +    TE+K            P+++  +  H+      +   C    AT     P+H A +Y +  + ++L++   N+  +      PLH A   GN+ +V +L++    IDA +K +  P+H A R+GH+ I+++L+ +G   +A T+    PIH+A    + D V  L+     I+  T+D   PLH+A   GH  + K+L+ +G   +    N ++P+ IA K N+  + + L+
Sbjct:    2 SLFVSQADAATSFLRAARSGNLDKALDHIKNGIDINTANQNGLNGLHLASKEGHVKMVLELLHNGVVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHIT-----LKNVCSFITATGFT--PLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLL 363          
BLAST of Protein kinase-like domain vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 258.07 bits (658), Expect = 4.649e-71
Identity = 139/537 (25.88%), Postives = 261/537 (48.60%), Query Frame = 1
Query:  106 AVKSNKIKDIRRLFKV-QFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLL---------------------------------EKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            A K   ++ + +L K+   ++    K    +H A   G  +VVK  +    N+NA S+  + P++ A + NH+++V+ L++N  +    +   + P+  A   GH Q+V LL++N+     R       +H A          LL++N  +  VE K    P+  A   GN+ +  LL+N    +D K++ +  P+HVA + G+ ++VK+L++    I+A T+    P+HC  + GH ++V++L+  G+ + +  +N   P+H A+    +  + LLL                                 +KK +  A     + P+HI C K  ++ ++LL+ +   I+  TE    PIH A + GH  IV  L++   +   ++      LH A   G  ++V  L++N   +DA SK D  P+H++ R G  EI++ L++ G   ++ T   + P+H+A   G+ D+ ++L+    ++   T   + PLH+A +YG  ++  LL+Q+    D   K+  +P+ +A  Y+  ++
Sbjct:   28 ASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR----LPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKV 560          

HSP 2 Score: 243.817 bits (621), Expect = 2.106e-66
Identity = 127/481 (26.40%), Postives = 229/481 (47.61%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
            ++ K   ++ P+H A   GN  +VK  +E+   I+A ++    P+H    + H ++V++L++    I S +     P+H A    HL  V+LL+ +   ++         +H A    H  + K++++   +   +      P+  ACK   ++++ELL+ +   I   ++    PIHVA   GH ++V  L+ +              +H A + G  E+VK L+QNG+ +DA  +++  P+H +S LG  E+I  LL+     ++ T   + P+H+   +GH +   +L+D    + I T+K   P+H A  YG  E+  +L+      + S      PLH A    N  +  +L++      A +K  + P+H+A +   +EI   L+  G  T A T     P+H+A   GN D+V LL++    I  C      PLH+A +    ++ ++L+  G   D   K  Y+P+ +A  Y 
Sbjct:  208 VDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYG 688          

HSP 3 Score: 236.884 bits (603), Expect = 4.182e-64
Identity = 122/445 (27.42%), Postives = 224/445 (50.34%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            +H A   G+ +V K  ++K  N NA +   + P+H AC+ N I++++LL+++  +I++++     P+H AAF GH  IV  L+ +    N    +    +H A      ++VK L++N   V  + K+   P+  + + G  EI++ L+ +    D  +   + P+H+A R GH DV  +L+     +   T+  + P+H A KYG +E+  LL+Q  +  DA G++   P+H A+   + ++  LLL++     A  +  + P+HI   K  +E    L++Y  D    T +   P+H A   G+ ++V +L+  +  I + +     PLH A     +++  VL+ +   +D  +K+ + P+HVAC  G++++V  L++   K  A T+        A   G+  I+NLL+         T++    L IA R G+  +V  L
Sbjct:  318 LHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTK------VTAAQQGHTHIINLLLQHGAAPNELTVNGNTALSIARRLGYISVVDTL 756          

HSP 4 Score: 229.18 bits (583), Expect = 1.443e-61
Identity = 121/527 (22.96%), Postives = 250/527 (47.44%), Query Frame = 1
Query:  238 FIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCK-----------------------------IDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHV---------------------------------ACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            +++   +IN  ++     +H A +  H+E+V  LI+    +++ +      +H A+  G   +VK L+ N  ++NA+++  +  ++ A    H+D+V+ L++N     +  ++   P+  A + G+ ++V LL+ N+ K                              DV+S+  + P+H+A  +G+++V  +L+     ++     +  P+H A K G+  +VKLL++ G+ +DA  ++   P+H  +  G  +++ +LL++   + + T+    P+H+     HL  V+LL+ ++  ++  T      +H A + GHY++ ++++D   N          PLH AC    + ++ +L+++   I A ++    PIHV                                 A R+G  E+VK L++ G   +A ++    P+HI+  +G  +I+  L+      ++ T   + PLH+A R GH D+  +L+ QG +  +  K  ++P+ +A KY   E+ N L+ 
Sbjct:    7 YLKSGVDINICNQNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQ 533          

HSP 5 Score: 212.231 bits (539), Expect = 3.870e-56
Identity = 123/541 (22.74%), Postives = 251/541 (46.40%), Query Frame = 1
Query:   82 NDFQNFIEAVKSNKIKDIRRLF---KVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTE------------GNWK---------------------PIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKK 1596
            N F     A + N +  +R L      Q +  +D     P+  A   G+ +VV   +E     +   +     +H A   +  +   LL++N  N +  S   + P+H AA YG++ +  LL+     ++ +A  +   +H A    + ++VKLL+E    +  + K+   P+    +SG+ ++VE+L++    I  K++    P+H+A +  HL+ V++L+ ++  ++ VT             G++K                     P+H ACK   +++++LL+++G+++ A  E+   PIH A+ +G   ++T L+                +H+    G  E VK L+     ++  ++ ++ P+H +   G  EI++ L+      + + T    PLH A   G+ D+ ++L++    +   +K  + P+HVA + G +E+  +L++K    +A  +    P+H+A    N  +  LL+    +  A   + + PLHIA +    +I   L++ G +T+ + +   SP+ +A +
Sbjct:   86 NGFTPLYMAAQENHLDVVRYLLDNGSSQSIATED--GFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQ 620          

HSP 6 Score: 123.635 bits (309), Expect = 3.227e-28
Identity = 65/326 (19.94%), Postives = 145/326 (44.48%), Query Frame = 1
Query:  157 FLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILI 1134
            +++ K   +  P+H +   G  E+++  ++     ++ +   + P+H A    H ++  +L++   ++   +   + P+H AA YG +++  LL+Q     +A  +     +H A    H D                              N ++  LL++        ++  + P+H+A +   +++   L++   D  A+T     P+H A + G+V++V LL+   +T++ C ++   P+H A+    V +  +L+     V+  T+M + P+H+ CH G+++ V  L+  +  +   T+        A   GH  I+ +L+
Sbjct:  438 YVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAA---HYD------------------------------NQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKV------TAAQQGHTHIINLLL 724          
BLAST of Protein kinase-like domain vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 257.299 bits (656), Expect = 7.871e-71
Identity = 131/479 (27.35%), Postives = 238/479 (49.69%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            +H A   G+ +V K  ++K  N NA +   + P+H AC+ N +++++LL+++  ++++++     P+H AAF GH  IVK L  +    N    +    +H A      D+V+ L++N   V ++ K+    +  A + G  EIV+LL+         +   + P+H+A R GH +   +L+++   + A T+  + P+H A KYG +E  KLL+Q  +  D  G+    P+H A+   +  +  LLL+      A  +  + P+HI   K  LE    L+++  +    T +   P+H A   G  ++V +L+  N N+ + +     PLH A     + +  VL+ +  ++DA +K  + P+HVAC  G++++V  L+    K  + T+  + P+H A   G+  I+N+L+  R +    T++    L IA R G+  +V  L  +G   + L      PV    K N  E  N+ +
Sbjct:  373 LHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL--RGLTDENLTAT--PPVSEKHKLNVPETMNEFL 847          

HSP 2 Score: 246.128 bits (627), Expect = 3.782e-67
Identity = 129/490 (26.33%), Postives = 236/490 (48.16%), Query Frame = 1
Query:  133 IRRLFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
            + R   V F+   D   + P+H A   GN  +VK  +++   I+A ++    P+H    + H ++V++L++    I S +     P+H A    HL  V+LL+Q++  ++         +H A    H  + K++++   +   +      P+  ACK   V+++ELL+ +   +   ++    PIHVA   GH ++VK L  +              +H A + G  ++V+ L+QNG+ +D   +++   +H AS LG  E++ LLL+K     A T   + P+H+   +GH E   LL+++   +  AT+K   P+H A  YG  E  ++L+      + +      PLH A    N  +  +L+++     A +K  + P+H+A +   LEI   L+  G +T A T     P+H+A   G+ D+V+LL++   N+     +   PLH+A +     + ++L+  G   D   K  Y+P+ +A  Y 
Sbjct:  257 LNRGAAVDFMARND---ITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYG 743          

HSP 3 Score: 244.973 bits (624), Expect = 8.746e-67
Identity = 127/546 (23.26%), Postives = 262/546 (47.99%), Query Frame = 1
Query:   70 FIIMNDFQNFIEAVKSNKIKDIRRLF-KVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIF---------------------------------YACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            F+  ND      A K      ++ L  +   ++ K    + P+H     G+ +VV+  +++   I + ++    P+H A + +H+  V+LL+++   ++ +++     +H AA  GH ++ K+++    + NA+A   +  +H AC    V +++LL+++   +    +    PI                                   A ++G  ++V  L+ N  K+D+K++ +   +H+A R G  ++V++L+Q      A T   + P+H A + GH E   LL+++G++L A  +  + P+H A+  G +E   LLL+K+   +   +    P+H+  H  +     LL+D+      A +    P+H A      EI   L++          +   PLH A   G++D+V++L+  + +++  +K    P+H+A +   + + ++L+  G + +A+T+  + P+H+AC  GN  +V+ L+ ++  I + T   + PLH A + GH  I+ +L+Q   + + L  N  + + IA++  Y
Sbjct:  265 FMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGY 810          

HSP 4 Score: 240.736 bits (613), Expect = 1.913e-65
Identity = 143/575 (24.87%), Postives = 250/575 (43.48%), Query Frame = 1
Query:  106 AVKSNKIKDIRRLFKV-QFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTE---------------------------------MKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLD---------------------------------WRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            A K   ++ +  L K+   ++    K    +H A   G  +VV+  +    N+NA S+  + P++ A + NH+E+V+ L+E+  +    +   + P+  A   GH Q+V LL++N+     R       +H A          LL++N  +  VE K    P+  A   GN+ +  LL+N    +D  ++ +  P+HVA + G+ ++VK+L+     I+A T+    P+HC  + GH ++V++L+  G+ + +  +N   P+H A+    +  + LLL+    V+ VT                                    + P+HI C K  ++ ++LL+ +   ++  TE    PIH A + GH  IV+ L     +   ++      LH A   G  D+V  L++N   +D  +K D                                 + P+H+A R GH E   +L+  G    A T+  + P+H+A   G  +   LL+  R   +        PLH+A  Y +  +  LL+  G +     KN Y+P+ IA K N  EI   L+
Sbjct:   83 ASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLL 653          

HSP 5 Score: 227.639 bits (579), Expect = 4.138e-61
Identity = 128/541 (23.66%), Postives = 260/541 (48.06%), Query Frame = 1
Query:   94 NFIEAVKSNKIKDIRRLFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCK-----------------------------IDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            N +E  K  + +  R+  + Q  + K D N   +  A   GN+E    +++   +IN  ++     +H A +  H+E+V  L++   ++++ +      +H A+  G   +V+ L+ N  ++NA+++  +  ++ A    H+++V+ L+E+     +  ++   P+  A + G+ ++V LL+ N+ K                              DV+S+  + P+H+A  +G+++V  +L+     ++ +   +  P+H A K G+  +VKLL+  G+ +DA  ++   P+H  +  G  +++ +LL++   + + T+    P+H+     HL  V+LL+ +   ++  T      +H A + GHY++ ++++D   N          PLH AC    + ++ +L+++   + A ++    PIHVA   GH  IVK L   G             +H+A   G  D+V  L+ +   ++    DD   LHIA R G A+IV+LL+Q+G        + Y+P+ +A +  + E  + L+
Sbjct:   17 NALEDDKDQRRRKNRKHSREQ--KKKSDSNASYLR-AARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLL 554          

HSP 6 Score: 186.037 bits (471), Expect = 1.024e-47
Identity = 98/412 (23.79%), Postives = 202/412 (49.03%), Query Frame = 1
Query:  397 KAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            +AA  G+L+     ++   DIN   +     +H A    HV++V  L++    V    K+    +  A  +G  ++V  L+ N   ++ +SQ  + P+++A +  HL+VV+ L+++       TE  + P+  A + GH ++V LL++N    D  G+     +H A+   D +   LLL+   + +  ++  + P+HI  H G++    LL++    ++     +  P+H A   G+  +V++L+D    I+    +   PLH    +G+  +V +L++    I + +K    P+H+A +  HL  V++L++     +  T      +H+A   G+Y +  +++  + N  A  ++ + PLHIAC+     +++LL++ G +   + ++  +P+ +A    +  I   L H
Sbjct:   49 RAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTH 456          

HSP 7 Score: 150.984 bits (380), Expect = 1.158e-36
Identity = 87/362 (24.03%), Postives = 174/362 (48.07%), Query Frame = 1
Query:  592 FYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLM--DYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAF 1671
              A ++GN+E     +     I++ +Q     +H+A + GH++VV  L++    ++A T+     +H A   G  ++V+ L+ NG+ ++A  +N + P++ A+    +E++  LLE        TE  + P+ +   +GH + V LL+  D K  + +        +H A      +   +L+ ++ N +V       PLH A   GN+++  +L+     +D  ++ D  P+HVA + G+  +VK+L+ +G K +A T+    P+H     G+  +V +L+     I + T +   PLH+A +  H + V+LL+Q     D +  +  + + +A    + ++   ++    N     L  F
Sbjct:   48 LRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPA------LHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGF 403          
BLAST of Protein kinase-like domain vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 256.529 bits (654), Expect = 1.468e-70
Identity = 131/479 (27.35%), Postives = 238/479 (49.69%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            +H A   G+ +V K  ++K  N NA +   + P+H AC+ N +++++LL+++  ++++++     P+H AAF GH  IVK L  +    N    +    +H A      D+V+ L++N   V ++ K+    +  A + G  EIV+LL+         +   + P+H+A R GH +   +L+++   + A T+  + P+H A KYG +E  KLL+Q  +  D  G+    P+H A+   +  +  LLL+      A  +  + P+HI   K  LE    L+++  +    T +   P+H A   G  ++V +L+  N N+ + +     PLH A     + +  VL+ +  ++DA +K  + P+HVAC  G++++V  L+    K  + T+  + P+H A   G+  I+N+L+  R +    T++    L IA R G+  +V  L  +G   + L      PV    K N  E  N+ +
Sbjct:  345 LHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL--RGLTDENLTAT--PPVSEKHKLNVPETMNEFL 819          

HSP 2 Score: 249.98 bits (637), Expect = 2.177e-68
Identity = 141/545 (25.87%), Postives = 254/545 (46.61%), Query Frame = 1
Query:  106 AVKSNKIKDIRRLFKV-QFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDK--------EKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTE---------------------------------MKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            A K   ++ +  L K+   ++    K    +H A   G  +VV+  +    N+NA S+  + P++ A + NH+E+V+ L+E+  +    +   + P+  A   GH Q+V LL++N+     R       +H A          LL++N  +  VE K            P+  A   GN+ +  LL+N    +D  ++ +  P+HVA + G+ ++VK+L+     I+A T+    P+HC  + GH ++V++L+  G+ + +  +N   P+H A+    +  + LLL+    V+ VT                                    + P+HI C K  ++ ++LL+ +   ++  TE    PIH A + GH  IV+ L     +   ++      LH A   G  D+V  L++N   +D  +K D   +H+A R G  EIV++L++KG    A T   + P+H+A   G+ +  +LL+    ++ A T   + PLH+A +YG  +  KLL+Q+    D   K   +P+ +A  Y+   +
Sbjct:   47 ASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRV 587          

HSP 3 Score: 245.358 bits (625), Expect = 7.698e-67
Identity = 129/490 (26.33%), Postives = 236/490 (48.16%), Query Frame = 1
Query:  133 IRRLFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
            + R   V F+   D   + P+H A   GN  +VK  +++   I+A ++    P+H    + H ++V++L++    I S +     P+H A    HL  V+LL+Q++  ++         +H A    H  + K++++   +   +      P+  ACK   V+++ELL+ +   +   ++    PIHVA   GH ++VK L  +              +H A + G  ++V+ L+QNG+ +D   +++   +H AS LG  E++ LLL+K     A T   + P+H+   +GH E   LL+++   +  AT+K   P+H A  YG  E  ++L+      + +      PLH A    N  +  +L+++     A +K  + P+H+A +   LEI   L+  G +T A T     P+H+A   G+ D+V+LL++   N+     +   PLH+A +     + ++L+  G   D   K  Y+P+ +A  Y 
Sbjct:  229 LNRGAAVDFMARND---ITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYG 715          

HSP 4 Score: 244.202 bits (622), Expect = 1.483e-66
Identity = 127/546 (23.26%), Postives = 262/546 (47.99%), Query Frame = 1
Query:   70 FIIMNDFQNFIEAVKSNKIKDIRRLF-KVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIF---------------------------------YACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            F+  ND      A K      ++ L  +   ++ K    + P+H     G+ +VV+  +++   I + ++    P+H A + +H+  V+LL+++   ++ +++     +H AA  GH ++ K+++    + NA+A   +  +H AC    V +++LL+++   +    +    PI                                   A ++G  ++V  L+ N  K+D+K++ +   +H+A R G  ++V++L+Q      A T   + P+H A + GH E   LL+++G++L A  +  + P+H A+  G +E   LLL+K+   +   +    P+H+  H  +     LL+D+      A +    P+H A      EI   L++          +   PLH A   G++D+V++L+  + +++  +K    P+H+A +   + + ++L+  G + +A+T+  + P+H+AC  GN  +V+ L+ ++  I + T   + PLH A + GH  I+ +L+Q   + + L  N  + + IA++  Y
Sbjct:  237 FMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGY 782          

HSP 5 Score: 220.705 bits (561), Expect = 7.530e-59
Identity = 117/479 (24.43%), Postives = 239/479 (49.90%), Query Frame = 1
Query:  202 ACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQN--KCDIEAV------TEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            A   GN+E    +++   +IN  ++     +H A +  H+E+V  L++   ++++ +      +H A+  G   +V+ L+ N  ++NA+++  +  ++ A    H+++V+ L+E+     +  ++   P+  A + G+ ++V LL+ N    D K +     +H+A R        +L+QN    D+E+       T   + P+H A  YG++ +  LL+  G+ +D    N+  P+H A+  G+  ++ LLL++   ++A T+    P+H     GH + V++L+D    I   T+    P+H A    H   V++L+  +  ++    +    LH A   G+  +  V+++   + +A +   + P+H+AC+   ++++++L++ G   +A TE    PIH+A  +G+ +IV  L     +     +     LH+A R G AD+V+ L+Q G   D+  K+  + + IA +    EI
Sbjct:   14 AARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEI 488          

HSP 6 Score: 181.8 bits (460), Expect = 2.411e-46
Identity = 102/420 (24.29%), Postives = 203/420 (48.33%), Query Frame = 1
Query:  397 KAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEK--KCDVEAV------TEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            +AA  G+L+     ++   DIN   +     +H A    HV++V  L++    V    K+    +  A  +G  ++V  L+ N   ++ +SQ  + P+++A +  HL+VV+ L+++       TE  + P+  A + GH ++V LL++N    D  G+     +H A+   D +   LLL+     DVE+       T   + P+HI  H G++    LL++    ++     +  P+H A   G+  +V++L+D    I+    +   PLH    +G+  +V +L++    I + +K    P+H+A +  HL  V++L++     +  T      +H+A   G+Y +  +++  + N  A  ++ + PLHIAC+     +++LL++ G +   + ++  +P+ +A    +  I   L H
Sbjct:   13 RAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTH 428          

HSP 7 Score: 142.895 bits (359), Expect = 3.846e-34
Identity = 87/370 (23.51%), Postives = 174/370 (47.03%), Query Frame = 1
Query:  592 FYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLM--DYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDT--------ENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAF 1671
              A ++GN+E     +     I++ +Q     +H+A + GH++VV  L++    ++A T+     +H A   G  ++V+ L+ NG+ ++A  +N + P++ A+    +E++  LLE        TE  + P+ +   +GH + V LL+  D K  + +        +H A      +   +L+ ++ N +V               PLH A   GN+++  +L+     +D  ++ D  P+HVA + G+  +VK+L+ +G K +A T+    P+H     G+  +V +L+     I + T +   PLH+A +  H + V+LL+Q     D +  +  + + +A    + ++   ++    N     L  F
Sbjct:   12 LRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPA------LHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGF 375          
BLAST of Protein kinase-like domain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 263.462 bits (672), Expect = 2.004e-75
Identity = 140/511 (27.40%), Postives = 252/511 (49.32%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNC----------------DINARA---------------------EKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            +H A   G  ++V+  +E   NINA S+  + P++ A + NH+EIVK L++N  N    +   + P+  A   GH Q+V LL++++                 D NA A                     E  +  +H A    ++++  LL+     V    +    P+  A K GN  +V+LL++   KID K++    P+H A R GH  V+++L++    I A T+    P+H A +  H+  V+LL+   + +D    +   P+H A+  G   +  LLL++  +  A     + P+HI C K  ++ ++LL+ +   I   TE    PIH A + GH  +V++L+ +  +   ++     PLH A   G L++V  L+++   +   ++ D  P+H+A R G  EIV++L+++G    A T     P++ A   G+ D+ +LL+ +  +I   T   + PLHIA +YG  ++  LL+++  + D   KN  +P+ +A  Y++ ++
Sbjct:   80 LHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKV 590          

HSP 2 Score: 258.455 bits (659), Expect = 1.387e-73
Identity = 127/448 (28.35%), Postives = 234/448 (52.23%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            + P+H A   G+  V K  +++    NA +   + P+H AC+ N I++++LL+++  +I + +     P+H A+F GHL +V+LL+QN    NA   +    +H A     +++VK L+++   V V+ +E   P+  A + G  EIV+LL+      +  +     P++ A R GH DV  +L++N  DI  VT+  + P+H A KYG +E+  LL++  ++ D  G+N   P+H A+     ++  LLL+K     +  +  + P+HI   K  LE  K+L++   +  + T++   P+H A   GH ++V +L+  + +I ++       +H A     +++  +L ++  D++  +KL + P+HVA   G++++V  L+R      A T   + P+H A   G+  +VN L+    +    T +    L IA R G+  +V  L
Sbjct:  345 LTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 792          

HSP 3 Score: 252.292 bits (643), Expect = 1.744e-71
Identity = 134/515 (26.02%), Postives = 248/515 (48.16%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGK---------------------------------WRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            ++ K    + P+H A   G+ +V++  +E+   I A ++    P+H A +  H+  V+LL+  +  ++ ++     P+H AA  GH ++ KLL+    + NARA   +  +H AC    + +++LL+++   +    +    PI  A   G++ +V+LL+ N    +  +     P+H+A R G L+VVK L+Q+   +      +  P+H A + G  EIV+LL+Q GS  +A   +   P+++AS  G  ++ +LLLE   D+  VT+  + P+HI    G LE   LL++     +   +    P+H A +Y H ++  +L+D   +   +      PLH A     L++  VL+E   + +  ++    P+H+A + GH ++V +L+ +       T+G                                  + P+H+A   GN  +VN L+ +R  + A T + + PLH A + GH  +V  L+Q   + + L  N  + + IA++  Y
Sbjct:  271 IDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGY 785          

HSP 4 Score: 243.432 bits (620), Expect = 2.387e-68
Identity = 141/564 (25.00%), Postives = 256/564 (45.39%), Query Frame = 1
Query:  130 DIRRLFKVQF---LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIEN-------------------------------------RCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAP 1701
            DI R+  V+F   +  +      P++ A    ++E+VKF ++   N +  +E  + P+  A +  H ++V LL+E+                                     +  +   +   + P+H AA YG++ +  LL+     ++  A      +H A    + ++VKLL++    +  + ++   P+  A +SG+ +++E+L+  +  I  K++    P+H+A +  HL  V++L+  +  ++ VT     P+H A   GH  + KLL+  G   +A   N + P+H A     ++++ LLL+    +   TE    PIH+    GHL  V+LL+           +   P+H A   G  E+V+ L+ S   + V   E+  PLH A   G  +IV +L++   D +AP+     P++ A R GH ++  +L+  G      T+  + P+HIA   G  ++  LL+    + +    +   PLH+A  Y H  +  LL+ +G +     KN Y+P+ IA K N  E+   L+        N+LT       +G AP
Sbjct:   90 DIVRVL-VEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAET--NMLT------QQGVAP 644          

HSP 5 Score: 243.047 bits (619), Expect = 2.814e-68
Identity = 135/523 (25.81%), Postives = 245/523 (46.85%), Query Frame = 1
Query:  172 DDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIEN-------------------------------HCDVVVE------DKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            +   +  +H A   G+V+VV   +++   I+  ++     +H A      +IV++L+E   NI + S   + P++ AA   HL+IVK L+ N  + +   E  +  +  A    H  +V LL+E+                               + DV  +       +    P+  A   GN+ +  LL+N    +D  ++    P+HVA + G+ ++VK+L+     I+  T     P+HCA + GH +++++L++  + + A  +N   P+H A+    +  + LLL ++  V+ VT     P+H+  H GH    KLL+D   +          P+H AC     +++ +L+    +I  +      P+H A   G+L++V +L++N    +A +     P+H+A R+G LE+VK L++ G +          P+HIA  +G  +IV LL+    +  A T     PL+ A R GH D+  LL++ G +   + K  ++P+ IA KY   E+   L+
Sbjct:   40 NQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLL 562          

HSP 6 Score: 235.343 bits (599), Expect = 1.332e-65
Identity = 125/513 (24.37%), Postives = 249/513 (48.54%), Query Frame = 1
Query:  202 ACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVK-------------------------------------SQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            A   GN+E +   ++   +IN  ++     +H A +  H+++V  L++    I++ + +    +H AA  G   IV++L++   +INA+++  +  ++ A    H++IVK L++N  +  V  ++   P+  A + G+ ++V LL+ ++ K  V+                                     ++  + P+H+A  +G+++V  +L+     ++        P+H A K G+  +VKLL+  G+ +D    +   P+H A+  G  ++I +LLE+   + A T+    P+H+     HL  V+LL+  +  ++  T     P+H A + GHY + ++L+D              PLH AC    + ++ +L+++   I   ++    PIHVA   GHL +V++L++ G  + A       P+H+A   G  ++V  L+ S   +     +D  PLHIA R G A+IV+LL+Q+G + +    +  +P+  A +  + ++ + L+
Sbjct:   17 AARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLL 529          

HSP 7 Score: 232.261 bits (591), Expect = 1.580e-64
Identity = 124/489 (25.36%), Postives = 231/489 (47.24%), Query Frame = 1
Query:  157 FLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAK---KYNYNEI 1614
             L    +    P+H A   GN+ V    +     ++  +     P+H A +  +  +VKLL++    I++ +     P+H AA  GH +++++L++ +  I A+ +     +H A   +H+  V+LL+     V     +   P+  A   G+  + +LL++   + + ++   + P+H+AC+   + V+++L+++   I   TE    PIH A   GH+ +V+LL+QNG++ +A       P+H AS  G +E++  LL+    V         P+HI    G  E V+LL+    D    T     P+++A   GH ++  +L+++  +I     +   PLH A   G L++  +L+E     D   K    P+HVA    H ++  +L+ KG    +  +  + P+HIA      ++  +L+         T     PLH+A + GHAD+V LL+ +  +  +  K   + + +A    K N  EI
Sbjct:  204 MLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEI 692          

HSP 8 Score: 197.208 bits (500), Expect = 1.331e-52
Identity = 126/493 (25.56%), Postives = 230/493 (46.65%), Query Frame = 1
Query:  346 NRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWK--PIHCACKYGHVEIVKLLIQNGSTLDACG--------ENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDW-RPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIFLFK 1791
            N CN   L+++     H A+  GH+ +V  L++   +I+   +     +H A L    DIV++L+E   ++  + +    P++ A +  ++EIV+ L++N     V ++  + P+ VA + GH  VV +L+      E+ T+G  +   +H A +        LL+Q+    D           E+ + P+H A+  G++ + TLLL     V+        P+H+   +G+   VKLL+D    I+  T     P+H A   GH +++ +L++ +  I         PLH A    +L  V +L+     +D  + LD+  P+HVA   GH  + K+L+ +G +  A     + P+HIAC      ++ LL+    +I   T     P+H+A   GH ++V+LL+Q G +++  +    +P+ +A +    E+   L+ +            K+ ED+        T LH     IA  +GK  I ++ L +
Sbjct:   37 NTCNQNGLNAL-----HLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLL------ESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVT-LDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARV------GVKAREDQ--------TPLH-----IASRLGKAEIVQLLLQR 498          

HSP 9 Score: 168.703 bits (426), Expect = 2.786e-43
Identity = 93/387 (24.03%), Postives = 183/387 (47.29%), Query Frame = 1
Query:  553 DVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLM--DYKCDIEI-----------------------------------ATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
            + +++  +       A ++GN+E +   +     I+  +Q     +H+A + GH+DVV  L++ + +I+  T+     +H A   G  +IV++L++ G+ ++A  +N + P++ A+    +E++  LL+   +    TE  + P+ +   +GH + V LL+  D K  + +                                    TE    P+H A +YG+  +  +L++    ++ +      PLH A   GN ++V +L++    ID  ++    P+H A RSGH ++++ML+ +     A T+    P+H+A    +   V LL+  +  ++  T+D   PLH+A   GH  + KLL+ +G   +    N ++P+ IA K N
Sbjct:    2 ETLLDKSDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKN 388          

HSP 10 Score: 149.058 bits (375), Expect = 4.503e-37
Identity = 76/343 (22.16%), Postives = 164/343 (47.81%), Query Frame = 1
Query:  106 AVKSNKIKDIRRLFKVQF-LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRIL 1131
            A ++ +++ ++ L +    + +K  ++  P+H A   G  E+V+  +++  + NAP+     P+++A    H ++  LL+EN  +I  ++   + P+H A+ YG L++  LL++     + + +     +H A    H  +  LL++         K    P+  A K   +E+ ++L+    + ++ +Q    P+H+A + GH D+V +L+     I   T+G    +H A +   V + ++L ++ + ++   +  + P+H AS  G+++++  LL  +  V A T   + P+H    +GH   V  L+ ++      T      +  A   G+  +V  L
Sbjct:  450 ASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 792          
BLAST of Protein kinase-like domain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 260.766 bits (665), Expect = 7.687e-75
Identity = 136/509 (26.72%), Postives = 249/509 (48.92%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMD---------------------------------YKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTD--VLDKNRYSPVDIAKKYNYNEI 1614
            +H A   G  ++V+  +E   NINA S+  + P++ A + NH+EIVK L++N  N    +   + P+  A   GH Q+V LL++++     R       +H A      +   LL+++  +  V  K    P+  A   GN+ +  LL+N    +D  ++    P+HVA + G+ ++VK+L+     I+  T     P+HCA + GH +++++L++  + + A  +N   P+H A+    +  + LLL ++  V+ VT     P+H+  H GH    KLL+D                                 +   I   TE    PIH A + GH  +V++L+ +  +   ++     PLH A   G L++V  L+++   +   ++ D  P+H+A R G  EIV++L+++G    A T     P++ A   G+ D+ +LL+ +  +I   T   + PLHIA +YG  ++  LL+++  + D  V  +N  +P+ +A  Y++ ++
Sbjct:   81 LHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVR----LPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKV 585          

HSP 2 Score: 254.218 bits (648), Expect = 1.513e-72
Identity = 127/450 (28.22%), Postives = 234/450 (52.00%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDA--CGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            + P+H A   G+  V K  +++    NA +   + P+H AC+ N I++++LL+++  +I + +     P+H A+F GHL +V+LL+QN    NA   +    +H A     +++VK L+++   V V+ +E   P+  A + G  EIV+LL+      +  +     P++ A R GH DV  +L++N  DI  VT+  + P+H A KYG +E+  LL++  ++ D    G+N   P+H A+     ++  LLL+K     +  +  + P+HI   K  LE  K+L++   +  + T++   P+H A   GH ++V +L+  + +I ++       +H A     +++  +L ++  D++  +KL + P+HVA   G++++V  L+R      A T   + P+H A   G+  +VN L+    +    T +    L IA R G+  +V  L
Sbjct:  338 LTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 787          

HSP 3 Score: 254.218 bits (648), Expect = 1.621e-72
Identity = 136/517 (26.31%), Postives = 251/517 (48.55%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMD--YKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGK---------------------------------WRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            ++ K    + P+H A   G+ +V++  +E+   I A ++    P+H A +  H+  V+LL+  +  ++ ++     P+H AA  GH ++ KLL+    + NARA   +  +H AC    + +++LL+++   +    +    PI  A   G++ +V+LL+ N    +  +     P+H+A R G L+VVK L+Q+   +      +  P+H A + G  EIV+LL+Q GS  +A   +   P+++AS  G  ++ +LLLE   D+  VT+  + P+HI    G LE   LL++     D ++A +    P+H A +Y H ++  +L+D   +   +      PLH A     L++  VL+E   + +  ++    P+H+A + GH ++V +L+ +       T+G                                  + P+H+A   GN  +VN L+ +R  + A T + + PLH A + GH  +V  L+Q   + + L  N  + + IA++  Y
Sbjct:  264 IDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGY 780          

HSP 4 Score: 241.121 bits (614), Expect = 7.708e-68
Identity = 127/505 (25.15%), Postives = 249/505 (49.31%), Query Frame = 1
Query:  202 ACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCK-----------------------------IDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            A   GN+E +   ++   +IN  ++     +H A +  H+++V  L++    I++ + +    +H AA  G   IV++L++   +INA+++  +  ++ A    H++IVK L++N  +  V  ++   P+  A + G+ ++V LL+ ++ K                              DV S+  + P+H+A  +G+++V  +L+     ++        P+H A K G+  +VKLL+  G+ +D    +   P+H A+  G  ++I +LLE+   + A T+    P+H+     HL  V+LL+  +  ++  T     P+H A + GHY + ++L+D              PLH AC    + ++ +L+++   I   ++    PIHVA   GHL +V++L++ G  + A       P+H+A   G  ++V  L+ S   +     +D  PLHIA R G A+IV+LL+Q+G + +    +  +P+  A +  + ++ + L+
Sbjct:   18 AARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLL 522          

HSP 5 Score: 226.483 bits (576), Expect = 9.659e-63
Identity = 114/486 (23.46%), Postives = 234/486 (48.15%), Query Frame = 1
Query:  163 EMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGK--WRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            + K    +  +H A    +       ++   N +  S+  + P+H A    ++ +  LL+     ++  +     P+H AA  G+  +VKLL+     I+ +       +H A  + H  ++++L+E    ++ + K    P+  A +  ++  V+LL+     +D  +     P+HVA   GH  V K+L+    +  A     + P+H ACK   +++++LL+++G+++    E+   PIH AS +G + ++ LLL+      A       P+H+    G LE VK L+     + +   +++ P+H A   G  EIV++L+    +        + PL++A   G+ D+ ++L+EN  DI   +K  + P+H+A + G LE+  +L+ K    +    G+    P+H+A    +  +  LL+    +  +   + + PLHIA +    ++ K+L++ G  T++L +   +P+ +A +  + ++
Sbjct:  166 DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADM 651          

HSP 6 Score: 202.216 bits (513), Expect = 1.673e-54
Identity = 125/485 (25.77%), Postives = 230/485 (47.42%), Query Frame = 1
Query:  346 NRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWK--PIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDW-RPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIFLFK 1791
            N CN   L+++     H A+  GH+ +V  L++   +I+   +     +H A L    DIV++L+E   ++  + +    P++ A +  ++EIV+ L++N     V ++  + P+ VA + GH  VV +L+      E+ T+G  +   +H A +        LL+Q+    D   ++ + P+H A+  G++ + TLLL     V+        P+H+   +G+   VKLL+D    I+  T     P+H A   GH +++ +L++ +  I         PLH A    +L  V +L+     +D  + LD+  P+HVA   GH  + K+L+ +G +  A     + P+HIAC      ++ LL+    +I   T     P+H+A   GH ++V+LL+Q G +++  +    +P+ +A +    E+   L+ +            K+ ED+        T LH     IA  +GK  I ++ L +
Sbjct:   38 NTCNQNGLNAL-----HLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLL------ESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVT-LDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARV------GVKAREDQ--------TPLH-----IASRLGKAEIVQLLLQR 491          
BLAST of Protein kinase-like domain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 251.906 bits (642), Expect = 6.503e-70
Identity = 126/448 (28.12%), Postives = 230/448 (51.34%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            +  +H A   G+    K  ++K  N N  +   + P+H AC+ N I +++LL++   +IE+++     P+H +AF G+L IV +L+Q     NA   +    +H A      ++V+ L+ N   V  + +E+  P+  A + G +EIV+LL+ +    D  +   + P+HVA R GH DV  +L+++   +   T+  + P+H A KYG +E+  LL+Q  ++ DA G+N   P+H AS   + ++  LLL++     A  +  + P+HI   K  LE    L++Y  +    T +   P+H     GH ++  +L+    ++  +      PLH A     +++  +L+++   ++A +KL + P+ VAC  G++++V  L++ G    + T+  + P+H A   G+  IVNLL+         T++    L IA R G+  +V  L
Sbjct:   73 LTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 520          

HSP 2 Score: 237.654 bits (605), Expect = 2.710e-65
Identity = 120/483 (24.84%), Postives = 238/483 (49.28%), Query Frame = 1
Query:  181 NMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
             + P+H A   G+ +VV+  +E+   I A ++    P+H A + +H+E V++L++ R  ++ ++      +H AA  GH +  K+L+    + N RA   +  +H AC    + +++LL++    +    +    P+  +   GN+ IV +L+      +  +      +H+A R G  +VV+ L++N   ++A       P+H A + G +EIV+LL+Q+ ++ DA   N + P+H A+  G  ++  +LLE    +   T+  + P+H+    G +E   LL+      + A +    P+H A +Y + ++  +L+D   +   +      PLH A     L+I   L+E   + +A ++    P+H+  + GH ++  +L+ +       T+    P+H+A      ++  +L+    ++ A T   + PL +AC YG+  +V  L+Q G + +   KN Y+P+  A +  +  I N L+
Sbjct:    6 GLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL 488          

HSP 3 Score: 177.178 bits (448), Expect = 1.076e-45
Identity = 101/418 (24.16%), Postives = 192/418 (45.93%), Query Frame = 1
Query:   79 MNDFQNFIEAVKSNKIKDIRRLFKV-QFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKML 1329
            +N F     A K N+I+ +  L K    +E   +  + P+H +   GN+ +V   ++   + NA +      +H A      E+V+ L+ N   +++ +  E  P+H AA  G L+IV+LL+Q+    +A     +  +H A    H D+  +L+E+   + V  K+   P+  A K G +E+  LL+      D   +    P+HVA  + +  V  +L+       A  +  + P+H A K   +EI   L++ G+  +A       P+H  +  G  ++ +LLL +  DV   T+    P+H+   +  +   ++L+ +   +   T+    P+  AC+YG+ ++V  L+    ++         PLH A   G+  IVN+L++     +  +      + +A R G++ +V  L
Sbjct:  103 LNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 520          
BLAST of Protein kinase-like domain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 246.128 bits (627), Expect = 1.171e-68
Identity = 122/430 (28.37%), Postives = 223/430 (51.86%), Query Frame = 1
Query:  238 FIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
             ++K  N N  +   + P+H AC+ N I +++LL++   +IE+++     P+H +AF G+L IV +L+Q     NA   +    +H A      ++V+ L+ N   V  + +E+  P+  A + G +EIV+LL+ +    D  +   + P+HVA R GH DV  +L+++   +   T+  + P+H A KYG +E+  LL+Q  ++ DA G+N   P+H AS   + ++  LLL++     A  +  + P+HI   K  LE    L++Y  +    T +   P+H     GH ++  +L+    ++  +      PLH A     +++  +L+++   ++A +KL + P+ VAC  G++++V  L++ G    + T+  + P+H A   G+  IVNLL+         T++    L IA R G+  +V  L
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 430          

HSP 2 Score: 193.356 bits (490), Expect = 4.709e-51
Identity = 97/398 (24.37%), Postives = 191/398 (47.99%), Query Frame = 1
Query:  436 LIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            L+    + N RA   +  +H AC    + +++LL++    +    +    P+  +   GN+ IV +L+      +  +      +H+A R G  +VV+ L++N   ++A       P+H A + G +EIV+LL+Q+ ++ DA   N + P+H A+  G  ++  +LLE    +   T+  + P+H+    G +E   LL+      + A +    P+H A +Y + ++  +L+D   +   +      PLH A     L+I   L+E   + +A ++    P+H+  + GH ++  +L+ +       T+    P+H+A      ++  +L+    ++ A T   + PL +AC YG+  +V  L+Q G + +   KN Y+P+  A +  +  I N L+
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL 398          

HSP 3 Score: 190.66 bits (483), Expect = 3.764e-50
Identity = 91/349 (26.07%), Postives = 176/349 (50.43%), Query Frame = 1
Query:  586 PIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            P+  ACK   + ++ELL+     I+  ++    P+HV+   G+L++V +L+Q      A        +H A + G  E+V+ L++NG+ +DA       P+H A+ LG +E++ LLL+     +A T   + P+H+   +GH +   +L+++   + + T+K   P+H A  YG  E+  +L+    + + +      PLH A    N  +  +L++      A +K  + P+H+A +   LEI   L+  G +T A T     P+H+    G+ D+ +LL++   ++   T     PLH+A +    ++ ++L++ G + +   K  Y+P+ +A  Y   ++ N L+ 
Sbjct:   18 PLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQ 366          

HSP 4 Score: 177.563 bits (449), Expect = 5.708e-46
Identity = 101/418 (24.16%), Postives = 192/418 (45.93%), Query Frame = 1
Query:   79 MNDFQNFIEAVKSNKIKDIRRLFKV-QFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKML 1329
            +N F     A K N+I+ +  L K    +E   +  + P+H +   GN+ +V   ++   + NA +      +H A      E+V+ L+ N   +++ +  E  P+H AA  G L+IV+LL+Q+    +A     +  +H A    H D+  +L+E+   + V  K+   P+  A K G +E+  LL+      D   +    P+HVA  + +  V  +L+       A  +  + P+H A K   +EI   L++ G+  +A       P+H  +  G  ++ +LLL +  DV   T+    P+H+   +  +   ++L+ +   +   T+    P+  AC+YG+ ++V  L+    ++         PLH A   G+  IVN+L++     +  +      + +A R G++ +V  L
Sbjct:   13 LNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 430          
BLAST of Protein kinase-like domain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002048.1 (pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 gene:ENSPMAG00000001850.1 transcript:ENSPMAT00000002048.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 209.149 bits (531), Expect = 6.339e-56
Identity = 136/519 (26.20%), Postives = 257/519 (49.52%), Query Frame = 1
Query:  202 ACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLS-SIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKS-QFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEK-ERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTID-DWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSD--------EDEGDAPNFSLTSL 1722
            AC+ G+V  V+  + +  +++  +E     +  AC   + E+ ++L+    N+E      +  P+  AA  G + IV+LL+ +  D+NA++      + +AC   +VD+V++L+E   ++   ++    P+  A   G+VE+  LL+     I+  S +F    + +AC  GHL++V+ L++   D E  T+     +  AC  GHVE+ +LL+++G+ ++   ++   P+  A+  G VEL  LL+E+  ++E V +  + P+     +GH E V LL+    +I   TE+ +   +  AC  G  E+   LI +  ++E+     + PL  A   G+L++V  L+    ++ A +      +  AC +GH ++  +L++ G   E  +EG   P+  A   G+   V  LIS   ++   T + D   L +AC  GH  +V+LL+  G + +   K+  + +  A K  +  +   LI    +  HN+L+A   +        +D+G AP   + +L
Sbjct:  107 ACSDGDVNAVRKLLGEGRSVHETTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGVKGDITPLMAAASGGFVDIVRLLLAHGADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADLELG---CSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGADPNHRLKDGSTMLIEAAKGGHTSVVCYLI----DYPHNLLSASPPEAPQLTPPPQDQGQAPRVPMQAL 618          

HSP 2 Score: 183.726 bits (465), Expect = 9.730e-48
Identity = 112/452 (24.78%), Postives = 211/452 (46.68%), Query Frame = 1
Query:  181 NMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARA-EKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKT-EAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLI 1530
            ++ P+  A +GG V++V+  +    ++NA S      + YAC   ++++V++L+E   N+E  +     P+ +AA  GH+++ +LL++    IN  + E     +  AC   H+++V+ L+E   D   +  E    +  AC  G+VE+  LL+ +  ++++ +     P+ +A   GH+++  +LI+   ++E V +  + P+  A + GH E+V LL+  G+ ++A  E                                E +   + + C  G LE    L+    D+E+       P+  A   GH E+V+ L+ +  N+  +       L YAC NG+ D+ ++L++   D++  S+    P+  A R+GH+  V+ LI KG     A        + +AC  G+  +V LL++   +      D    L  A + GH  +V  LI
Sbjct:  167 DITPLMAAASGGFVDIVRLLLAHGADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTE--------------------------------ETQETALTLACCGGFLEVADFLIKAGADLELGCST---PLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGADPNHRLKDGSTMLIEAAKGGHTSVVCYLI 583          

HSP 3 Score: 166.392 bits (420), Expect = 3.250e-42
Identity = 102/401 (25.44%), Postives = 200/401 (49.88%), Query Frame = 1
Query:  463 ARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKS-QFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEA-VTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYT-EGKWRPIHIACLIGNYDIVNLLISSRCNIE-ACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIH 1653
            A  + + R +  AC +  V+ V+ L+     V    +E    +  AC +G  E+ ++L+  +  ++ +  + +  P+  A   G +D+V++L+ +  D+ A +      +  AC  G+V++V++L++ G+ L+   E+   P+  A+  G VE+  LLLE+   +     E K   + + C+KGHLE V+ L++   D E  T++    +  AC  GH E+ R+L++S   + +       PL  A C G++++  +LIE   +++  +   + P+  A R GH E+V +L+ +G    A T E +   + +AC  G  ++ + LI +  ++E  C+     PL  A + GH ++VK L+  G N         + +  A +  + ++ + L+ A  +  H
Sbjct:   95 ATGQPDNRSLAEACSDGDVNAVRKLLGEGRSVHETTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGVKGDITPLMAAASGGFVDIVRLLLAHGADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADLELGCST----PLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEH 491          

HSP 4 Score: 155.606 bits (392), Expect = 6.720e-39
Identity = 93/323 (28.79%), Postives = 164/323 (50.77%), Query Frame = 1
Query:  589 IFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNW-KPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKW--RPIHIVCHKGHLEGVKLLMDYKCDIEIATEKER-RPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDA---PSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQ 1536
            +  AC  G+ ++V +LI     I+ + +  + P+ +A   GH++VV++L+ N  DIEA +E     P+  AC  G  E+V+LLI  G+  +    +++ P+  A+  G V +I +LL    ++ + T  K    P+ +    GH   VKLL+D   DI    E  R   +  AC+ G +E+V +L++   N+E        PL  A   G  ++  VL+E   D++A   PS  D   + +A   GH +  +++I +G   +   +    P+ +A   G+ D+V LL++S  +++A       PL  A R GH  +V+ L+++
Sbjct:  937 LTLACAGGHEDLVTVLIARGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLVERKANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTA-LTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGADVDAADNRKITPLMAAFRKGHVKVVRYLVKE 1258          

HSP 5 Score: 149.828 bits (377), Expect = 4.931e-37
Identity = 88/315 (27.94%), Postives = 162/315 (51.43%), Query Frame = 1
Query:  412 GHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVE-DKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNW--KPIHCACKYGHVEIVKLLIQNGSTLDACGENNW-QPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERR--PIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRK 1338
            GH  +V +LI    +I  R +K +  +  A    HV++V+LL++N  D+  + ++ K  P+  AC  G  E+VELLI      + ++  ++ P+ +A   G+++++K+L+    +I + T       P+  A   GH   VKLL+  GS ++A  E N    +  A   G  E+++LL+E+K +VE   +    P+      G+ E  ++L++   D+  A     R   +  A   GHY+   ++I    +I+V + +   PL  A   G+LD+V +L+ +  D+DA       P+  A R GH+++V+ L+++
Sbjct:  944 GHEDLVTVLIARGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLVERKANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGADVDAADNRKITPLMAAFRKGHVKVVRYLVKE 1258          

HSP 6 Score: 142.51 bits (358), Expect = 7.848e-35
Identity = 103/394 (26.14%), Postives = 175/394 (44.42%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPS-EFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQ-PIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARP-LHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLI 1332
            LE  ++    P+  A +GG+VEV +  +E+   IN  S EF    +  AC   H+E+V+ L+E   + E  +      + +A   GH+++ +LL+++   +N  A+     +  A    HV++  LLIE   ++   + E   P+  A + G+ E+V LL+     I+ +++   +  + +AC  G L+V   LI+   D+E    G   P+  A + GH+E+VK L+       A G N    +H  +  GD  L                         C  GH +   LL+    D+E  +E  R P+  A   GH   V+ LI    ++  +   N    L  AC  G+L +V +L+ +  D +   K     +  A + GH  +V  LI
Sbjct:  226 LEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADLEL---GCSTPLMEAAQEGHLELVKYLL-------AAGAN----VHATTATGDTALT----------------------YACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGADPNHRLKDGSTMLIEAAKGGHTSVVCYLI 583          

HSP 7 Score: 129.028 bits (323), Expect = 1.271e-30
Identity = 80/298 (26.85%), Postives = 146/298 (48.99%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNW-CPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRL--IHWACLNQHVDIVKLLIENHCDVVVE-DKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEA--VTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLM 1035
            +E +D K   P+  A T G+V VV+  ++   +I A SE     P+  AC     E+V+LLI    N E  +  ++ P+  AA  G++ I+K+L+    +IN+R      +  +  A +N H   VKLL++   D+  + +  +   +  AC  G  E+V LL+     ++ +++    P+  A   G+ +V +VL++   D+ A  V       +  A   GH +  +L+I  G+ +D   +    P+  A+  G ++++ LL+    DV+A    K  P+     KGH++ V+ L+
Sbjct:  959 IEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLVERKANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGADVDAADNRKITPLMAAFRKGHVKVVRYLV 1256          

HSP 8 Score: 128.642 bits (322), Expect = 2.040e-30
Identity = 85/332 (25.60%), Postives = 146/332 (43.98%), Query Frame = 1
Query:  163 EMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRL-IHWACLNQHVDIVKLLIENHCDVVVEDKEKCQ-PIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNI 1152
            E K D+    +  AC  G+VEV +  +E    +N P++    P+  A    H+E+  LLIE   N+E ++   + P+ +AA  GH ++V LL+    +INA+ E+     +  AC    +++   LI+   D+ +     C  P+  A + G++E+V+ L+     +   +      +  AC +GH DV  +L+Q   D+E  +EG   P+  A + GHV  V+ LI  G+ ++    NN   +                                + + C  GHL  V+LL+ +  D     +     +  A   GH  +V  LID   N+
Sbjct:  294 EHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADLEL----GCSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTV--------------------------------LSLACAGGHLSVVELLLAHGADPNHRLKDGSTMLIEAAKGGHTSVVCYLIDYPHNL 589          

HSP 9 Score: 116.701 bits (291), Expect = 8.453e-27
Identity = 78/332 (23.49%), Postives = 163/332 (49.10%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSS-IEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKC--QPIFYACKSGNVEIVELLINNNCKIDVKSQFNW-QPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDAC--GENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTE 1170
            +  AC GG+ ++V   I +  NI    +  + P+  A    H+ +V+LL++N  +IE+ S   +  P+  A   G  ++V+LLI    +   R   ++  +  A    +V+I+K+L+    ++      K    P+  A  +G+   V+LL++    I+ + + N    + +AC  G  +VV +L++ K ++E   +    P+  A   G+ E+ ++L++ G+ ++A     +    +  A+  G  +   L++ +   ++   +    P+ +  + GHL+ V+LL++   D++ A  ++  P+  A   GH ++VR L+    N   SD+E
Sbjct:  937 LTLACAGGHEDLVTVLIARGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLVERKANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGADVDAADNRKITPLMAAFRKGHVKVVRYLV-KEVNQFPSDSE 1267          

HSP 10 Score: 82.4185 bits (202), Expect = 3.014e-16
Identity = 51/157 (32.48%), Postives = 85/157 (54.14%), Query Frame = 1
Query: 1129 LIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTE-GKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGC--NTDVLDKNRYSPVDIA 1590
            L+D +C    S+ + A  L  AC  G+ D+V VLI    +I+   K  + P+ +A  +GH+ +V++L+  G   EA +E  K  P+ +AC  G  ++V LLI+   N E   + D+ PL +A   G+ +I+K+L+  G   N+    K   SP+ +A
Sbjct:  921 LVDIDCIHTESNHDTA--LTLACAGGHEDLVTVLIARGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLA 1075          
BLAST of Protein kinase-like domain vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 79.7221 bits (195), Expect = 1.052e-15
Identity = 54/171 (31.58%), Postives = 88/171 (51.46%), Query Frame = 1
Query: 1816 VKRISMDDVDHEAIVTHINLFKDYIRHKNIVLYYGAIAFDENICILMEYMEGDSLKNKISVEKRLEEDKIIKYTKGILQGLAFIHEKNFVHKYLSPRRIFFDKENNAXXXXXXXXXXXXXXXXXTN----IYKPSAYAAPEVLDMNLFSAGSDIWSAGAIIVYMKTGKKPL 2316
            + R  +D + HE     +NL K+ + H+NIV YYGA     N+ I +EY+ G S+ + ++     EE  I  +T+ IL G+A++H+KN +H+ +    I  D +   KI+     K       K N    +     + +PEV+     +A +DIWS G +++ M TGK P 
Sbjct:  493 IHRKMVDALQHE-----MNLLKE-LHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPF 657          
BLAST of Protein kinase-like domain vs. Ensembl Yeast
Match: MKK1 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p; MKK1 has a paralog, MKK2, that arose from the whole genome duplication [Source:SGD;Acc:S000005757])

HSP 1 Score: 78.1814 bits (191), Expect = 1.860e-15
Identity = 58/179 (32.40%), Postives = 83/179 (46.37%), Query Frame = 1
Query: 1810 FAVKRISMDDVDHE---AIVTHINLFKDYIRHKNIVLYYGAIAFDEN--ICILMEYMEGDSL----KNKISVEKRLEEDKIIKYTKGILQGLAFIHEKNFVHKYLSPRRIFFDKENNAXXXXXXXXXXXXXXXXXTNIYKPSAYAAPEVLDMNLFSAGSDIWSAGAIIVYMKTGKKPLS 2319
            FA+K I+  + D E    I   +  F    + + IV YYG    DEN  I I MEYM G SL    KN +    R+ E  + K  + +L+GL+++HEK  +H+ + P+ I  + EN                   T     S Y APE +    +S  SD+WS G  I+ +  GK P S
Sbjct:  247 FALKVINTLNTDPEYQKQIFRELQ-FNRSFQSEYIVRYYGMFTDDENSSIYIAMEYMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLN-ENGQVKLCDFGVSGEAVNSLATTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKFPCS 423          
BLAST of Protein kinase-like domain vs. Ensembl Yeast
Match: GDE1 (Glycerophosphocholine (GroPCho) phosphodiesterase; hydrolyzes GroPCho to choline and glycerolphosphate, for use as a phosphate source and as a precursor for phosphocholine synthesis; may interact with ribosomes [Source:SGD;Acc:S000006031])

HSP 1 Score: 76.6406 bits (187), Expect = 1.236e-14
Identity = 54/201 (26.87%), Postives = 95/201 (47.26%), Query Frame = 1
Query:  277 FNWCPIHYACENNHIEIVKLLIE--------NRCNIESLSSI----EWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWAC-LNQHVDIVKLLIENHCDVVVEDKEKCQ-PIFYACKSGNVEIVELLINNNCKIDVKSQ-FNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLL 834
            +   P+HY+C+    E+ KL+I+        N   I+ +S+        P+H      H +  ++L+Q+  D N +  K+  L+H A   N +  +  LL     D+  +D E  + P++ AC+    E    L+ N   ++++ + F W  I VA   G  D+VK+LI N  + +   EG W P+  A   GH+ I  ++
Sbjct:  427 YKRTPLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLCVLGAHPKTTEVLLQS-LDPNVKL-KSSSLLHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIADMV 625          

HSP 2 Score: 69.707 bits (169), Expect = 1.423e-12
Identity = 58/218 (26.61%), Postives = 95/218 (43.58%), Query Frame = 1
Query:  784 PIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDS-NCNIEVSDTE-NARPLHYACCNGNLDIVNVLIENSCDIDAPSKL-DWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLL 1428
            P+H +C+YG  E+ KL+I+     +   E    PI   S  GD E +T                  P+H+     H +  ++L+    D  +   K    +H A  + +Y ++ +L+ S   +I   D E +  PL+ AC     +    L+ N  D++   KL  W  I VA   G  +IVK+LI      +   EG W P+  A L G+  I +++
Sbjct:  431 PLHYSCQYGLSEVTKLIIKLMKEWNIWNE---IPIDDVSAFGDAESLT------------------PLHLCVLGAHPKTTEVLLQ-SLDPNVKL-KSSSLLHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIADMV 625          

HSP 3 Score: 54.6842 bits (130), Expect = 6.177e-8
Identity = 44/189 (23.28%), Postives = 86/189 (45.50%), Query Frame = 1
Query: 1072 ERRPIHWACYYGHYEIVRILID--SNCNI----------EVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPI-HVACRSGHLEIVKMLIRKGCKTEAYTEGKW--RPIHIACLIGNYDIVNLLISSRCNIEAC-TIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIA 1590
            +R P+H++C YG  E+ +++I      NI             D E+  PLH      +     VL+++   +D   KL    + H+A    +  ++ +L+        Y + +    P+++AC +  ++    L+ +  ++E    +  W  + +A   G  DIVKLLI    N D+ D+  ++P++ A
Sbjct:  428 KRTPLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLCVLGAHPKTTEVLLQS---LDPNVKLKSSSLLHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHA 613          
BLAST of Protein kinase-like domain vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 75.0998 bits (183), Expect = 3.693e-14
Identity = 72/256 (28.12%), Postives = 117/256 (45.70%), Query Frame = 1
Query: 1753 IGKGTISEIFL-FKTQTDFFFAVKRISMDDVDH---------EAIVTHINLFKDYIRHKNIVLYYGAIAFDENICILMEYMEGDSLKNKISVEKRLEEDKIIKYTKGILQGLAFIHEKNFVHKYLSPRRIFFDKENNAXXXXXXXXXXXXXXXXXTNIYKPSA--YAAPEVLDMNL-FSAGSDIWSAGAIIVYMKTGKKPLSGIG--GTSLKISGFSS-----KDLLLLTKRMVRS--------NPSKRATATELL 2436
            IGKG+   ++L     T    AVK++ +              EA+ + ++  KD + H NIV Y G    +    + +EY+ G S+ + I +  R +E  I   T  +L+GLA++H K  +H+ +    +  D++   KIS     +        +++       + APE++D    +SA  DIWS G I++ M  GK+P S +       KI    S     +D L L  ++ R+        NP KR TA ELL
Sbjct: 1181 IGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKD-LDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKSKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELL 1435          
BLAST of Protein kinase-like domain vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 70.4774 bits (171), Expect = 6.002e-14
Identity = 55/228 (24.12%), Postives = 99/228 (43.42%), Query Frame = 1
Query:  982 PIHIVCHKGHLEGVKLLMDYKCDIEIATEKERR-PIHWACYYGHYEIVRILIDSNCNIEVSDTENAR---PLHYACCNGNLDIVNVLIENSC--DIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTID-----DWRPLHIACRYGHADIVKLLIQQ-GCNTDVLDKNRYSPVDIA-----KKYNYNEI 1614
            P+H  C +     V+ L+  K  + +  +++ R P+HW+  +  +EI   L+    N+ + D  +     P H AC  GNL++V  L +     D++  +      +H+A      E+ + LI  G       +    P+H A  +G+  ++ LL    C +    ++      W PL  A   GH D   LL+++ G   D++D       D+A     KK+  N +
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELL----CGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLNNV 228          

HSP 2 Score: 65.0846 bits (157), Expect = 3.667e-12
Identity = 50/190 (26.32%), Postives = 90/190 (47.37%), Query Frame = 1
Query:  490 IHWACL-NQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKI---DVKSQFNWQPIHVACRHGHLDVVKVLIQN--KCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLE-KKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMD 1038
            +H AC+ N+   + +LL      ++ +D++   P+ ++      EI   L++    +   D      W P H+AC  G+L+VVK L     K D+  +T      +H A      E+ + LI+NG+++    + N  P+H A+ +G ++LI LL    K  V    +  W P+     +GH +   LL++
Sbjct:    6 LHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVE 195          

HSP 3 Score: 63.929 bits (154), Expect = 9.640e-12
Identity = 51/219 (23.29%), Postives = 90/219 (41.10%), Query Frame = 1
Query:  103 EAVKSNKIKDIRRLF--KVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINA---PSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLIN-NNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQ 741
            +A   N+   ++ L   K   L  KD     P+H++ +    E+  F + K+ N+N    P +  W P H AC   ++E+VK          SL     KP                     D+N    +    +H A   +  ++ + LIEN   V ++DK    P+  A   G+++++ELL       ++ + +  W P+  A   GH D   +L++
Sbjct:    8 QACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVK----------SLYDRPLKP---------------------DLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVE 195          

HSP 4 Score: 56.225 bits (134), Expect = 3.183e-9
Identity = 37/142 (26.06%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  133 IRRLFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLC--NINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQ-NNCDINARAEKNWRLIHWACLNQHVDIVKLLIENH 549
            + ++  V   +  DD    P H AC+ GN+EVVK   ++    ++N  +      +H A      E+ + LIEN  ++         P+H+AA  G L++++LL       +N + ++ W  +  A    H D   LL+E +
Sbjct:   56 LSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKY 197          

HSP 5 Score: 54.6842 bits (130), Expect = 1.293e-8
Identity = 42/191 (21.99%), Postives = 86/191 (45.03%), Query Frame = 1
Query:  685 PIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWK-PIHCACKYGHVEIVKLLI---QNGSTLDACGENNWQPIHYASMLGDVELITLLLEK--KCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILID-SNCNIEVSDTENARPLHYACCNGNLDIVNVLIE 1236
            P+H AC       V+ L+ +K  +    + + + P+H +  +   EI   L+   +N +  D   ++ W P H A  +G++E++  L ++  K D+  +T      +H+   K   E  + L++    + I  +  + P+H A   G  +++ +L       +   D +   PL +A   G+ D   +L+E
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVE 195          
BLAST of Protein kinase-like domain vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 114.39 bits (285), Expect = 9.193e-27
Identity = 110/473 (23.26%), Postives = 200/473 (42.28%), Query Frame = 1
Query:  181 NMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLI---ENRCNIESLSSI-------EWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGV-----------KLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENAR--PLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLI 1530
             M P+H AC+ G + V K  +E   ++ +  E    P+H+AC   ++ + KLL    E R    ++S +       E   +H A   GH  + KL ++   ++NA  E   +  H            +++   C  V+    K + + + CKS  ++   LL            + +  + + C          +I+ +  IE   +    P+  A +  HV+ V+ L+Q+G+ + A   N+   +  A+  G +E +   LE +  V       W     VC  G + G            +LL+D    I+   +++  PIH+A  +G    V  L+  +  I ++D + A   PLH A  +G+  +V  L+     IDA +   W P+  A   G +E+  +L+ +    +   + K  P+H+A   G+ ++V LL+S + NI          L IA    H ++   +I
Sbjct:    4 QMTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKT----------IVVARECIFVMIKVSKLKYLSF-CKSEKIKREILL------------YFFDVVIIIC---------YIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPV-------WTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAI-INDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAII 436          

HSP 2 Score: 111.309 bits (277), Expect = 9.078e-26
Identity = 95/413 (23.00%), Postives = 158/413 (38.26%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPI---------------HYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAA----------------------------------FYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVE-------------------------------------LLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEG-NWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILID 1137
            L   D++ M P+H+AC  GN+ V K        + A     W  +               H A E  H ++ KL +E   N+ ++   + K  HK                                    F+  + I+  +I+    I  R +     +  A    HVD V+ L+++  D+  +D      +F A   G +E +E                                     LL++N   ID K+  +  PIH A + G +  V  L++    I    +G +  P+H A  +GH  +VK L+  G  +DA     W P+  A+  G VE+  +LL++   V+   + K  P+H+   +GH+E VKLL+  K +I +     R  +  A    H E+   +ID
Sbjct:   30 LRSLDEEQMTPLHFACMEGNLGVAKLLF-----VAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIID 437          

HSP 3 Score: 108.227 bits (269), Expect = 9.239e-25
Identity = 95/439 (21.64%), Postives = 178/439 (40.55%), Query Frame = 1
Query:  490 IHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPI---------------HVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCA------CKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIV-------------------------------------RILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIE-NSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            +H AC +  + + K L+E   D+   D+E+  P+ +AC  GN+ + +LL      +  + +  W  +               H+A   GH D+ K+ ++   ++ AV E   K  H        C +  +++ KL       L  C     +          V +I  ++  +  +E   + K  P+ I   K H++ V+ L+ +  DI      +R  +  A   G  E +                                     ++L+D+   I+  + E+  P+HYA   G +  V  L++ +   I+        P+H+A   GH  +VK L+ +G   +A     W P+  A   G  ++ N+L+     ++        PLH+A R GH ++VKLL+ +  N  + D    + +DIA + ++ E+   +I
Sbjct:    8 LHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLF-----VAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKL-----KYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAII 436          

HSP 4 Score: 95.1301 bits (235), Expect = 1.736e-20
Identity = 68/263 (25.86%), Postives = 119/263 (45.25%), Query Frame = 1
Query:  289 PIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVD-----------IVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIV-ELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDY 1041
            P+  A E NH++ V+ L+++  +I +    +   V +AA  G ++ ++  +++   +       W +    CLN  V              +LL++N   +  ++ E   PI YA K G V  V  LL  +   I+ +   +  P+H+A  HGH  VVK L+     I+A     W P+ CA   G VE+  +L+   + +D   +    P+H AS  G VE++ LLL +K ++          + I     H E    ++D+
Sbjct:  183 PLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPV-------WTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIIDH 438          

HSP 5 Score: 58.5362 bits (140), Expect = 7.201e-9
Identity = 31/112 (27.68%), Postives = 52/112 (46.43%), Query Frame = 1
Query: 1264 KLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSR------CNIEACTIDDWR----PLHIACRYGHADIVKLLIQQGCNTDVLDKNR 1569
            K    P+HVAC  G + + K L+  G    +  E +  P+H AC+ GN  +  LL  +         +     D  R     LH+A   GH D+ KL +++G N + + +++
Sbjct:    2 KTQMTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESK 113          
BLAST of Protein kinase-like domain vs. Ensembl Nematostella
Match: EDO46099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR35])

HSP 1 Score: 88.1965 bits (217), Expect = 2.033e-20
Identity = 46/147 (31.29%), Postives = 85/147 (57.82%), Query Frame = 1
Query:  589 IFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEG---NWKPIHCACKYGHVEI-VKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVT-EMKWRPIHIVCHKGHL 1014
            + YA + GN + +ELL+ +  K++V  ++ W+PIH A  +GH + V++L++      A T     N  P+H A + GH++  V++L++ G  L+A   + W+ IH AS  G V+++  LL+   D+E+ T E +   +H+   +G +
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDIESKTYERRLTAVHVAARQGQV 147          

HSP 2 Score: 80.1073 bits (196), Expect = 1.453e-17
Identity = 42/127 (33.07%), Postives = 67/127 (52.76%), Query Frame = 1
Query: 1183 LHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWR---PIHIACLIGNYDI-VNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTD 1551
            LHYA   GN   + +L+++   ++ P +  WRPIH A  +GH E V+ML+R G    A T    R   P+H A  +G+ D  V +L+    ++EA   D WR +H+A   G   ++  L+  G + +
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDIE 127          

HSP 3 Score: 76.2554 bits (186), Expect = 3.164e-16
Identity = 45/152 (29.61%), Postives = 76/152 (50.00%), Query Frame = 1
Query:  193 IHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIE--NRCNIESLSSIE-WKPVHKAAFYGHLQI-VKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKE-KCQPIFYACKSGNVEIVEL 633
            +HYA   GN + ++  ++    +N P  + W PIH A  N H E V++L+   +  N ++  +I    P+H AA  GHL   V++L++   D+ A     WRLIH A  N  V ++  L++   D+  +  E +   +  A + G V +  L
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDIESKTYERRLTAVHVAARQGQVTMTTL 152          

HSP 4 Score: 75.0998 bits (183), Expect = 8.470e-16
Identity = 44/152 (28.95%), Postives = 76/152 (50.00%), Query Frame = 1
Query:  886 IHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERR---PIHWACYYGHYEI-VRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPS-KLDWRPIHVACRSGHLEIVKM 1326
            +HYA+  G+ + I LLL+    +       WRPIH     GH E V++L+ Y       T K  R   P+H+A   GH +  VR+L++   ++E    +  R +H A  NG + ++  L++   DI++ + +     +HVA R G + +  +
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDIESKTYERRLTAVHVAARQGQVTMTTL 152          

HSP 5 Score: 73.9442 bits (180), Expect = 1.713e-15
Identity = 45/152 (29.61%), Postives = 76/152 (50.00%), Query Frame = 1
Query: 1084 IHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWR---PIHVACRSGHLEI-VKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTID-DWRPLHIACRYGHADIVKL 1524
            +H+A  YG+ + + +L+ S   + V      RP+H A  NG+ + V +L+      +A +    R   P+H A R GHL+  V+ML+ +G   EA     WR IH+A   G   ++  L+ +  +IE+ T +     +H+A R G   +  L
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDIESKTYERRLTAVHVAARQGQVTMTTL 152          

HSP 6 Score: 72.7886 bits (177), Expect = 5.725e-15
Identity = 48/152 (31.58%), Postives = 77/152 (50.66%), Query Frame = 1
Query:  985 IHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILI--DSNCNIEVSDT-ENARPLHYACCNGNLDI-VNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYT-EGKWRPIHIACLIGNYDIVNL 1425
            +H     G+ + ++LL+     + +      RPIH A   GH E VR+L+   S+ N +   T  N  PLHYA   G+LD  V +L+E   D++A  +  WR IHVA  +G ++++  L+  G   E+ T E +   +H+A   G   +  L
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDIESKTYERRLTAVHVAARQGQVTMTTL 152          

HSP 7 Score: 66.6254 bits (161), Expect = 5.917e-13
Identity = 43/152 (28.29%), Postives = 77/152 (50.66%), Query Frame = 1
Query:  490 IHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQ---FNWQPIHVACRHGHLD-VVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDA-CGENNWQPIHYASMLGDVELITL 930
            +H+A    +   ++LL+++   + V  +   +PI  A  +G+ E V +L+      + K+     N  P+H A R GHLD  V++L++   D+EAV    W+ IH A   G V+++  L+  G  +++   E     +H A+  G V + TL
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDIESKTYERRLTAVHVAARQGQVTMTTL 152          
BLAST of Protein kinase-like domain vs. Ensembl Nematostella
Match: EDO39112 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB40])

HSP 1 Score: 92.4337 bits (228), Expect = 3.123e-19
Identity = 67/259 (25.87%), Postives = 123/259 (47.49%), Query Frame = 1
Query:  580 CQPIFYACKSGNVEIVELLINNNCK--IDVKSQFNWQPIHVA---CRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQ-NGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRK 1338
            C  +  AC   +   VE+++ N  K  I+ K  +   P+H A   C+ G   ++++LI++  ++ AV      P+H A + G ++ + +L+Q N  T++     +   +H A+     E   LLLEK  +V+   + +  P+  V   G    VK+L++Y  D+E   +  + P+  A Y+G  E+ R L+DS  +I    +     L  A  N NLDI N +I +           W+ + +  ++  +  +K LI +
Sbjct:    6 CLHVAAAC--SDFRTVEIILRNGGKSIINSKDSYGKTPLHYAVIRCQGGK--IIQLLIESGANVLAVDFDERLPLHHAAEQGMLDNISILLQANPETINEVDNRSLTALHIAAAAARTEACRLLLEKGAEVDYRDDERLTPLFYVASVGCPLTVKVLLEYDADLEARDKNRKTPLISAAYFGRLEVFRTLLDSGADIAAETSSGWNALDVALDNNNLDITNEIIRHES---------WKTLLLNTKADGVSPLKKLIER 251          

HSP 2 Score: 73.1738 bits (178), Expect = 2.447e-13
Identity = 54/217 (24.88%), Postives = 95/217 (43.78%), Query Frame = 1
Query:  259 INAPSEFNWCPIHYA---CENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCD-INARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYA 897
            IN+   +   P+HYA   C+    +I++LLIE+  N+ ++   E  P+H AA  G L  + +L+Q N + IN    ++   +H A      +  +LL+E   +V   D E+  P+FY    G            C +                      VKVL++   D+EA  +    P+  A  +G +E+ + L+ +G+ + A   + W  +  A
Sbjct:   31 INSKDSYGKTPLHYAVIRCQGG--KIIQLLIESGANVLAVDFDERLPLHHAAEQGMLDNISILLQANPETINEVDNRSLTALHIAAAAARTEACRLLLEKGAEVDYRDDERLTPLFYVASVG------------CPL---------------------TVKVLLEYDADLEARDKNRKTPLISAAYFGRLEVFRTLLDSGADIAAETSSGWNALDVA 212          
BLAST of Protein kinase-like domain vs. Ensembl Nematostella
Match: EDO41242 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z6])

HSP 1 Score: 87.0409 bits (214), Expect = 6.642e-19
Identity = 66/257 (25.68%), Postives = 114/257 (44.36%), Query Frame = 1
Query: 1726 SRSFQIAQSIGKGTISEIFL-FKTQTDFFFAVKRISMDDV-DHEAIVTHINLFKDYIRHKNIVLYYGAIAFDENICILMEYMEGDSLKNKISVEKRLEEDKIIKYTKGILQGLAFIHEKNFVHKYLSPRRIFFDKENNAXXXXXXXXXXXXXXXXXTNIYKPSA-----YAAPEVLDMNLFSAGSDIWSAGAIIVYMKTGKKP----------LSGIGGTSLKISGF---SSKDLLLLTKRMVRSNPSKRATATELL 2436
            S ++ + + IG+G+ +++F   + +T   FA K + + DV D E I   I ++KD +RH+NIV  Y +I   E +C++MEY+ G SL +++  +    E +    T+ +L  L ++H +  VH+ + P  +   +  N                  T++    A     + APE +         DIW+ G I   +  G  P          LS + G     S F    S D   L  +++  +P  R +A E L
Sbjct:    2 SPNYDMLELIGEGSFAKVFRCIERKTGLEFAAKELRLTDVEDKEKIEQEIAVWKD-LRHENIVSLYSSIREGETVCLIMEYVAGGSLFDEVIQQTYYSEKQARLVTRQLLNALEYLHSRRIVHRDIKPDNLLLKRTGNNVTIKLADFGLAQALPNDTDVISCGASGAPMFLAPETVLEEPIGRAVDIWACGVIFYLLLVGYPPFWSNSDEQLLLSILRGQYTMPSPFWDNVSNDARDLVHKLIVVDPEARISAKEAL 257          
BLAST of Protein kinase-like domain vs. Ensembl Nematostella
Match: EDO35743 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKK8])

HSP 1 Score: 80.1073 bits (196), Expect = 6.034e-17
Identity = 59/202 (29.21%), Postives = 90/202 (44.55%), Query Frame = 1
Query: 1894 HKNIVLYYGAIAFDENICILMEYMEGDSLKNKISVEKRLEEDKIIKYTKGILQGLAFIHEKNFVHKYLSPRRIFFDKENNAXXXXXXXXXXXXXXXXXTNIYKP---SAYAAPEVLDMNLFSAGSDIWSAGAIIVYMKTGKKPLSGIGGTSL--------KISGFS-----SKDLLLLTKRMVRSNPSKRATATELLKDAIF 2451
            H+N+V  YGA+  ++ I I MEYM+G S++  +S     +ED +    + IL+ L ++H K  VH  L    +  D +   K++   +  +       T    P    A+ +PEV     F   +DIWSA   +  M TG+ P     G S+        K  G       S+++      M    P  R TA ELLK+ IF
Sbjct:    1 HENVVKLYGAVQTEQKIIIFMEYMDGGSVEMFLSNNGSADEDSVKCVMQVILEALCWLHSKGVVHLDLKGGNVLMDSKGIVKLADFGASVHLDDTTTHTRNIIPRGTEAFMSPEVCRSEPFGRSTDIWSAACTLYQMLTGEPPWMQYSGGSILYQVAIATKPPGIPDSLECSQEIKDFMASMFSFVPEDRPTAAELLKNPIF 202          
BLAST of Protein kinase-like domain vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 264.233 bits (674), Expect = 3.590e-73
Identity = 143/521 (27.45%), Postives = 258/521 (49.52%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLI-----------------------------ENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH--ACCNC 1647
            K   P++ A    ++EVVKF +E   N + P+E  + P+  A +  H  +V LLI                             +N  N + LS   + P+H AA Y ++ + +LL+    ++N   +     +H A    +V +V+LL++    +  + K++  P+  A ++G+V I+E+L+ +   I  K++    PIH+A +  H+D V+ L+Q   +I+ +T  +  P+H A   GH  + K+L+  G+  +A   N + P+H A     +  + LLL+    +EAVTE    P+H+    GHL  VK L+        +  K   P+H A   GH E+ + L+ +   ++    ++  PLH A   G+ ++V +L+++  + D+ +     P+H+A R GH+  +++L+  G +    T+  + P+H+A   G  D+  LL+    N  A   +   PLH+A  + + D+VKLL+ +G +     +N Y+P+ IA K N  E+ + L+   A  NC
Sbjct:  108 KGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNC 628          

HSP 2 Score: 263.848 bits (673), Expect = 4.684e-73
Identity = 141/510 (27.65%), Postives = 252/510 (49.41%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLI-----------------------------QNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
            LE    K    +H A   G  +VV   +    N+NA S   + P++ A + NH+E+VK L+EN  N    +   + P+  A   GH  +V LLI                             QN+ + +  ++  +  +H A   +++ + +LL+    +V    K    P+  A + GNV +V LL++   +ID +++    P+H A R+GH+ ++++L+++   I+A T+    PIH A +  H++ V+ L+Q  + +D    ++  P+H A+  G   +  +LL+K     A     + P+HI C K H+  + LL+ +   +E  TE    P+H A + GH  IV+ L+    +   S+ +   PLH A   G+ ++   L++N+  +DA +K D  P+H A R GH E+VK+L+      ++ T     P+HIA   G+   + +L+ +       T   + PLH+A +YG  D+ +LL+++G N +   KN  +P+ +A  +N
Sbjct:   69 LEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHN 578          

HSP 3 Score: 259.996 bits (663), Expect = 1.099e-71
Identity = 132/480 (27.50%), Postives = 249/480 (51.88%), Query Frame = 1
Query:  190 PIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            P+H A    N+ V +  + +  N+N   +    P+H A    ++ +V+LL++    I++ +  E  P+H AA  GH++I+++L+++   I A+ +     IH A    H+D V+ L++ + ++     +   P+  A   G+  + ++L++   K + ++   + P+H+AC+  H+  + +L+++   +EAVTE    P+H A   GH+ IVK L+Q G++ +A       P+H AS  G  E+   LL+    V+A  +    P+H     GH E VKLL+D+K + + AT     P+H A   GH   +RIL+D+         +   PLH A   G +D+  +L+E   + +A  K    P+HVA    +L++VK+L+ KG    +     + P+HIA      ++ ++L+ +  +    ++    PLH+A + G  D+V +LI +  N ++ +KN  +P+ +  +  +  I + L+
Sbjct:  207 PLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLV 686          

HSP 4 Score: 256.144 bits (653), Expect = 1.966e-70
Identity = 162/648 (25.00%), Postives = 305/648 (47.07%), Query Frame = 1
Query:  181 NMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNC----------IHNILTAFKSD-----EDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIFLFKTQTDFFFAVKRISMD-------DVDHEAIVTHINLF-------KDYIRHKNIVLYYGAIAFDENICILMEYMEGDSLKNKISVEKRLEEDKIIKYT 2037
             + P+H A   GNV +V+  +++   I+A ++    P+H A  N H+ I+++L+E+   I++ +     P+H AA   H+  V+ L+Q N +I+     +   +H A    H  + K+L++              P+  ACK  ++  ++LL+ ++  ++  ++    P+HVA   GHL++VK L+Q      A       P+H A + GH E+ + L+QN + +DA  +++  P+H A+ +G  EL+ LLL+ K + ++ T     P+HI   +GH+  +++L+D        T+K   P+H A  YG  ++  +L++   N   +      PLH A  + NLD+V +L+       + ++  + P+H+A +   +E+  +L++ G      +     P+H+A   G  D+V +LIS + N+     +   PLH+  + GH  I   L++QG +     +  Y+P+ +A  Y   ++   L+    +           +H       +D        G  PN  +TS  +    IA+ +  G IS I + K  T+   +  R+S         DV  + ++  +  F        D++  +NI+ Y  AI      C+  E ++ D     I + K  +ED +I  +
Sbjct:  237 GITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPN-EITSNGTSPLGIAKRL--GYISVIDVLKLVTEESVSTHRMSFPETVDEILDVSEDEVILSLLFFLQEEAELLDFVL-QNILPYSPAIP--RIPCVSPETVQLDQ-HTPIPLPKEYDEDSLIPSS 877          

HSP 5 Score: 254.218 bits (648), Expect = 8.117e-70
Identity = 134/514 (26.07%), Postives = 248/514 (48.25%), Query Frame = 1
Query:  163 EMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWAC---------------------------------LNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            + KD+  + P+H A   G+V +++  +E    I A ++    PIH A + +H++ V+ L++    I+ ++     P+H AA  GH ++ K+L+      NARA   +  +H AC                                    H++IVK L++        + +   P+  A ++G+ E+ + L+ N  ++D +++ +  P+H A R GH ++VK+L+ +K + ++ T     P+H A + GH+  +++L+  G+      +  + P+H AS  G V++  LLLE+  +  A  +    P+H+  H  +L+ VKLL+               P+H A      E+  +L+ +  +      +   PLH A   G  D+V +LI    +++  +K    P+H+  + GH+ I   L+++G    A +   + P+H+AC  GN  +V  L+  + ++ A T   + PLH A + GH DIV LL++ G   + +  N  SP+ IAK+  Y
Sbjct:  266 QTKDE--LTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGY 777          

HSP 6 Score: 235.343 bits (599), Expect = 1.079e-63
Identity = 140/557 (25.13%), Postives = 262/557 (47.04%), Query Frame = 1
Query:  202 ACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLIN-----------------------------NNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIFL 1785
            A   GN++     I+   NIN  ++     +H A +  H+++V  L+ +   +E+ +      +H AA  G  ++V  L+    ++NA++ K +  ++ A    H+++VK L+EN  +  +  ++   P+  A + G+  +V LLIN                             N+   DV S+  + P+H+A  + ++ V ++L+    ++    +    P+H A + G+V +V+LL+  G+ +DA  ++   P+H A+  G V +I +LLE    ++A T+    PIH+     H++ V+ L+ Y  +I+  T     P+H A + GH+ + ++L+D              PLH AC   ++  +++L+++S  ++A ++    P+HVA   GHL IVK L+++G    A       P+H+A   G+ ++   L+ +   ++A   DD  PLH A R GH ++VKLL+    N D      ++P+ IA +  +              IH I     +   +        T LH     +A   GK  ++E+ L
Sbjct:   17 AARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGH--------------IHTIRILLDAGAQQVKMTKKGFTPLH-----VASKYGKVDVAELLL 554          

HSP 7 Score: 190.274 bits (482), Expect = 4.758e-49
Identity = 116/441 (26.30%), Postives = 206/441 (46.71%), Query Frame = 1
Query:  397 KAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLI-----------------------------QNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            +AA  G+L      I+N  +IN   +     +H A    HV +V  L+ +  ++    K+    +  A  +G  ++V  L+N    ++ +S   + P+++A +  HL+VVK L++N  +    TE  + P+  A + GH  +V LLI                             QN    D   +  + P+H A+   ++ +  LLL +  +V    +    P+HI   +G++  V+LL+D    I+  T+ E  P+H A   GH  I+ IL++    I+        P+H A    ++D V  L++ + +ID  +     P+HVA   GH  + K+L+ KG K  A     + P+HIAC   +   ++LL+    ++EA T     PLH+A   GH +IVK L+Q+G + +  +    +P+ +A +  + E+   L+ 
Sbjct:   16 RAARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQ 456          
BLAST of Protein kinase-like domain vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 256.144 bits (653), Expect = 2.108e-70
Identity = 140/522 (26.82%), Postives = 256/522 (49.04%), Query Frame = 1
Query:   70 FIIMNDFQNFIEAVKSNKIKDIRRLF-KVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            F   N       A K      +R L  +   ++ K    + P+H A   G+   V+  +EK   + A ++    P+H A + +H+E VK L++++  ++ ++      +H AA  GH ++ KLL+    + NARA   +  +H AC    V +++LL++    +    +    PI  A   G++ IV LL+ N    DV +      +H+A R G  +VV+ L++N   ++A    +  P+H A + G  EIV+LL+Q+ +  DA   N + P+H ++  G +E  ++LLE        T+  + P+H+V   G L+  KLL+  +   + A +    P+H A +Y + ++  +L+D   +   +      PLH A     +DI  VL++   + +A +K    P+H+A + GH ++  +L+ KG +    T+     +H+A       +  +L+ +  N++  T   + PL +AC YG+A +V  L+Q G + +   KN Y+P+  A +     I N L+ 
Sbjct:  254 FTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQ 775          

HSP 2 Score: 251.906 bits (642), Expect = 4.718e-69
Identity = 124/448 (27.68%), Postives = 223/448 (49.78%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            +  +H A   G+  V K  ++K  N NA +   + P+H AC+ N +++++LL++   +I++++     P+H AAF GHL IV LL+QN    +    +    +H A      ++V+ L+ N   V    +E   P+  A + G  EIV+LL+ +    D  +   + P+H++ R G L+   VL++        T+  + P+H   KYG +++ KLL+Q  +  D+ G+N   P+H A+   + ++  LLL+K        +  + P+HI   K  ++   +L+ Y  +    T++   P+H A   GH ++  +L+     I V        LH A     + +  +L+ N  ++D  +KL + P+ VAC  G+ ++V  L++ G    A T+  + P+H A   GN  I+N+L+       A T++    L IA R G+  +V  L
Sbjct:  359 LTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 806          

HSP 3 Score: 243.432 bits (620), Expect = 2.793e-66
Identity = 142/547 (25.96%), Postives = 251/547 (45.89%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVK-----------------------------LLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDA--------------CGE-------------------NNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            K    +H +   G  EVVK  +++  +INA S+  + P++ A + NH+++V+ L+EN  N  + +   + P+  A   GH Q+V                              LL+QN+ + + +++  +  +H A    +V++  LL+     V    +    P+  A K GN  +V LL++   +ID K++    P+H A R GH   V+VL++    + A T+    P+H A +  HVE VK L+Q+ + +D               CG                    N + P+H A     V+++ LL++    ++AVTE    PIH+    GHL  V LL+      +++  +    +H A   G  E+VR L+ +   ++    E+  PLH A   G  +IV +L+++    DA +   + P+H++ R G LE   +L+  G      T+  + P+H+    G+ D+  LL+  +   ++   +   PLH+A  Y +  +  LL+ +G +     KN Y+P+ IA K N  +I   L+ 
Sbjct:   97 KGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQ 643          

HSP 4 Score: 238.424 bits (607), Expect = 1.296e-64
Identity = 134/528 (25.38%), Postives = 256/528 (48.48%), Query Frame = 1
Query:  169 KDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCK-----------------------------IDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILT 1665
            K D N   +  A   GN++ V  +++   +I+  ++     +H A +  H+++V+ L++    ++S +      +H ++  G  ++VK L++   DINA+++  +  ++ A    H+D+V+ L+EN  +     ++   P+  A + G+ ++V +L+ N+ K                              DV+S+  + P+H+A  +G+++V  +L+     ++        P+H A K G+  +V+LL+  GS +DA   +   P+H A+  G    + +LLEK   + A T+    P+H+     H+E VK L+ +K  ++  T      +H A + GHY + ++L+D   N          PLH AC    + ++ +L++    I A ++    PIHVA   GHL IV +L++ G   +         +H+A   G  ++V  L+ +   ++A   +D  PLHIA R G  +IV+LL+Q   + D    N Y+P+ I+ +    E  + L+ A  +  H++ T
Sbjct:   29 KSDSNTSFLR-AARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGAS--HSLAT 553          

HSP 5 Score: 232.261 bits (591), Expect = 1.515e-62
Identity = 126/503 (25.05%), Postives = 234/503 (46.52%), Query Frame = 1
Query:  163 EMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAF 1671
            +++      P+H A   GNV V    + +   ++  +     P+H A +  +  +V+LL++    I++ +     P+H AA  GH   V++L++    + AR +     +H A    HV+ VK L+++   V     +    +  A   G+  + +LL++     + ++   + P+H+AC+   + V+++L++    I+AVTE    PIH A   GH+ IV LL+QNG++ D         +H A+  G  E++  LL     V+A       P+HI    G  E V+LL+ +    + AT     P+H +   G  E   +L+++  +  ++  +   PLH     G+LD+  +L++     D+  K    P+HVA    + ++  +L+ KG       +  + P+HIA      DI  +L+       A T     PLH+A + GHAD+  LL+ +G   +V  K+  + + +A + +   +   L+    N  H     +
Sbjct:  220 DVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGY 722          

HSP 6 Score: 213.386 bits (542), Expect = 2.080e-56
Identity = 112/484 (23.14%), Postives = 228/484 (47.11%), Query Frame = 1
Query:  163 EMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            + K    +  +H A    + +     ++   N +  S+  + P+H A    ++ +  LL+     ++  +     P+H A+  G+  +V+LL+     I+A+       +H A  + H   V++L+E    ++   K    P+  A +  +VE V+ L+ +   +D  +      +HVA   GH  V K+L+  + +  A     + P+H ACK   V++++LL++ G+++ A  E+   PIH A+ +G + ++ LLL+     +         +H+    G  E V+ L+     ++    +++ P+H A   G  EIV++L+    + + + T    PLH +   G L+  +VL+E        +K  + P+HV  + G L++ K+L+++    ++  +    P+H+A    N  +  LL+    +      + + PLHIA +    DI  +L+Q G  T+ L K   +P+ +A +  + ++
Sbjct:  187 DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADM 670          

HSP 7 Score: 127.872 bits (320), Expect = 1.685e-29
Identity = 68/343 (19.83%), Postives = 154/343 (44.90%), Query Frame = 1
Query:  106 AVKSNKIKDIRRLFK-VQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRIL 1131
            A ++ + + +R L +    ++ +  ++  P+H A   G  E+V+  ++ + + +A +   + P+H +     +E   +L+E   +    +   + P+H  + YG L + KLL+Q     ++  +     +H A    +  +  LL++         K    P+  A K   ++I  +L+    + +  ++    P+H+A + GH D+  +L+     I   T+     +H A +   V + ++L++NG+ LD   +  + P+  A   G+ ++++ LL+    V A T+  + P+H    +G+   + +L+ +       T      +  A   G+  +V  L
Sbjct:  464 AARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 806          
BLAST of Protein kinase-like domain vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 255.373 bits (651), Expect = 3.140e-70
Identity = 140/522 (26.82%), Postives = 256/522 (49.04%), Query Frame = 1
Query:   70 FIIMNDFQNFIEAVKSNKIKDIRRLF-KVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            F   N       A K      +R L  +   ++ K    + P+H A   G+   V+  +EK   + A ++    P+H A + +H+E VK L++++  ++ ++      +H AA  GH ++ KLL+    + NARA   +  +H AC    V +++LL++    +    +    PI  A   G++ IV LL+ N    DV +      +H+A R G  +VV+ L++N   ++A    +  P+H A + G  EIV+LL+Q+ +  DA   N + P+H ++  G +E  ++LLE        T+  + P+H+V   G L+  KLL+  +   + A +    P+H A +Y + ++  +L+D   +   +      PLH A     +DI  VL++   + +A +K    P+H+A + GH ++  +L+ KG +    T+     +H+A       +  +L+ +  N++  T   + PL +AC YG+A +V  L+Q G + +   KN Y+P+  A +     I N L+ 
Sbjct:  269 FTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQ 790          

HSP 2 Score: 251.136 bits (640), Expect = 8.434e-69
Identity = 124/448 (27.68%), Postives = 223/448 (49.78%), Query Frame = 1
Query:  184 MQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLL 1527
            +  +H A   G+  V K  ++K  N NA +   + P+H AC+ N +++++LL++   +I++++     P+H AAF GHL IV LL+QN    +    +    +H A      ++V+ L+ N   V    +E   P+  A + G  EIV+LL+ +    D  +   + P+H++ R G L+   VL++        T+  + P+H   KYG +++ KLL+Q  +  D+ G+N   P+H A+   + ++  LLL+K        +  + P+HI   K  ++   +L+ Y  +    T++   P+H A   GH ++  +L+     I V        LH A     + +  +L+ N  ++D  +KL + P+ VAC  G+ ++V  L++ G    A T+  + P+H A   GN  I+N+L+       A T++    L IA R G+  +V  L
Sbjct:  374 LTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 821          

HSP 3 Score: 242.662 bits (618), Expect = 4.982e-66
Identity = 142/547 (25.96%), Postives = 251/547 (45.89%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVK-----------------------------LLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDA--------------CGE-------------------NNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            K    +H +   G  EVVK  +++  +INA S+  + P++ A + NH+++V+ L+EN  N  + +   + P+  A   GH Q+V                              LL+QN+ + + +++  +  +H A    +V++  LL+     V    +    P+  A K GN  +V LL++   +ID K++    P+H A R GH   V+VL++    + A T+    P+H A +  HVE VK L+Q+ + +D               CG                    N + P+H A     V+++ LL++    ++AVTE    PIH+    GHL  V LL+      +++  +    +H A   G  E+VR L+ +   ++    E+  PLH A   G  +IV +L+++    DA +   + P+H++ R G LE   +L+  G      T+  + P+H+    G+ D+  LL+  +   ++   +   PLH+A  Y +  +  LL+ +G +     KN Y+P+ IA K N  +I   L+ 
Sbjct:  112 KGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQ 658          

HSP 4 Score: 239.195 bits (609), Expect = 7.622e-65
Identity = 135/530 (25.47%), Postives = 257/530 (48.49%), Query Frame = 1
Query:  163 EMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCK-----------------------------IDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILT 1665
            EM  D N   +  A   GN++ V  +++   +I+  ++     +H A +  H+++V+ L++    ++S +      +H ++  G  ++VK L++   DINA+++  +  ++ A    H+D+V+ L+EN  +     ++   P+  A + G+ ++V +L+ N+ K                              DV+S+  + P+H+A  +G+++V  +L+     ++        P+H A K G+  +V+LL+  GS +DA   +   P+H A+  G    + +LLEK   + A T+    P+H+     H+E VK L+ +K  ++  T      +H A + GHY + ++L+D   N          PLH AC    + ++ +L++    I A ++    PIHVA   GHL IV +L++ G   +         +H+A   G  ++V  L+ +   ++A   +D  PLHIA R G  +IV+LL+Q   + D    N Y+P+ I+ +    E  + L+ A  +  H++ T
Sbjct:   42 EMLSDSNTSFLR-AARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGAS--HSLAT 568          

HSP 5 Score: 231.491 bits (589), Expect = 2.718e-62
Identity = 126/499 (25.25%), Postives = 233/499 (46.69%), Query Frame = 1
Query:  163 EMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNI 1659
            +++      P+H A   GNV V    + +   ++  +     P+H A +  +  +V+LL++    I++ +     P+H AA  GH   V++L++    + AR +     +H A    HV+ VK L+++   V     +    +  A   G+  + +LL++     + ++   + P+H+AC+   + V+++L++    I+AVTE    PIH A   GH+ IV LL+QNG++ D         +H A+  G  E++  LL     V+A       P+HI    G  E V+LL+ +    + AT     P+H +   G  E   +L+++  +  ++  +   PLH     G+LD+  +L++     D+  K    P+HVA    + ++  +L+ KG       +  + P+HIA      DI  +L+       A T     PLH+A + GHAD+  LL+ +G   +V  K+  + + +A + +   +   L+    N  H  
Sbjct:  235 DVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQT 733          

HSP 6 Score: 212.616 bits (540), Expect = 3.579e-56
Identity = 112/484 (23.14%), Postives = 228/484 (47.11%), Query Frame = 1
Query:  163 EMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEI 1614
            + K    +  +H A    + +     ++   N +  S+  + P+H A    ++ +  LL+     ++  +     P+H A+  G+  +V+LL+     I+A+       +H A  + H   V++L+E    ++   K    P+  A +  +VE V+ L+ +   +D  +      +HVA   GH  V K+L+  + +  A     + P+H ACK   V++++LL++ G+++ A  E+   PIH A+ +G + ++ LLL+     +         +H+    G  E V+ L+     ++    +++ P+H A   G  EIV++L+    + + + T    PLH +   G L+  +VL+E        +K  + P+HV  + G L++ K+L+++    ++  +    P+H+A    N  +  LL+    +      + + PLHIA +    DI  +L+Q G  T+ L K   +P+ +A +  + ++
Sbjct:  202 DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADM 685          

HSP 7 Score: 127.487 bits (319), Expect = 2.131e-29
Identity = 68/343 (19.83%), Postives = 154/343 (44.90%), Query Frame = 1
Query:  106 AVKSNKIKDIRRLFK-VQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRIL 1131
            A ++ + + +R L +    ++ +  ++  P+H A   G  E+V+  ++ + + +A +   + P+H +     +E   +L+E   +    +   + P+H  + YG L + KLL+Q     ++  +     +H A    +  +  LL++         K    P+  A K   ++I  +L+    + +  ++    P+H+A + GH D+  +L+     I   T+     +H A +   V + ++L++NG+ LD   +  + P+  A   G+ ++++ LL+    V A T+  + P+H    +G+   + +L+ +       T      +  A   G+  +V  L
Sbjct:  479 AARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 821          
BLAST of Protein kinase-like domain vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 254.603 bits (649), Expect = 5.018e-70
Identity = 137/502 (27.29%), Postives = 249/502 (49.60%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINAR-----------AEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIH 1632
            LE    K    +H A   G  +VV   +    N+NA S+  + P++ A + NH+E+VK L+EN  N    +   + P+  A   GH  +V LLI        R           +   +  +H A   +++++ +LL+    +      ++  P+  A ++G+  I+E+L++N   I  K++    PIH+A +  H+D VK L+Q   +I+ +T  +  P+H A   GH  + K+L+  G+  ++   N + P+H A     + ++ LLL+    +EAVTE    P+H+    GHL  VK+L+        +  K   P+H A   GH+E+   L+ +   ++    ++  PLH A   G+ ++V +L+E+  + ++ +     P+H+A R GH++ V++L+    +    T+  + P+H+A   G  D+  LL+    N  A   +   PLH+A  + + D+V LL+ +G +     +N Y+ + IA K N  E+ N L+ 
Sbjct:   66 LETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGAN------DELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQ 561          

HSP 2 Score: 253.447 bits (646), Expect = 1.252e-69
Identity = 143/549 (26.05%), Postives = 256/549 (46.63%), Query Frame = 1
Query:  169 KDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLI----ENRCNIESLSSI----------------------------------EWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGST---------------------------------LDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYN 1602
            +  K   P++ A    ++EVVKF +E   N + P+E  + P+  A +  H  +V LLI    + +  + +L+                                    E  P+H AA  GH +I+++L+ N   I A+ +     IH A    H+D VK L++ + ++     +   P+  A   G+  + ++L++   K + ++   + P+H+AC+  HL V+ +L+++   IEAVTE    P+H A   GH+ IVK+L+Q G++                                 +DA  +++  P+H A+ +G  EL+ LLLE K +  + T     P+HI   +GH++ V+LL+D +      T+K   P+H A  YG  ++  +L++   N   +      PLH A  + NLD+VN+L+       + ++  +  +H+A +   +E+   L++ G    A +     P+H+A   G  DIV+LLIS + N+         PLH+  + GH  I  +L++QG +     +  Y+P+ +A  Y 
Sbjct:  102 QSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYG 650          

HSP 3 Score: 249.595 bits (636), Expect = 2.745e-68
Identity = 140/514 (27.24%), Postives = 250/514 (48.64%), Query Frame = 1
Query:  202 ACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVK-----------SQFNWQPIHV---------------------------ACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            A   GN++     I+   +IN  ++     +H A +  H+++V  L+ N   +E+ +      +H AA  G  Q+V  L+    ++NA+++K +  ++ A    H+++VK L+EN  +  +  ++   P+  A + G+  +V LLI+   K  V+           S   + P+H+                           A R+GH  ++++L+ N   I+A T+    PIH A +  H++ VK L+Q  + +D    ++  P+H A+  G   +  +LL+K     +     + P+HI C K HL  + LL+ +   IE  TE    P+H A + GH  IV+IL+    +   S+ +   PLH A  +G+ ++   L++N+  +DA +K D  P+H A R GH E+VK+L+       + T     P+HIA   G+   V LL+         T   + PLH+A +YG  D+ +LL+++G N +   KN  +P+ +A  +N  ++ N L+
Sbjct:   14 AARSGNLDKALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLV 527          

HSP 4 Score: 224.557 bits (571), Expect = 4.267e-60
Identity = 120/447 (26.85%), Postives = 219/447 (48.99%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRY 1500
            ++ K    + PIH A  G +++ VK  ++    I+  +  +  P+H A    H  + K+L++      S +   + P+H A    HL+++ LL++++  I A  E     +H A    H++IVK+L++        + +   P+  A +SG+ E+ E L+ N   +D K++ +  P+H A R GH ++VK+L+++K +  + T     P+H A + GHV+ V+LL+   +      +  + P+H AS  G V++  LLLE+  +  A  +    P+H+  H  +L+ V LL+        A       +H A      E+   L+    +      +   PLH A   G  DIV++LI    +++  +K    P+H+  + GH+ I  +L+++G    A T   + P+H+AC  GN  +V  L+  + N+ + T    R  +I C Y
Sbjct:  236 IQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKT----RVEYIQCHY 678          

HSP 5 Score: 203.371 bits (516), Expect = 3.336e-53
Identity = 119/441 (26.98%), Postives = 207/441 (46.94%), Query Frame = 1
Query:  397 KAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGST--------------------------------------LDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNY 1605
            +AA  G+L      I+N  DIN   +     +H A    HV +V  L+ N   +    K+    +  A  +G  ++V  L+N    ++ +SQ  + P+++A +  HL+VVK L++N  +    TE  + P+  A + GH  +V LLI  G+                                       L+    +   P+H A+  G   +I +LL+    ++A T+    PIH+     H++ VK L+ Y  +I+  T     P+H A + GH+ + ++L+D              PLH AC   +L ++++L+++S  I+A ++    P+HVA   GHL IVK+L++KG    A       P+H+A   G++++   L+ +   ++A   DD  PLH A R GH ++VKLL++   N +      +SP+ IA +  +
Sbjct:   13 RAARSGNLDKALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGH 453          
BLAST of Protein kinase-like domain vs. Ensembl Medaka
Match: ENSORLT00000040233.1 (pep primary_assembly:ASM223467v1:19:16412534:16434057:1 gene:ENSORLG00000021910.1 transcript:ENSORLT00000040233.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 210.305 bits (534), Expect = 2.191e-59
Identity = 105/411 (25.55%), Postives = 215/411 (52.31%), Query Frame = 1
Query:  202 ACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLIS 1434
            A   GN+E    +++   +IN  ++     +H A +  H+E+V  LI+   N+++ +      +H A+  G  ++VK L+ N  ++NA+++  +  ++ A    H+D+V+LL+EN     +  ++   P+  A + G+ ++V LL+ N    D K +     +H+A R        +L+QN  + +  ++  + P+H A  YG++ +  LL+  G+ +D    N+  P+H AS  G+  ++ LLLE+   ++A T+    P+H     GH + V++L++    I   T+    P+H A    H   V++L+  +  ++    +    LH A   G+  +  V+++   + +A +   + P+H+AC+   ++++++L++ G   +A TE    PIH+A  +G+ +IV+ LI+
Sbjct:   24 AARAGNLEKALDYLQNGVDINICNQNGLNALHLASKEGHVEVVAELIKQGANVDAATKKGNTALHIASLAGQTEVVKELVSNGANVNAQSQNGFTPLYMAAQENHLDVVQLLLENGSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLNRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVHQLIN 430          

HSP 2 Score: 197.208 bits (500), Expect = 9.749e-55
Identity = 105/410 (25.61%), Postives = 206/410 (50.24%), Query Frame = 1
Query:  400 AAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLI 1629
            AA  G+L+     +QN  DIN   +     +H A    HV++V  LI+   +V    K+    +  A  +G  E+V+ L++N   ++ +SQ  + P+++A +  HLDVV++L++N       TE  + P+  A + GH ++V LL++N    D  G+     +H A+   D +   LLL+   + +  ++  + P+HI  H G++    LL++    ++     +  P+H A   G+  +VR+L++    I+    +   PLH A  +G+  +V +L+     I + +K    P+H+A +  HL  V++L+      +  T      +H+A   G+Y +  +++  + N  A  ++ + PLHIAC+     +++LL++ G +   + ++  +P+ +A    +  I + LI
Sbjct:   24 AARAGNLEKALDYLQNGVDINICNQNGLNALHLASKEGHVEVVAELIKQGANVDAATKKGNTALHIASLAGQTEVVKELVSNGANVNAQSQNGFTPLYMAAQENHLDVVQLLLENGSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLNRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVHQLI 429          

HSP 3 Score: 193.741 bits (491), Expect = 1.684e-53
Identity = 104/391 (26.60%), Postives = 196/391 (50.13%), Query Frame = 1
Query:  172 DDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGC 1344
            +   +  +H A   G+VEVV   I++  N++A ++     +H A      E+VK L+ N  N+ + S   + P++ AA   HL +V+LL++N    +   E  +  +  A    H  +V LL+EN      + K +   +  A +  + +   LL+ N+   DV+S+  + P+H+A  +G+++V  +L+     ++     +  P+H A K G+  +V+LL++ GS +DA  ++   P+H A+  G  +++ +LL +   + + T+    P+H+     HL  V+LL+ +   ++  T      +H A + GHY++ ++++D   N          PLH AC    + ++ +L+++   I A ++    PIHVA   GH  IV  LI  G 
Sbjct:   47 NQNGLNALHLASKEGHVEVVAELIKQGANVDAATKKGNTALHIASLAGQTEVVKELVSNGANVNAQSQNGFTPLYMAAQENHLDVVQLLLENGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDT----KGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLNRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVHQLINYGA 433          

HSP 4 Score: 187.578 bits (475), Expect = 2.729e-51
Identity = 109/406 (26.85%), Postives = 204/406 (50.25%), Query Frame = 1
Query:  346 NRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWK--PIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENA-RPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDV 1554
            N CN   L+++     H A+  GH+++V  LI+   +++A  +K    +H A L    ++VK L+ N  +V  + +    P++ A +  ++++V+LL+ N     + ++  + P+ VA + GH  VV +L++N       T+G  +   +H A +    +   LL+QN    D   ++ + P+H A+  G++ + TLLL +   V+        P+H+   +G+   V+LL++    I+  T+    P+H A   GH ++V +L++    I +S T+N   PLH A    +L+ V +L+ +   +D  +      +HVA   GH ++ K+++ K     A     + P+HIAC      ++ LL+    +I+A T     P+H+A   GH +IV  LI  G + + 
Sbjct:   44 NICNQNGLNAL-----HLASKEGHVEVVAELIKQGANVDAATKKGNTALHIASLAGQTEVVKELVSNGANVNAQSQNGFTPLYMAAQENHLDVVQLLLENGSSQSIATEDGFTPLAVALQQGHDQVVSLLLEND------TKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLNRGAPI-LSKTKNGLSPLHMATQGDHLNCVQLLLHHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVHQLINYGASPNT 437          

HSP 5 Score: 159.458 bits (402), Expect = 1.463e-41
Identity = 96/358 (26.82%), Postives = 168/358 (46.93%), Query Frame = 1
Query:  178 KNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNC---------------------------DINARAEK--NWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSD 1164
            K    +H A   G  EVVK  +    N+NA S+  + P++ A + NH+++V+LL+EN  +    +   + P+  A   GH Q+V LL++N+                            D NA  E    +  +H A    ++++  LL+     V  + +    P+  A K GN  +V LL+    KID +++    P+H A R GH  VV++L+     I + T+    P+H A +  H+  V+LL+ +   +D    +    +H A+  G  ++  ++++KK +  A     + P+HI C K  ++ ++LL+ +   I+  TE    PIH A + GH  IV  LI+   +   S+
Sbjct:   82 KGNTALHIASLAGQTEVVKELVSNGANVNAQSQNGFTPLYMAAQENHLDVVQLLLENGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLNRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVHQLINYGASPNTSN 439          

HSP 6 Score: 112.079 bits (279), Expect = 9.547e-26
Identity = 60/232 (25.86%), Postives = 120/232 (51.72%), Query Frame = 1
Query:  163 EMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVED--KEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGST 852
            +++      P+H A   GN+ V    + +   ++  +  +  P+H A +  +  +V+LL+E    I++ +     P+H AA  GH Q+V++L+     I ++ +     +H A    H++ V+LL+  H DV V+D   +    +  A   G+ ++ +++++     + K+   + P+H+AC+   + V+++L+++   I+AVTE    PIH A   GH  IV  LI  G++
Sbjct:  205 DVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLNRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL--HHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVHQLINYGAS 434          
BLAST of Protein kinase-like domain vs. Planmine SMEST
Match: SMESG000016842.1 (SMESG000016842.1)

HSP 1 Score: 1575.84 bits (4079), Expect = 0.000e+0
Identity = 786/793 (99.12%), Postives = 788/793 (99.37%), Query Frame = 1
Query:   79 MNDFQNFIEAVKSNKIKDIRRLFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIFLFKTQTDFFFAVKRISMDDVDHEAIVTHINLFKDYIRHKNIVLYYGAIAFDENICILMEYMEGDSLKNKISVEKRLEEDKIIKYTKGILQGLAFIHEKNFVHKYLSPRRIFFDKENNAXXXXXXXXXXXXXXXXXTNIYKPSAYAAPEVLDMNLFSAGSDIWSAGAIIVYMKTGKKPLSGIGGTSLKISGFSSKDLLLLTKRMVRSNPSKRATATELLKDAIFLL 2457
            MNDFQNFIEAVKSNKIKDIRRLFKVQFLEMKDDKNMQPIHYAC GGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHL+IVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACY GHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTE YTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIFLFKTQTDFFFAVKRISMDDVDHEAIVTHINLFKDYIRHKNIVLYYGAIAFDENICILMEYMEGDSLKNKISVEKRLEEDKIIKYTK ILQGLAFIHEKNFVHKYLSPRRIFFDKENNAKISYSLSKKYYPKKLGKTNIYKPSAY APEVLDMNLFSAGSDIWSAGAIIVYMKTGKKPLSGIGGTSLKISGFSSKDL+LLTKRMVRSNPSKRATATELLKDAIFLL
Sbjct:    1 MNDFQNFIEAVKSNKIKDIRRLFKVQFLEMKDDKNMQPIHYACIGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLEIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYCGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTETYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIFLFKTQTDFFFAVKRISMDDVDHEAIVTHINLFKDYIRHKNIVLYYGAIAFDENICILMEYMEGDSLKNKISVEKRLEEDKIIKYTKSILQGLAFIHEKNFVHKYLSPRRIFFDKENNAKISYSLSKKYYPKKLGKTNIYKPSAYGAPEVLDMNLFSAGSDIWSAGAIIVYMKTGKKPLSGIGGTSLKISGFSSKDLVLLTKRMVRSNPSKRATATELLKDAIFLL 793          
BLAST of Protein kinase-like domain vs. Planmine SMEST
Match: SMESG000017277.1 (SMESG000017277.1)

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 318/793 (40.10%), Postives = 459/793 (57.88%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHA---------CCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIF-LFKTQTDFFFAVKRISMDDVDHEAIVTHINLFKDYIRHKNIVLYYGAIAFDENICILMEYMEGDSLKNKISVEKRLEEDKIIKYTKGILQGLAFIHEKNFVHKYLSPRRIFFDKENNAXXXXXXXXXXXXXXXXXT----NIYKPSAYAAPEVL---DMNLFSAGSDIWSAGAIIVYMKTGKKPLSG--IGGTSLKISGFSSKDL---LLLT-------KRMVRSNPSKRATATELLKDAIF 2451
            +E  D +N +PIH +C  G+ E VK  IE  C+I A    N  PIH AC   H E VKLLIEN+C+IE+L     +P+H A   GH + VKLLI++ CDI A  ++  R IH AC   H + VKLLIE+ CD+   DK+K +PI  AC  G+ E V+LLI N C I+V  ++N +PIH+AC  GH + VK+LI+NKCDIEA+ + N +PIH AC  GH   VKLLI+N   ++A  E   +PIH+A + G  E + LL+E KCD+EA+ +   RPIH+ C++GH E VKLL++ KCDIE   E+ +RPIH AC  GH E V++LI++ C+IE  D  N RP+H AC  G+ + V +LIEN CDI+A  + + RPIH+AC  G  E VK+LI   C  EA  +   RPIH+AC+ G+ + V LLI ++C+IEA    + RP+H+AC YGH+   KLLI+  C  D  D++  SP++ A K+   EI   L  A             +   ++      + G       TSL  +SF     IG+G   +++ L  +   F FA+KR++ + VD + I  +I  F   + H+ IV Y+GAI  ++++C+ MEY    SL  +IS +  +E D +I+Y+K IL+GL F+H    +H+ + P  I  D+ENN K++     +   +  GK+         + + APEVL   D   +   +DIWS GA ++ M +G+ P     +     K+      DL    L+T       K M+  NP KR++A +LL   +F
Sbjct:  161 IEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKWNQRPIHLACIQGHSEAVKLLIENKCDIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKILNEARLERQRQQQLQQQLERQISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGISFVFAIKRMNSEGVDEKYIEGNIYKFLPKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYHESADIWSVGATVINMISGRPPYDNCPLCAVIFKVMTLKKLDLPEPQLMTAQIKSFIKEMLNPNPKKRSSAAQLLNLNLF 953          

HSP 2 Score: 471.47 bits (1212), Expect = 1.359e-151
Identity = 244/520 (46.92%), Postives = 330/520 (63.46%), Query Frame = 1
Query:   85 DFQNFIEAVKSNKIKDIRRLFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            +F+ FI A+KS   +  RR FK +FLE KD    +PIH+AC  G+ E+VK  IE  C+I A  + NW PIH AC   H E VKLLIEN+C+IE+L   + +P+H A   GH + VKLLI++ CDI A  + N R IH +C+  H + VKLLIEN CD+   DK   +PI  +C  G+ E V+LLI +NC I+     N +PIH+AC  GH + VK+LI+NKCDIEA+   N +PIH AC  GH E VKLLI++   ++A  +   +PIH A   G  E + LL+E KCD+EA+ + K RPIH+ C++GH E VKLL++ KCDIE+  E  RRPIH AC  GH E V++LI++ C+IE  D  N RP+H AC  G+   V +LIEN CDI+A  +   RPIH AC  GH E VK+LI   C  EA  +   RPIH+AC  G+ + V LLI ++C+IEA    + RP+H+AC  GH++ VKLLI+  C+ + LD     P+ +A    ++E    LI   C+
Sbjct:    4 EFKLFINAIKSGSAELFRRYFKEEFLERKDSDLRRPIHHACITGHAEIVKLLIEHKCDIEALDKDNWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCD 523          

HSP 3 Score: 438.343 bits (1126), Expect = 4.766e-139
Identity = 228/495 (46.06%), Postives = 311/495 (62.83%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            +E  D +  +PIH AC  G+ E VK  IE  C+I A  ++N  PIH +C   H E VKLLIEN+C+IE+L    W+P+H +   GH + VKLLI++NCDI A   +N R IH AC   H + VKLLIEN CD+   D    +PI  AC  G+ E V+LLI + C I+   +   +PIH+AC  GH + VK+LI++KCDIEA+ +   +PIH AC  GH E VKLLI+N   ++   E N +PIH A   G  E + LL+E KCD+EA+ +   RPIH+ C +GH   VKLL++ KCDIE   E++RRPIH AC  GH E V++LI++ C+IE  D  N RP+H AC  G+ + V +LIEN CDI+A  + + RPIH+AC  GH E VK+LI   C  EA  +   RPIH+AC  G+ + V LLI ++C+IEA    + RP+H+AC YG ++ VKLLI+  C  + LDK    P+ +A    ++E    LI   C+
Sbjct:   95 IEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKWNQRPIHLACIQGHSEAVKLLIENKCD 589          

HSP 4 Score: 71.633 bits (174), Expect = 2.183e-12
Identity = 37/94 (39.36%), Postives = 54/94 (57.45%), Query Frame = 1
Query:  157 FLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLL 438
            ++E  D  N +PIH AC  G+ E VK  IE  C+I A  + N  PIH AC   H +  KLLIE++C I++       P+  A  +G+ +I+K+L
Sbjct:  556 YIEALDKWNQRPIHLACIQGHSEAVKLLIENKCDIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKIL 649          
BLAST of Protein kinase-like domain vs. Planmine SMEST
Match: SMESG000017277.1 (SMESG000017277.1)

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 320/793 (40.35%), Postives = 450/793 (56.75%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHA---------CCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIF-LFKTQTDFFFAVKRISMDDVDHEAIVTHINLFKDYIRHKNIVLYYGAIAFDENICILMEYMEGDSLKNKISVEKRLEEDKIIKYTKGILQGLAFIHEKNFVHKYLSPRRIFFDKENNAXXXXXXXXXXXXXXXXXT----NIYKPSAYAAPEVL---DMNLFSAGSDIWSAGAIIVYMKTGKKPLSG--IGGTSLKISGFSSKDL---LLLT-------KRMVRSNPSKRATATELLKDAIF 2451
            +E  D  N +PIH +C  G+ E VK  IE  C+I A  + NW PIH +C   H E VKLLIE+ C+IE+L     +P+H A + GH + VKLLI+N CDI A    N R IH AC   H + VKLLIE+ CD+   DK+K +PI  AC  G+ E V+LLI + C I+   +   +PIH+AC  GH + VK+LI+NKCDIE + E N +PIH AC  GH E VKLLI+N   ++A  + N +PIH A   G    + LL+E KCD+EA+ E K RPIH  C +GH E VKLL++ KCDIE   +  +RPIH ACY GH E V++LI++ C+IE  D  N RP+H AC  G+ + V +LIEN CDI+A    + RPIH+AC  GH E VK+LI   C  EA  E   RPIH+AC  G  + V LLI ++C IEA    + RP+H+AC YGH+   KLLI+  C  D  D++  SP++ A K+   EI   L  A             +   ++      + G       TSL  +SF     IG+G   +++ L  +   F FA+KR++ + VD + I  +I  F   + H+ IV Y+GAI  ++++C+ MEY    SL  +IS +  +E D +I+Y+K IL+GL F+H    +H+ + P  I  D+ENN K++     +   +  GK+         + + APEVL   D   +   +DIWS GA ++ M +G+ P     +     K+      DL    L+T       K M+  NP KR++A +LL   +F
Sbjct:  128 IEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKILNEARLERQRQQQLQQQLERQISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGISFVFAIKRMNSEGVDEKYIEGNIYKFLPKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYHESADIWSVGATVINMISGRPPYDNCPLCAVIFKVMTLKKLDLPEPQLMTAQIKSFIKEMLNPNPKKRSSAAQLLNLNLF 920          

HSP 2 Score: 471.855 bits (1213), Expect = 3.497e-152
Identity = 244/520 (46.92%), Postives = 330/520 (63.46%), Query Frame = 1
Query:   85 DFQNFIEAVKSNKIKDIRRLFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            +F+ FI A+KS   +  RR FK +FLE KD    +PIH+AC  G+ E+VK  IE  C+I A  + NW PIH AC   H E VKLLIEN+C+IE+L   + +P+H A   GH + VKLLI++ CDI A  + N R IH +C+  H + VKLLIEN CD+   DK   +PI  +C  G+ E V+LLI +NC I+     N +PIH+AC  GH + VK+LI+NKCDIEA+   N +PIH AC  GH E VKLLI++   ++A  +   +PIH A   G  E + LL+E KCD+EA+ + K RPIH+ C++GH E VKLL++ KCDIE+  E  RRPIH AC  GH E V++LI++ C+IE  D  N RP+H AC  G+   V +LIEN CDI+A  +   RPIH AC  GH E VK+LI   C  EA  +   RPIH+AC  G+ + V LLI ++C+IEA    + RP+H+AC  GH++ VKLLI+  C+ + LD     P+ +A    ++E    LI   C+
Sbjct:    4 EFKLFINAIKSGSAELFRRYFKEEFLERKDSDLRRPIHHACITGHAEIVKLLIEHKCDIEALDKDNWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCD 523          
BLAST of Protein kinase-like domain vs. Planmine SMEST
Match: SMESG000017277.1 (SMESG000017277.1)

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 302/732 (41.26%), Postives = 434/732 (59.29%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHA---------CCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIF-LFKTQTDFFFAVKRISMDDVDHEAIVTHINLFKDYIRHKNIVLYYGAIAFDENICILMEYMEGDSLKNKISVEKRLEEDKIIKYTKGILQGLAFIHEKNFVHKYLSPRRIFFDKENNAXXXXXXXXXXXXXXXXXT----NIYKPSAYAAPEVL---DMNLFSAGSDIWSAGAIIVYMKTG 2304
            +E  D +N +PIH +C  G+ E VK  IE  C+I A    N  PIH AC   H E VKLLIEN+C+IE+L     +P+H A   GH + VKLLI++ CDI A  ++  R IH AC   H + VKLLIE+ CD+   DK+K +PI  AC  G+ E V+LLI N C I+V  ++N +PIH+AC  GH + VK+LI+NKCDIEA+ + N +PIH AC  GH   VKLLI+N   ++A  E   +PIH+A + G  E + LL+E KCD+EA+ +   RPIH+ C++GH E VKLL++ KCDIE   E+ +RPIH AC  GH E V++LI++ C+IE  D  N RP+H AC  G+ + V +LIEN CDI+A  + + RPIH+AC  G  E VK+LI   C  EA  +   RPIH+AC+ G+ + V LLI ++C+IEA    + RP+H+AC YGH+   KLLI+  C  D  D++  SP++ A K+   EI   L  A             +   ++      + G       TSL  +SF     IG+G   +++ L  +   F FA+KR++ + VD + I  +I  F   + H+ IV Y+GAI  ++++C+ MEY    SL  +IS +  +E D +I+Y+K IL+GL F+H    +H+ + P  I  D+ENN K++     +   +  GK+         + + APEVL   D   +   +DIWS GA ++ M +G
Sbjct:  161 IEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKWNQRPIHLACIQGHSEAVKLLIENKCDIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKILNEARLERQRQQQLQQQLERQISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGISFVFAIKRMNSEGVDEKYIEGNIYKFLPKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYHESADIWSVGATVINMISG 892          

HSP 2 Score: 469.929 bits (1208), Expect = 7.501e-152
Identity = 244/520 (46.92%), Postives = 330/520 (63.46%), Query Frame = 1
Query:   85 DFQNFIEAVKSNKIKDIRRLFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            +F+ FI A+KS   +  RR FK +FLE KD    +PIH+AC  G+ E+VK  IE  C+I A  + NW PIH AC   H E VKLLIEN+C+IE+L   + +P+H A   GH + VKLLI++ CDI A  + N R IH +C+  H + VKLLIEN CD+   DK   +PI  +C  G+ E V+LLI +NC I+     N +PIH+AC  GH + VK+LI+NKCDIEA+   N +PIH AC  GH E VKLLI++   ++A  +   +PIH A   G  E + LL+E KCD+EA+ + K RPIH+ C++GH E VKLL++ KCDIE+  E  RRPIH AC  GH E V++LI++ C+IE  D  N RP+H AC  G+   V +LIEN CDI+A  +   RPIH AC  GH E VK+LI   C  EA  +   RPIH+AC  G+ + V LLI ++C+IEA    + RP+H+AC  GH++ VKLLI+  C+ + LD     P+ +A    ++E    LI   C+
Sbjct:    4 EFKLFINAIKSGSAELFRRYFKEEFLERKDSDLRRPIHHACITGHAEIVKLLIEHKCDIEALDKDNWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCD 523          

HSP 3 Score: 437.187 bits (1123), Expect = 3.153e-139
Identity = 228/495 (46.06%), Postives = 311/495 (62.83%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            +E  D +  +PIH AC  G+ E VK  IE  C+I A  ++N  PIH +C   H E VKLLIEN+C+IE+L    W+P+H +   GH + VKLLI++NCDI A   +N R IH AC   H + VKLLIEN CD+   D    +PI  AC  G+ E V+LLI + C I+   +   +PIH+AC  GH + VK+LI++KCDIEA+ +   +PIH AC  GH E VKLLI+N   ++   E N +PIH A   G  E + LL+E KCD+EA+ +   RPIH+ C +GH   VKLL++ KCDIE   E++RRPIH AC  GH E V++LI++ C+IE  D  N RP+H AC  G+ + V +LIEN CDI+A  + + RPIH+AC  GH E VK+LI   C  EA  +   RPIH+AC  G+ + V LLI ++C+IEA    + RP+H+AC YG ++ VKLLI+  C  + LDK    P+ +A    ++E    LI   C+
Sbjct:   95 IEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKWNQRPIHLACIQGHSEAVKLLIENKCD 589          

HSP 4 Score: 71.633 bits (174), Expect = 2.010e-12
Identity = 37/94 (39.36%), Postives = 54/94 (57.45%), Query Frame = 1
Query:  157 FLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLL 438
            ++E  D  N +PIH AC  G+ E VK  IE  C+I A  + N  PIH AC   H +  KLLIE++C I++       P+  A  +G+ +I+K+L
Sbjct:  556 YIEALDKWNQRPIHLACIQGHSEAVKLLIENKCDIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKIL 649          
BLAST of Protein kinase-like domain vs. Planmine SMEST
Match: SMESG000017277.1 (SMESG000017277.1)

HSP 1 Score: 542.347 bits (1396), Expect = 4.145e-180
Identity = 304/732 (41.53%), Postives = 425/732 (58.06%), Query Frame = 1
Query:  160 LEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHA---------CCNCIHNILTAFKSDEDEGDAPNFSLTSLHSRSFQIAQSIGKGTISEIF-LFKTQTDFFFAVKRISMDDVDHEAIVTHINLFKDYIRHKNIVLYYGAIAFDENICILMEYMEGDSLKNKISVEKRLEEDKIIKYTKGILQGLAFIHEKNFVHKYLSPRRIFFDKENNAXXXXXXXXXXXXXXXXXT----NIYKPSAYAAPEVL---DMNLFSAGSDIWSAGAIIVYMKTG 2304
            +E  D  N +PIH +C  G+ E VK  IE  C+I A  + NW PIH +C   H E VKLLIE+ C+IE+L     +P+H A + GH + VKLLI+N CDI A    N R IH AC   H + VKLLIE+ CD+   DK+K +PI  AC  G+ E V+LLI + C I+   +   +PIH+AC  GH + VK+LI+NKCDIE + E N +PIH AC  GH E VKLLI+N   ++A  + N +PIH A   G    + LL+E KCD+EA+ E K RPIH  C +GH E VKLL++ KCDIE   +  +RPIH ACY GH E V++LI++ C+IE  D  N RP+H AC  G+ + V +LIEN CDI+A    + RPIH+AC  GH E VK+LI   C  EA  E   RPIH+AC  G  + V LLI ++C IEA    + RP+H+AC YGH+   KLLI+  C  D  D++  SP++ A K+   EI   L  A             +   ++      + G       TSL  +SF     IG+G   +++ L  +   F FA+KR++ + VD + I  +I  F   + H+ IV Y+GAI  ++++C+ MEY    SL  +IS +  +E D +I+Y+K IL+GL F+H    +H+ + P  I  D+ENN K++     +   +  GK+         + + APEVL   D   +   +DIWS GA ++ M +G
Sbjct:  128 IEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKILNEARLERQRQQQLQQQLERQISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGISFVFAIKRMNSEGVDEKYIEGNIYKFLPKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYHESADIWSVGATVINMISG 859          

HSP 2 Score: 471.085 bits (1211), Expect = 1.395e-152
Identity = 244/520 (46.92%), Postives = 330/520 (63.46%), Query Frame = 1
Query:   85 DFQNFIEAVKSNKIKDIRRLFKVQFLEMKDDKNMQPIHYACTGGNVEVVKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSIEWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIVKLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFNWQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVKLLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKWRPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRILIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWRPIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLLISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSPVDIAKKYNYNEIENDLIHACCN 1644
            +F+ FI A+KS   +  RR FK +FLE KD    +PIH+AC  G+ E+VK  IE  C+I A  + NW PIH AC   H E VKLLIEN+C+IE+L   + +P+H A   GH + VKLLI++ CDI A  + N R IH +C+  H + VKLLIEN CD+   DK   +PI  +C  G+ E V+LLI +NC I+     N +PIH+AC  GH + VK+LI+NKCDIEA+   N +PIH AC  GH E VKLLI++   ++A  +   +PIH A   G  E + LL+E KCD+EA+ + K RPIH+ C++GH E VKLL++ KCDIE+  E  RRPIH AC  GH E V++LI++ C+IE  D  N RP+H AC  G+   V +LIEN CDI+A  +   RPIH AC  GH E VK+LI   C  EA  +   RPIH+AC  G+ + V LLI ++C+IEA    + RP+H+AC  GH++ VKLLI+  C+ + LD     P+ +A    ++E    LI   C+
Sbjct:    4 EFKLFINAIKSGSAELFRRYFKEEFLERKDSDLRRPIHHACITGHAEIVKLLIEHKCDIEALDKDNWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCD 523          
The following BLAST results are available for this feature:
BLAST of Protein kinase-like domain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK26.327e-8331.20ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK25.563e-7929.49ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK26.509e-7929.49ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK26.509e-7929.49ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK21.580e-7629.14ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of Protein kinase-like domain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-442.514e-7126.36AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.514e-7126.36AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.854e-7126.36AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.854e-7126.36AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-443.078e-7126.36AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of Protein kinase-like domain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank26.622e-7526.41gene:FBgn0261788 transcript:FBtr0303119[more]
Ank23.182e-7426.49gene:FBgn0261788 transcript:FBtr0334061[more]
Ank22.066e-7028.17gene:FBgn0261788 transcript:FBtr0334062[more]
Ank22.246e-6926.46gene:FBgn0261788 transcript:FBtr0303118[more]
Ank22.300e-6926.46gene:FBgn0261788 transcript:FBtr0303122[more]
back to top
BLAST of Protein kinase-like domain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b4.634e-7628.43ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b4.778e-7628.43ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b2.636e-7528.43ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b7.766e-7428.99ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b8.673e-7428.99ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Protein kinase-like domain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK14.088e-7328.69ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK13.137e-7227.81ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK13.139e-7227.81ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK13.962e-7227.81ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK14.046e-7227.81ankyrin 1 [Source:NCBI gene;Acc:613080][more]
back to top
BLAST of Protein kinase-like domain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank21.394e-7529.69ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank24.129e-7529.69ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank28.702e-7129.31ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank34.433e-7026.97ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank35.103e-7026.97ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of Protein kinase-like domain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P16157|ANK1_HUMAN2.200e-6927.27Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=... [more]
sp|G5E8K5|ANK3_MOUSE9.595e-6926.97Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
sp|Q01484|ANK2_HUMAN2.950e-6829.91Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=... [more]
sp|Q8C8R3|ANK2_MOUSE1.809e-6729.69Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV... [more]
sp|Q02357|ANK1_MOUSE2.967e-6627.48Ankyrin-1 OS=Mus musculus OX=10090 GN=Ank1 PE=1 SV... [more]
back to top
BLAST of Protein kinase-like domain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q16FI94.356e-12435.70AAEL014742-PA (Fragment) OS=Aedes aegypti OX=7159 ... [more]
A0A182GGY82.629e-11236.91ANK_REP_REGION domain-containing protein OS=Aedes ... [more]
Q16FR17.292e-11034.94AAEL014668-PA (Fragment) OS=Aedes aegypti OX=7159 ... [more]
A0A4Q2UZ946.980e-10431.94Ankyrin-3 (Fragment) OS=Fusarium oxysporum f. sp. ... [more]
A0A182H2I61.660e-9735.55Uncharacterized protein OS=Aedes albopictus OX=716... [more]
back to top
BLAST of Protein kinase-like domain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b6.869e-7528.04ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1a1.562e-7128.63ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
ank3b4.649e-7125.88ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank3a7.871e-7127.35ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a1.468e-7027.35ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of Protein kinase-like domain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000093.12.004e-7527.40pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000000095.17.687e-7526.72pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000007446.16.503e-7028.13pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000007449.11.171e-6828.37pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000002048.16.339e-5626.20pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 g... [more]
back to top
BLAST of Protein kinase-like domain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
STE111.052e-1531.58Signal transducing MEK kinase; involved in pheromo... [more]
MKK11.860e-1532.40MAPKK involved in the protein kinase C signaling p... [more]
GDE11.236e-1426.87Glycerophosphocholine (GroPCho) phosphodiesterase;... [more]
BCK13.693e-1428.13MAPKKK acting in the protein kinase C signaling pa... [more]
NAS66.002e-1424.12Evolutionarily conserved 19S regulatory particle a... [more]
back to top
BLAST of Protein kinase-like domain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO387029.193e-2723.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460992.033e-2031.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391123.123e-1925.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412426.642e-1925.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357436.034e-1729.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase-like domain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b3.590e-7327.45ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ENSORLT00000039458.12.108e-7026.82ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000031565.13.140e-7026.82ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ank1a5.018e-7027.29ankyrin-1 [Source:NCBI gene;Acc:101174837][more]
ENSORLT00000040233.12.191e-5925.55pep primary_assembly:ASM223467v1:19:16412534:16434... [more]
back to top
BLAST of Protein kinase-like domain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016842.10.000e+099.12SMESG000016842.1[more]
SMESG000017277.11.359e-15140.10SMESG000017277.1[more]
SMESG000017277.13.497e-15240.35SMESG000017277.1[more]
SMESG000017277.17.501e-15241.26SMESG000017277.1[more]
SMESG000017277.14.145e-18041.53SMESG000017277.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004149 ID=SMED30004149|Name=Protein kinase-like domain|organism=Schmidtea mediterranea sexual|type=transcript|length=2685bp
GAACAGATTTATTTTGATAACTATTATTAACTGACAATTTTCACAAGAAT
ATCCTGTGAAATCGAAATATTTATAATAATGAATGACTTTCAGAATTTTA
TTGAAGCCGTTAAGTCGAATAAAATCAAAGATATCCGGCGACTATTCAAA
GTTCAATTTTTAGAAATGAAAGATGATAAAAATATGCAGCCGATACATTA
TGCCTGTACTGGGGGAAATGTTGAAGTTGTGAAGTTTTTCATTGAAAAAC
TGTGTAATATTAATGCACCAAGTGAATTCAATTGGTGCCCCATTCATTAT
GCCTGTGAAAATAATCATATCGAAATTGTTAAATTATTAATAGAGAATCG
TTGCAACATTGAATCTCTTTCAAGCATTGAATGGAAACCCGTCCATAAAG
CCGCTTTTTATGGCCACCTACAAATTGTCAAACTCTTAATCCAAAATAAC
TGCGACATTAACGCACGTGCAGAAAAAAACTGGCGTTTGATTCATTGGGC
TTGTTTAAATCAACATGTTGATATCGTGAAATTGCTTATCGAAAACCACT
GTGACGTTGTCGTTGAAGATAAGGAAAAGTGTCAGCCGATATTTTATGCT
TGTAAAAGCGGAAATGTTGAAATAGTTGAATTGCTAATAAATAACAATTG
CAAAATTGATGTCAAGAGTCAATTCAACTGGCAGCCAATCCACGTGGCGT
GCCGACATGGCCATTTAGATGTGGTGAAGGTTCTGATACAAAACAAGTGT
GACATTGAAGCTGTCACAGAAGGCAATTGGAAACCAATCCATTGTGCTTG
TAAATATGGTCACGTAGAAATCGTGAAGCTTCTCATTCAAAACGGATCGA
CTTTAGATGCATGCGGCGAAAATAACTGGCAGCCAATACATTATGCTTCT
ATGTTGGGTGATGTTGAGCTCATTACTTTATTACTAGAAAAGAAATGTGA
TGTTGAAGCCGTCACTGAAATGAAGTGGCGGCCCATTCATATTGTTTGCC
ATAAAGGTCACCTTGAAGGGGTAAAGCTGCTAATGGACTACAAATGTGAC
ATTGAAATAGCTACTGAAAAAGAAAGACGTCCCATTCATTGGGCATGTTA
CTATGGGCACTATGAAATAGTAAGAATCCTCATTGATAGCAATTGCAATA
TCGAAGTTTCTGATACTGAAAATGCTCGACCCCTTCATTATGCCTGCTGC
AATGGAAACCTTGATATAGTTAATGTGTTAATAGAAAATTCATGCGACAT
TGACGCACCTTCCAAACTTGATTGGCGACCAATACACGTAGCTTGCCGTT
CGGGGCATCTTGAAATAGTGAAAATGTTAATAAGAAAAGGCTGCAAAACC
GAAGCGTATACTGAAGGAAAGTGGCGACCCATCCACATTGCGTGCCTTAT
TGGCAACTATGACATTGTCAACTTATTAATAAGTAGCCGTTGTAACATTG
AAGCTTGTACTATTGACGACTGGAGGCCATTACACATAGCCTGCCGATAT
GGTCATGCCGACATTGTTAAATTATTAATTCAGCAAGGTTGCAACACTGA
TGTTCTTGATAAGAATCGTTATTCACCAGTTGATATAGCTAAAAAATACA
ATTATAATGAAATTGAGAACGATTTAATTCACGCGTGTTGCAATTGCATA
CATAATATTTTGACGGCTTTTAAAAGCGACGAAGATGAAGGCGATGCTCC
TAATTTTAGTTTAACATCTCTCCACTCCAGATCTTTTCAAATCGCTCAAT
CCATTGGAAAAGGCACAATAAGTGAAATTTTCCTTTTCAAGACTCAAACG
GATTTCTTTTTCGCCGTCAAACGGATTTCGATGGATGATGTAGACCATGA
AGCAATTGTAACACATATAAACCTGTTCAAAGATTACATTCGTCATAAAA
ATATTGTATTATATTATGGAGCGATAGCATTCGATGAAAATATTTGCATT
CTTATGGAGTACATGGAAGGCGATTCGCTTAAAAATAAAATCAGTGTGGA
AAAACGCCTTGAAGAAGATAAAATAATTAAATACACCAAAGGCATTTTAC
AAGGTCTCGCATTTATTCATGAGAAAAATTTTGTCCATAAATATTTGTCA
CCCAGGAGAATATTTTTCGATAAAGAAAATAATGCAAAAATAAGTTATTC
ACTATCAAAGAAATACTACCCAAAAAAATTGGGAAAGACAAATATATACA
AACCTTCCGCATATGCAGCACCGGAAGTCCTAGACATGAATCTATTCTCA
GCAGGATCTGACATATGGTCGGCTGGCGCTATAATTGTGTACATGAAAAC
TGGCAAAAAGCCTCTAAGTGGAATTGGAGGAACTTCACTGAAAATTTCGG
GATTCAGTTCAAAAGATTTGCTGCTACTGACAAAGCGTATGGTACGTAGT
AATCCGTCAAAACGTGCAACAGCTACCGAATTATTAAAAGATGCTATATT
TCTTTTGTAAATGAGACATTTTAACTCTATTTTTATTGAAAACCGGATTT
CACTCAATGTTGAGTATAAACTATTTGGCCATAGATAAAAATTTGTTTTT
AGTCTTTATTCTGATGAATTTATTTTTGTCGCTTAAACATTTCATCCTGA
AAAGTTATTTCGTGTGGCTTTTAAAGAGAAATATATTCGGTGGCGTATTA
TACCGTAGGCAAATACAAAGGGCGCCAAACCTTCG
back to top

protein sequence of SMED30004149-orf-1

>SMED30004149-orf-1 ID=SMED30004149-orf-1|Name=SMED30004149-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=794bp
MNDFQNFIEAVKSNKIKDIRRLFKVQFLEMKDDKNMQPIHYACTGGNVEV
VKFFIEKLCNINAPSEFNWCPIHYACENNHIEIVKLLIENRCNIESLSSI
EWKPVHKAAFYGHLQIVKLLIQNNCDINARAEKNWRLIHWACLNQHVDIV
KLLIENHCDVVVEDKEKCQPIFYACKSGNVEIVELLINNNCKIDVKSQFN
WQPIHVACRHGHLDVVKVLIQNKCDIEAVTEGNWKPIHCACKYGHVEIVK
LLIQNGSTLDACGENNWQPIHYASMLGDVELITLLLEKKCDVEAVTEMKW
RPIHIVCHKGHLEGVKLLMDYKCDIEIATEKERRPIHWACYYGHYEIVRI
LIDSNCNIEVSDTENARPLHYACCNGNLDIVNVLIENSCDIDAPSKLDWR
PIHVACRSGHLEIVKMLIRKGCKTEAYTEGKWRPIHIACLIGNYDIVNLL
ISSRCNIEACTIDDWRPLHIACRYGHADIVKLLIQQGCNTDVLDKNRYSP
VDIAKKYNYNEIENDLIHACCNCIHNILTAFKSDEDEGDAPNFSLTSLHS
RSFQIAQSIGKGTISEIFLFKTQTDFFFAVKRISMDDVDHEAIVTHINLF
KDYIRHKNIVLYYGAIAFDENICILMEYMEGDSLKNKISVEKRLEEDKII
KYTKGILQGLAFIHEKNFVHKYLSPRRIFFDKENNAKISYSLSKKYYPKK
LGKTNIYKPSAYAAPEVLDMNLFSAGSDIWSAGAIIVYMKTGKKPLSGIG
GTSLKISGFSSKDLLLLTKRMVRSNPSKRATATELLKDAIFLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
GO:0005515protein binding
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0003824catalytic activity
GO:0004190aspartic-type endopeptidase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
GO:0006468protein phosphorylation
GO:0006508proteolysis
GO:0009116nucleoside metabolic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 331..360
e-value: 7.2E-4
score: 28.9
coord: 100..129
e-value: 0.0031
score: 26.8
coord: 265..294
e-value: 0.087
score: 21.9
coord: 397..426
e-value: 0.038
score: 23.1
coord: 199..228
e-value: 4.9E-5
score: 32.7
coord: 166..195
e-value: 0.0048
score: 26.1
coord: 133..162
e-value: 0.17
score: 21.0
coord: 430..459
e-value: 0.085
score: 22.0
coord: 232..261
e-value: 9.6E-5
score: 31.8
coord: 463..492
e-value: 2.1E-5
score: 34.0
coord: 298..327
e-value: 0.13
score: 21.4
coord: 364..393
e-value: 2.6E-4
score: 30.3
coord: 67..96
e-value: 0.0028
score: 26.9
coord: 34..63
e-value: 7.5E-4
score: 28.8
IPR002110Ankyrin repeatPFAMPF13606Ank_3coord: 233..259
e-value: 2.1E-4
score: 21.5
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 232..264
score: 10.659
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 265..297
score: 9.965
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 104..132
score: 10.633
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 331..363
score: 10.472
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 199..231
score: 10.366
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 463..495
score: 13.063
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 67..99
score: 9.564
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 166..198
score: 8.923
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 34..66
score: 9.644
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 397..429
score: 10.099
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 364..396
score: 11.568
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 532..792
e-value: 1.6E-45
score: 157.2
NoneNo IPR availablePANTHERPTHR24180FAMILY NOT NAMEDcoord: 102..228
coord: 165..294
coord: 29..161
coord: 401..512
coord: 263..330
coord: 295..421
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 6..159
e-value: 1.1E-39
score: 138.5
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 160..523
e-value: 1.6E-110
score: 371.7
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 8..207
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 138..517
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 364..423
e-value: 3.2E-12
score: 46.9
coord: 39..130
e-value: 1.0E-20
score: 74.1
coord: 270..362
e-value: 2.3E-15
score: 56.9
coord: 138..228
e-value: 3.6E-18
score: 65.9
coord: 435..512
e-value: 2.0E-11
score: 44.3
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 34..517
score: 121.08
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 554..789
e-value: 2.2E-38
score: 132.1
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 553..792
score: 29.757
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 551..791