Carboxypeptidase

Overview
NameCarboxypeptidase
Smed IDSMED30004147
Length (bp)1649
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Carboxypeptidase (SMED30004147) t-SNE clustered cells

Violin plots show distribution of expression levels for Carboxypeptidase (SMED30004147) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Carboxypeptidase (SMED30004147) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Carboxypeptidase (SMED30004147) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004147

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30004147SMESG000074066.1 Contig613GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30004147SMESG000029164.1 Contig613GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30004147SMESG000029164.1 dd_Smed_v4_785_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004147SMESG000029164.1 dd_Smed_v4_785_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30004147SMESG000029164.1 dd_Smed_v6_785_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004147SMESG000029164.1 dd_Smed_v6_785_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Carboxypeptidase vs. Ensembl Human
Match: CTSA (cathepsin A [Source:HGNC Symbol;Acc:HGNC:9251])

HSP 1 Score: 424.861 bits (1091), Expect = 8.806e-144
Identity = 226/475 (47.58%), Postives = 297/475 (62.53%), Query Frame = 1
Query:  136 EDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVK--LAMDGYKNLNVYNIYSDCY--TPSS---AIDQAIWSQL-NIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLN 1533
            +DE+  LPGL  QP+F+ YSGYL GS +K LHYWFVESQK P   P+VLWLNGGPGCSSLDG +TEHGPF V  +G  ++ NPYSWN IANV+YLESP+ VGFSYS D     ND   +  NF ALQ F   FP+YK    ++TGESY G Y+PTL+V LV + P  ++  +G+AVGNGLSS+  NDN   +FAYYHGL+ + LWS + + CC+      KCN   NK+ +C T ++    + G   LN+YN+Y+ C    PS      D  +   L NIF+   +  +   W+       + LR                +K +++ PC+N TA++ YLNNP VR AL+IP+ +  W +C+  VN  Y+ +Y +M  QY KL + Q + I +YNGDVDMAC ++ DEWF +S  QK+   R+PW  K   SG+QI GFVK F     LTI+G+GHMVPTDKP+ A  MF  FLN
Sbjct:   32 QDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAV-LVMQDP--SMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCS----QNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFT---RLPLKRMWHQ------ALLRSG--------------DKVRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLN 476          
BLAST of Carboxypeptidase vs. Ensembl Human
Match: CTSA (cathepsin A [Source:HGNC Symbol;Acc:HGNC:9251])

HSP 1 Score: 424.861 bits (1091), Expect = 8.806e-144
Identity = 226/475 (47.58%), Postives = 297/475 (62.53%), Query Frame = 1
Query:  136 EDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVK--LAMDGYKNLNVYNIYSDCY--TPSS---AIDQAIWSQL-NIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLN 1533
            +DE+  LPGL  QP+F+ YSGYL GS +K LHYWFVESQK P   P+VLWLNGGPGCSSLDG +TEHGPF V  +G  ++ NPYSWN IANV+YLESP+ VGFSYS D     ND   +  NF ALQ F   FP+YK    ++TGESY G Y+PTL+V LV + P  ++  +G+AVGNGLSS+  NDN   +FAYYHGL+ + LWS + + CC+      KCN   NK+ +C T ++    + G   LN+YN+Y+ C    PS      D  +   L NIF+   +  +   W+       + LR                +K +++ PC+N TA++ YLNNP VR AL+IP+ +  W +C+  VN  Y+ +Y +M  QY KL + Q + I +YNGDVDMAC ++ DEWF +S  QK+   R+PW  K   SG+QI GFVK F     LTI+G+GHMVPTDKP+ A  MF  FLN
Sbjct:   32 QDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAV-LVMQDP--SMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCS----QNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFT---RLPLKRMWHQ------ALLRSG--------------DKVRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLN 476          
BLAST of Carboxypeptidase vs. Ensembl Human
Match: CTSA (cathepsin A [Source:HGNC Symbol;Acc:HGNC:9251])

HSP 1 Score: 424.861 bits (1091), Expect = 8.806e-144
Identity = 226/475 (47.58%), Postives = 297/475 (62.53%), Query Frame = 1
Query:  136 EDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVK--LAMDGYKNLNVYNIYSDCY--TPSS---AIDQAIWSQL-NIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLN 1533
            +DE+  LPGL  QP+F+ YSGYL GS +K LHYWFVESQK P   P+VLWLNGGPGCSSLDG +TEHGPF V  +G  ++ NPYSWN IANV+YLESP+ VGFSYS D     ND   +  NF ALQ F   FP+YK    ++TGESY G Y+PTL+V LV + P  ++  +G+AVGNGLSS+  NDN   +FAYYHGL+ + LWS + + CC+      KCN   NK+ +C T ++    + G   LN+YN+Y+ C    PS      D  +   L NIF+   +  +   W+       + LR                +K +++ PC+N TA++ YLNNP VR AL+IP+ +  W +C+  VN  Y+ +Y +M  QY KL + Q + I +YNGDVDMAC ++ DEWF +S  QK+   R+PW  K   SG+QI GFVK F     LTI+G+GHMVPTDKP+ A  MF  FLN
Sbjct:   32 QDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAV-LVMQDP--SMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCS----QNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFT---RLPLKRMWHQ------ALLRSG--------------DKVRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLN 476          
BLAST of Carboxypeptidase vs. Ensembl Human
Match: CTSA (cathepsin A [Source:HGNC Symbol;Acc:HGNC:9251])

HSP 1 Score: 425.246 bits (1092), Expect = 1.040e-143
Identity = 226/475 (47.58%), Postives = 297/475 (62.53%), Query Frame = 1
Query:  136 EDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVK--LAMDGYKNLNVYNIYSDCY--TPSS---AIDQAIWSQL-NIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLN 1533
            +DE+  LPGL  QP+F+ YSGYL GS +K LHYWFVESQK P   P+VLWLNGGPGCSSLDG +TEHGPF V  +G  ++ NPYSWN IANV+YLESP+ VGFSYS D     ND   +  NF ALQ F   FP+YK    ++TGESY G Y+PTL+V LV + P  ++  +G+AVGNGLSS+  NDN   +FAYYHGL+ + LWS + + CC+      KCN   NK+ +C T ++    + G   LN+YN+Y+ C    PS      D  +   L NIF+   +  +   W+       + LR                +K +++ PC+N TA++ YLNNP VR AL+IP+ +  W +C+  VN  Y+ +Y +M  QY KL + Q + I +YNGDVDMAC ++ DEWF +S  QK+   R+PW  K   SG+QI GFVK F     LTI+G+GHMVPTDKP+ A  MF  FLN
Sbjct:   50 QDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAV-LVMQDP--SMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCS----QNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFT---RLPLKRMWHQ------ALLRSG--------------DKVRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLN 494          
BLAST of Carboxypeptidase vs. Ensembl Human
Match: CTSA (cathepsin A [Source:HGNC Symbol;Acc:HGNC:9251])

HSP 1 Score: 401.364 bits (1030), Expect = 1.222e-134
Identity = 218/474 (45.99%), Postives = 286/474 (60.34%), Query Frame = 1
Query:  136 EDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVK--LAMDGYKNLNVYNIYSDCY--TPSS---AIDQAIWSQL-NIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLN 1533
            +DE+  LPGL  QP+F+ YSGYL GS +K LHYWFVESQK P   P+VLWLNGGPGCSSLDG +TEHGPF                 IANV+YLESP+ VGFSYS D     ND   +  NF ALQ F   FP+YK    ++TGESY G Y+PTL+V LV + P  ++  +G+AVGNGLSS+  NDN   +FAYYHGL+ + LWS + + CC+      KCN   NK+ +C T ++    + G   LN+YN+Y+ C    PS      D  +   L NIF+   +  +   W+       + LR                +K +++ PC+N TA++ YLNNP VR AL+IP+ +  W +C+  VN  Y+ +Y +M  QY KL + Q + I +YNGDVDMAC ++ DEWF +S  QK+   R+PW  K   SG+QI GFVK F     LTI+G+GHMVPTDKP+ A  MF  FLN
Sbjct:   50 QDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPF----------------LIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAV-LVMQDP--SMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCS----QNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFT---RLPLKRMWHQ------ALLRSG--------------DKVRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLN 477          
BLAST of Carboxypeptidase vs. Ensembl Celegans
Match: F41C3.5 (Uncharacterized serine carboxypeptidase F41C3.5 [Source:UniProtKB/Swiss-Prot;Acc:P52717])

HSP 1 Score: 338.576 bits (867), Expect = 9.048e-111
Identity = 187/478 (39.12%), Postives = 267/478 (55.86%), Query Frame = 1
Query:  139 DEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEG-YLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVK--LAMDGYKNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKN------KLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNHNSL 1545
            +E+  LPGL F+PNFKHYSG+   SD   LHYWFVESQ  P+ DPL+ W NGGPGCSSLDG + E GP+    +G  L +N YSWNK+A+V+Y+ESP+ VG+SY+TDG    NDD TSL N+ A++ F  +FPQ++    +I GESYGG YVPTL+ R+V       +  KG+A+GNG  +  LN + +  FAY HGLI + +W+ +   CC    DS  C++T      C T V+       +  LN Y++Y DC  P+ +++      +           L G      H    L+ +    + +F    L NK+      K ++PC NDT    Y+NNPKVR A+HIP  +  W +CS  V   Y+  YT+MT    K+    +  + +Y GD DMAC ++  + F +    +    + PW Y      +QI GF  +FD  + +TIRG+GHM P  +     +  + FLN++ L
Sbjct:   17 EEIKDLPGLDFEPNFKHYSGFFQVSDNHVLHYWFVESQNEPSNDPLIFWFNGGPGCSSLDGLLNEMGPYVANEDGKTLRENEYSWNKMASVVYIESPAGVGYSYATDGNITTNDDLTSLENYEAVKQFFTEFPQFRHHQTFIMGESYGGVYVPTLTARIVDGQKDFPINLKGMALGNGYVNEKLNIDTSVRFAYGHGLIDEKIWNTLERDCCRGCIDS--CDLT-QVTGHCATLVEDIFQFLWFGGLNPYDLYRDC-DPNPSVNSKRMKHM-----------LRGVAPAMAHFDELLKNQTKTSLYQF----LKNKSQSQKPLKADVPCLNDTEMLSYMNNPKVRKAIHIPFNLGKWDICSDKVTTTYQKQYTDMTPFIKKIVK-NHVRVLLYYGDTDMACNFMMGQQFSDQLGLRRTLKKTPWKYD-----RQIAGFKTLFDGLSFITIRGAGHMAPQWRAPQMYYAVQQFLNNHPL 469          
BLAST of Carboxypeptidase vs. Ensembl Celegans
Match: F41C3.5 (Uncharacterized serine carboxypeptidase F41C3.5 [Source:UniProtKB/Swiss-Prot;Acc:P52717])

HSP 1 Score: 338.576 bits (867), Expect = 9.048e-111
Identity = 187/478 (39.12%), Postives = 267/478 (55.86%), Query Frame = 1
Query:  139 DEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEG-YLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVK--LAMDGYKNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKN------KLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNHNSL 1545
            +E+  LPGL F+PNFKHYSG+   SD   LHYWFVESQ  P+ DPL+ W NGGPGCSSLDG + E GP+    +G  L +N YSWNK+A+V+Y+ESP+ VG+SY+TDG    NDD TSL N+ A++ F  +FPQ++    +I GESYGG YVPTL+ R+V       +  KG+A+GNG  +  LN + +  FAY HGLI + +W+ +   CC    DS  C++T      C T V+       +  LN Y++Y DC  P+ +++      +           L G      H    L+ +    + +F    L NK+      K ++PC NDT    Y+NNPKVR A+HIP  +  W +CS  V   Y+  YT+MT    K+    +  + +Y GD DMAC ++  + F +    +    + PW Y      +QI GF  +FD  + +TIRG+GHM P  +     +  + FLN++ L
Sbjct:   17 EEIKDLPGLDFEPNFKHYSGFFQVSDNHVLHYWFVESQNEPSNDPLIFWFNGGPGCSSLDGLLNEMGPYVANEDGKTLRENEYSWNKMASVVYIESPAGVGYSYATDGNITTNDDLTSLENYEAVKQFFTEFPQFRHHQTFIMGESYGGVYVPTLTARIVDGQKDFPINLKGMALGNGYVNEKLNIDTSVRFAYGHGLIDEKIWNTLERDCCRGCIDS--CDLT-QVTGHCATLVEDIFQFLWFGGLNPYDLYRDC-DPNPSVNSKRMKHM-----------LRGVAPAMAHFDELLKNQTKTSLYQF----LKNKSQSQKPLKADVPCLNDTEMLSYMNNPKVRKAIHIPFNLGKWDICSDKVTTTYQKQYTDMTPFIKKIVK-NHVRVLLYYGDTDMACNFMMGQQFSDQLGLRRTLKKTPWKYD-----RQIAGFKTLFDGLSFITIRGAGHMAPQWRAPQMYYAVQQFLNNHPL 469          
BLAST of Carboxypeptidase vs. Ensembl Celegans
Match: F41C3.5 (Uncharacterized serine carboxypeptidase F41C3.5 [Source:UniProtKB/Swiss-Prot;Acc:P52717])

HSP 1 Score: 338.576 bits (867), Expect = 9.048e-111
Identity = 187/478 (39.12%), Postives = 267/478 (55.86%), Query Frame = 1
Query:  139 DEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEG-YLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVK--LAMDGYKNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKN------KLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNHNSL 1545
            +E+  LPGL F+PNFKHYSG+   SD   LHYWFVESQ  P+ DPL+ W NGGPGCSSLDG + E GP+    +G  L +N YSWNK+A+V+Y+ESP+ VG+SY+TDG    NDD TSL N+ A++ F  +FPQ++    +I GESYGG YVPTL+ R+V       +  KG+A+GNG  +  LN + +  FAY HGLI + +W+ +   CC    DS  C++T      C T V+       +  LN Y++Y DC  P+ +++      +           L G      H    L+ +    + +F    L NK+      K ++PC NDT    Y+NNPKVR A+HIP  +  W +CS  V   Y+  YT+MT    K+    +  + +Y GD DMAC ++  + F +    +    + PW Y      +QI GF  +FD  + +TIRG+GHM P  +     +  + FLN++ L
Sbjct:   17 EEIKDLPGLDFEPNFKHYSGFFQVSDNHVLHYWFVESQNEPSNDPLIFWFNGGPGCSSLDGLLNEMGPYVANEDGKTLRENEYSWNKMASVVYIESPAGVGYSYATDGNITTNDDLTSLENYEAVKQFFTEFPQFRHHQTFIMGESYGGVYVPTLTARIVDGQKDFPINLKGMALGNGYVNEKLNIDTSVRFAYGHGLIDEKIWNTLERDCCRGCIDS--CDLT-QVTGHCATLVEDIFQFLWFGGLNPYDLYRDC-DPNPSVNSKRMKHM-----------LRGVAPAMAHFDELLKNQTKTSLYQF----LKNKSQSQKPLKADVPCLNDTEMLSYMNNPKVRKAIHIPFNLGKWDICSDKVTTTYQKQYTDMTPFIKKIVK-NHVRVLLYYGDTDMACNFMMGQQFSDQLGLRRTLKKTPWKYD-----RQIAGFKTLFDGLSFITIRGAGHMAPQWRAPQMYYAVQQFLNNHPL 469          
BLAST of Carboxypeptidase vs. Ensembl Celegans
Match: ctsa-1 (Uncharacterized serine carboxypeptidase ctsa-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09991])

HSP 1 Score: 324.709 bits (831), Expect = 2.564e-105
Identity = 191/476 (40.13%), Postives = 259/476 (54.41%), Query Frame = 1
Query:  139 DEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNK-EEKCKTKVKLAMDGYKNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLE--IP-CSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRK----PWFYKDPHSGQQIGGF-VKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNH 1536
            D+VN LPGL F P+F HYSGYL     K LHYW  ES ++PT+DPLVLWLNGGPGCSSLDG I E GPF V + G  I  N Y+WNK ANV++LESP+ VG+SYST+     +DD  SL N+ AL  FL KFP+YKGRDF+ITGESY G Y+PTL+VR++ +       FKG+A+GNG  ++P N N    F YYH L+ D L+++I   CC    +   C+I     +  C+ KV  A+DG   LN+YN+Y  CY                              Y+P    + L++ +I    +  V     K+     +P C+    +  YLN   VR +LHIP  +  W  CS  V  NY   + N+  ++  +       I +YNGDVD AC  + ++ F  S    ++  ++     W Y    +G  + GF  K       LT+RGSGH VP DKP  +  M  +F+N+
Sbjct:   24 DKVNDLPGLTFTPDFFHYSGYLRAWTDKYLHYWLTESSRAPTQDPLVLWLNGGPGCSSLDGLIEELGPFHVKDFGNSIYYNEYAWNKFANVLFLESPAGVGYSYSTNFNLTVSDDEVSLHNYMALLDFLSKFPEYKGRDFWITGESYAGVYIPTLAVRILNDKKNFP-NFKGVAIGNGALNFPNNYNTMVPFYYYHALVRDDLYNDIARNCC--NNNIGTCDIYSKFFDPNCRDKVINALDGTNELNMYNLYDVCY------------------------------YNP---TTNLKKAFIERQMRIAVGLPARKHNAATTVPLCAQTNNTHVYLNRADVRKSLHIPSSLPAWEECSDQVGKNYVVTHFNVIPEFQTMI-AAGIKILVYNGDVDTACNSIMNQQFLTSLNLTVLGEQEKVNEAWHYSG-QTGTAVAGFQTKFAGNVDFLTVRGSGHFVPEDKPKESQQMIFNFINN 461          
BLAST of Carboxypeptidase vs. Ensembl Celegans
Match: ctsa-1 (Uncharacterized serine carboxypeptidase ctsa-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09991])

HSP 1 Score: 324.709 bits (831), Expect = 2.564e-105
Identity = 191/476 (40.13%), Postives = 259/476 (54.41%), Query Frame = 1
Query:  139 DEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNK-EEKCKTKVKLAMDGYKNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLE--IP-CSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRK----PWFYKDPHSGQQIGGF-VKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNH 1536
            D+VN LPGL F P+F HYSGYL     K LHYW  ES ++PT+DPLVLWLNGGPGCSSLDG I E GPF V + G  I  N Y+WNK ANV++LESP+ VG+SYST+     +DD  SL N+ AL  FL KFP+YKGRDF+ITGESY G Y+PTL+VR++ +       FKG+A+GNG  ++P N N    F YYH L+ D L+++I   CC    +   C+I     +  C+ KV  A+DG   LN+YN+Y  CY                              Y+P    + L++ +I    +  V     K+     +P C+    +  YLN   VR +LHIP  +  W  CS  V  NY   + N+  ++  +       I +YNGDVD AC  + ++ F  S    ++  ++     W Y    +G  + GF  K       LT+RGSGH VP DKP  +  M  +F+N+
Sbjct:   24 DKVNDLPGLTFTPDFFHYSGYLRAWTDKYLHYWLTESSRAPTQDPLVLWLNGGPGCSSLDGLIEELGPFHVKDFGNSIYYNEYAWNKFANVLFLESPAGVGYSYSTNFNLTVSDDEVSLHNYMALLDFLSKFPEYKGRDFWITGESYAGVYIPTLAVRILNDKKNFP-NFKGVAIGNGALNFPNNYNTMVPFYYYHALVRDDLYNDIARNCC--NNNIGTCDIYSKFFDPNCRDKVINALDGTNELNMYNLYDVCY------------------------------YNP---TTNLKKAFIERQMRIAVGLPARKHNAATTVPLCAQTNNTHVYLNRADVRKSLHIPSSLPAWEECSDQVGKNYVVTHFNVIPEFQTMI-AAGIKILVYNGDVDTACNSIMNQQFLTSLNLTVLGEQEKVNEAWHYSG-QTGTAVAGFQTKFAGNVDFLTVRGSGHFVPEDKPKESQQMIFNFINN 461          
BLAST of Carboxypeptidase vs. Ensembl Fly
Match: CG4572 (gene:FBgn0038738 transcript:FBtr0302327)

HSP 1 Score: 109.383 bits (272), Expect = 3.564e-25
Identity = 67/190 (35.26%), Postives = 99/190 (52.11%), Query Frame = 1
Query:  190 YSGYLNGSDTKK--LHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNF-RALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLA----VKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISD 738
            YSGYL      K  + +W+  +++ P   P+VLWL GGPG SSL G  TE+GP ++   G L    Y+W+K  N+IY+++P   GFS++ +    A ++     N   A+      F       F++TGESY G YVP L+  +      +     V  KG+A+GNGLS  PL+      + Y  GLI +
Sbjct:   87 YSGYLTVDPGFKSNMFFWYFPAEQEPEYAPVVLWLQGGPGASSLFGLFTENGPLELDGHGKLQKRNYTWSKTHNLIYIDNPVGTGFSFTENDAGYATNEKDVGRNLHEAVMQLYELFEWSNSSGFWVTGESYAGKYVPALAYHIHKVQNAIETRVYVPLKGVAIGNGLSD-PLHQLKYGDYLYQLGLIDE 275          
BLAST of Carboxypeptidase vs. Ensembl Fly
Match: CG4572 (gene:FBgn0038738 transcript:FBtr0083861)

HSP 1 Score: 109.383 bits (272), Expect = 3.564e-25
Identity = 67/190 (35.26%), Postives = 99/190 (52.11%), Query Frame = 1
Query:  190 YSGYLNGSDTKK--LHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNF-RALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLA----VKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISD 738
            YSGYL      K  + +W+  +++ P   P+VLWL GGPG SSL G  TE+GP ++   G L    Y+W+K  N+IY+++P   GFS++ +    A ++     N   A+      F       F++TGESY G YVP L+  +      +     V  KG+A+GNGLS  PL+      + Y  GLI +
Sbjct:   87 YSGYLTVDPGFKSNMFFWYFPAEQEPEYAPVVLWLQGGPGASSLFGLFTENGPLELDGHGKLQKRNYTWSKTHNLIYIDNPVGTGFSFTENDAGYATNEKDVGRNLHEAVMQLYELFEWSNSSGFWVTGESYAGKYVPALAYHIHKVQNAIETRVYVPLKGVAIGNGLSD-PLHQLKYGDYLYQLGLIDE 275          
BLAST of Carboxypeptidase vs. Ensembl Fly
Match: CG4572 (gene:FBgn0038738 transcript:FBtr0083860)

HSP 1 Score: 109.383 bits (272), Expect = 3.564e-25
Identity = 67/190 (35.26%), Postives = 99/190 (52.11%), Query Frame = 1
Query:  190 YSGYLNGSDTKK--LHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNF-RALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLA----VKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISD 738
            YSGYL      K  + +W+  +++ P   P+VLWL GGPG SSL G  TE+GP ++   G L    Y+W+K  N+IY+++P   GFS++ +    A ++     N   A+      F       F++TGESY G YVP L+  +      +     V  KG+A+GNGLS  PL+      + Y  GLI +
Sbjct:   87 YSGYLTVDPGFKSNMFFWYFPAEQEPEYAPVVLWLQGGPGASSLFGLFTENGPLELDGHGKLQKRNYTWSKTHNLIYIDNPVGTGFSFTENDAGYATNEKDVGRNLHEAVMQLYELFEWSNSSGFWVTGESYAGKYVPALAYHIHKVQNAIETRVYVPLKGVAIGNGLSD-PLHQLKYGDYLYQLGLIDE 275          
BLAST of Carboxypeptidase vs. Ensembl Fly
Match: CG31823 (gene:FBgn0051823 transcript:FBtr0080810)

HSP 1 Score: 74.7146 bits (182), Expect = 5.043e-14
Identity = 55/198 (27.78%), Postives = 91/198 (45.96%), Query Frame = 1
Query:  199 YLNGSDTKKLHYWFVESQKSPT---KDPLVLWLNGGPGCSSL-DGFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNF-RALQHFLIKFPQYKGRDFYITGESYGGFYVP--TLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFH-FAYYHGLISDSLWSEILSLC 768
            Y+       L YW + +  + +   + PLV+WL GGPG +S   G   + GP  +  +        SW K  NV++++SP   GF+Y       A ++    L+  + ++ FL K+P ++    +I  ESYGG   P   L + L  +   L    K + VGN  +S PL+   ++  F    G++ D  +  I  L 
Sbjct:   39 YVEVRKGAHLFYWLLYTTANVSHFIERPLVIWLQGGPGVASTGSGIFEQLGPIDIEGK----TRESSWLKHVNVLFVDSPVGTGFAYVEHHSLYARNNRQIALDLVQLMKQFLTKYPDFRKVPLHIFSESYGGKMAPEFALELHLAKKVGELECDLKSVVVGNPWTS-PLDSILSYAPFLLQSGIVDDDGYRRISRLA 231          
BLAST of Carboxypeptidase vs. Ensembl Fly
Match: CG31821 (gene:FBgn0051821 transcript:FBtr0080809)

HSP 1 Score: 70.4774 bits (171), Expect = 1.395e-12
Identity = 55/171 (32.16%), Postives = 80/171 (46.78%), Query Frame = 1
Query:  196 GYLNGSDTKKLHYWF---VESQKSPTKDPLVLWLNGGPGCSSLD-GFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTT---SLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVT-------EHPGLAVKFKGIAVGN 666
            GY++  D   + YW      +  S T  PLVLWL GGPG SS   G   E GP  V   G   D   +W +  NV+++++P   GFSY+ +      ++      L++F  + HF     ++K    +I  ESYGG   P L++RL          HPG     K + +GN
Sbjct:   32 GYVDVRDGAHMFYWLYYTTANVSSYTDRPLVLWLQGGPGGSSTALGNFQELGP--VDTNGQPRDG--NWVQYVNVLFIDNPVGSGFSYADNTSLLVTNNEELIDDLISF--MLHFYKLHKEFKNVPLHIFSESYGGKMAPALAIRLAKAMSAGELAHPG---TLKSVTIGN 193          
BLAST of Carboxypeptidase vs. Ensembl Zebrafish
Match: ctsa (cathepsin A [Source:ZFIN;Acc:ZDB-GENE-030131-537])

HSP 1 Score: 427.557 bits (1098), Expect = 2.980e-145
Identity = 224/467 (47.97%), Postives = 300/467 (64.24%), Query Frame = 1
Query:  139 DEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVK-LAMDGYKN-LNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFL 1530
            DE+  LPGL  QP+F+HYSGY N +D K LHYWFVESQK P   P+VLWLNGGPGCSS+DG +TEHGPF + ++G  ++ NPY+WNKIANV+YLESP+ VGFSYS D +   ND   ++ N+ AL+ F   FP++   +F++TGESYGG Y+PTL+  +V E    ++  KGIAVGNGLSS+ LNDN   +FAYYHGL+  SLW+++   CC  G     CN   N++  C + V  + +  Y++ LN+YN+Y+ C  P          Q   F N  +F I +  ++  +H+ SK + + +       V+ L    KL+ PC+N T S  YLNNP V+ ALHI     DW +CSS VN NY  ++ ++  QY KL     + + +YNGDVDMAC +L DEWF ES QQ++   R+PW Y +  S QQIGGFVK F     +T++GSGHMVPTDKPI A  MF  F+
Sbjct:   22 DEIKYLPGLSKQPSFRHYSGYFNVADNKHLHYWFVESQKDPVSSPVVLWLNGGPGCSSMDGLLTEHGPFLIQDDGATLEYNPYAWNKIANVLYLESPAGVGFSYSDDKQYTTNDTEVAMNNYLALKAFFQLFPEFSKNEFFLTGESYGGIYIPTLA-EIVMEDS--SINLKGIAVGNGLSSYELNDNSLVYFAYYHGLLGTSLWNDLQKFCCKDG----VCNFYDNQDVNCSSSVNTVQVIVYQSGLNMYNLYAPC--PGGV------GQRFGFEN-GQFVIRDLGHHFINHQWSKAQSEKMR-----GVVSLFKSTKLDPPCTNSTPSTLYLNNPLVKSALHISPNALDWVICSSEVNLNYNRLFMDVKKQYLKLLGALKYRVLVYNGDVDMACNFLGDEWFVESLQQEVQVQRRPWIYFNGES-QQIGGFVKEFTNLAFITVKGSGHMVPTDKPIAAFTMFSRFI 466          
BLAST of Carboxypeptidase vs. Ensembl Zebrafish
Match: si:ch211-122f10.4 (si:ch211-122f10.4 [Source:ZFIN;Acc:ZDB-GENE-140106-45])

HSP 1 Score: 367.466 bits (942), Expect = 6.482e-122
Identity = 207/489 (42.33%), Postives = 274/489 (56.03%), Query Frame = 1
Query:   79 RIL*GFYVLISKIVAFNYQEDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGY-LIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAMDGYKN--LNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNH 1536
            R+   F  L    V+  Y  DEV  LPG+ F+P+++ +SGYL  S  K LHYWFV SQ+ P KDP+VLWLNGGPGCSSLDGF++E+GPF V + G  L +N +SWNKIANV+Y+ESP+ VG+SYS D K   ND+  +  N+ ALQ F  KFP +   +F+I GESYGG Y PTLS+R+ T    L V FKG AVGNG+SS+ LND    +F  YHGL  + LW ++   CC  G     CN   N ++ C   V  A +   N  LNVY +Y DC    +   Q+  +  ++F N+ K    N                        Q++      +   PC N TA  ++LN   VR ALHIP  +  W +CS  V   Y +IY  M   Y KL  +      +YNGD DMAC +L D+WF E   QK  +  +PW Y      +QI GF + F   T LT++G+GHMVP   P P+L M + FL++
Sbjct:    5 RVFCSFVFLSLHAVSGMYDPDEVLDLPGMSFKPSYRQWSGYLKASSGKFLHYWFVTSQRDPVKDPVVLWLNGGPGCSSLDGFLSENGPFHVRDNGATLYENEFSWNKIANVLYIESPAGVGYSYSDDQKYQTNDNEVADNNYLALQSFFAKFPNFTHNEFFIFGESYGGIYAPTLSLRVATGGQ-LKVNFKGFAVGNGISSFALNDQSLIYFGNYHGLFGEQLWKDLNDNCCENG----VCNFYNNSKKSCADVVLHAFNIIYNSGLNVYALYLDC----AGGVQSQRAMTHLFRNFRKHWETN------------------------QIVDSTPSVQGVPPCINSTAQLNWLNRGDVRKALHIPDVLPAWDICSDVVGNQYHTIYETMKDIYVKLLAV-GLRALVYNGDTDMACNFLGDQWFVEQLGQKASTQYQPWIYD-----KQIAGFYQQFGNITFLTVKGAGHMVPQWAPGPSLQMLQRFLSN 454          
BLAST of Carboxypeptidase vs. Ensembl Zebrafish
Match: cpvl (carboxypeptidase vitellogenic like [Source:ZFIN;Acc:ZDB-GENE-031219-2])

HSP 1 Score: 120.168 bits (300), Expect = 1.142e-28
Identity = 74/203 (36.45%), Postives = 105/203 (51.72%), Query Frame = 1
Query:  145 VNILPGLRFQPNFKHYSGYLNGSDT--KKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDA-NDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVK--FKGIAVGNGLSSWPLNDNGNFHFAYYHGLISD 738
            V  LPG     N K YSGYL  + T    L +WF  +Q+ P   P++LWL GGPG +S+ G   EHGP+ V     L    + W    +V+Y+++P   G+S++ D +  A N D      + AL  F   F +++   FY TGESY G YVP +   +   +P   VK  FKG+A+G+GL    L   G   F Y  GL+ +
Sbjct:   67 VGPLPG----ANVKSYSGYLTVNKTYNSNLFFWFFPAQERPETAPVLLWLQGGPGGTSMFGLFVEHGPYFVYKNLTLGYRHFPWTSRYSVLYIDNPVGTGWSFTEDDRGFAQNQDDVGRDLYSALTQFFQIFREFQSNPFYATGESYAGKYVPAIGYYIHRNNPSAKVKINFKGVAIGDGLCDPELMLGGYADFLYQTGLVDE 265          
BLAST of Carboxypeptidase vs. Ensembl Zebrafish
Match: cpvl (carboxypeptidase vitellogenic like [Source:ZFIN;Acc:ZDB-GENE-031219-2])

HSP 1 Score: 120.168 bits (300), Expect = 1.142e-28
Identity = 74/203 (36.45%), Postives = 105/203 (51.72%), Query Frame = 1
Query:  145 VNILPGLRFQPNFKHYSGYLNGSDT--KKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDA-NDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVK--FKGIAVGNGLSSWPLNDNGNFHFAYYHGLISD 738
            V  LPG     N K YSGYL  + T    L +WF  +Q+ P   P++LWL GGPG +S+ G   EHGP+ V     L    + W    +V+Y+++P   G+S++ D +  A N D      + AL  F   F +++   FY TGESY G YVP +   +   +P   VK  FKG+A+G+GL    L   G   F Y  GL+ +
Sbjct:   67 VGPLPG----ANVKSYSGYLTVNKTYNSNLFFWFFPAQERPETAPVLLWLQGGPGGTSMFGLFVEHGPYFVYKNLTLGYRHFPWTSRYSVLYIDNPVGTGWSFTEDDRGFAQNQDDVGRDLYSALTQFFQIFREFQSNPFYATGESYAGKYVPAIGYYIHRNNPSAKVKINFKGVAIGDGLCDPELMLGGYADFLYQTGLVDE 265          
BLAST of Carboxypeptidase vs. Ensembl Zebrafish
Match: ctsa (cathepsin A [Source:ZFIN;Acc:ZDB-GENE-030131-537])

HSP 1 Score: 69.707 bits (169), Expect = 1.354e-14
Identity = 31/53 (58.49%), Postives = 37/53 (69.81%), Query Frame = 1
Query: 1372 RKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFL 1530
            R+PW Y +  S QQIGGFVK F     +T++GSGHMVPTDKPI A  MF  F+
Sbjct:   11 RRPWIYFNGES-QQIGGFVKEFTNLAFITVKGSGHMVPTDKPIAAFTMFSRFI 62          
BLAST of Carboxypeptidase vs. Ensembl Xenopus
Match: cct7 (chaperonin containing TCP1 subunit 7 [Source:Xenbase;Acc:XB-GENE-988120])

HSP 1 Score: 421.394 bits (1082), Expect = 9.840e-143
Identity = 226/485 (46.60%), Postives = 294/485 (60.62%), Query Frame = 1
Query:   94 FYVLISKIVAFNYQEDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAM-DGYKN-LNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKN-KLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNH 1536
            F +L    +   Y  DEV  LPGL  QP+F+ YSG+L+  + K LHYWFVESQK P+ DPLVLWLNGGPGCSSLDG +TEHGPF +  +G  ++ N YSWNKIANV+YLE+P+ VGFSYS D     ND   +  N+ AL+ F   +PQ+   DFYITGESYGG YVP+L+V +  +    ++  KGIAVGNGLSS+  NDN    FAYYHG++   LWS +   CCA G     C    N +  C   V+ AM D Y   LN+YN+Y  C T  +  +  +   L + +++              H +      +++L  K   + LV K  +++ PC N TAS  +LNN  VR ALHIP  VQ W VCS  V   Y  +Y +M  QY KL +   + I +YNGDVDMAC +L D+WF +S QQK+   R+PW YK+    QQIGGFVK F   + LTI+G+GHMVPTDKP  A  +F  F+ +
Sbjct:    8 FMLLGGLFLVACYTADEVTYLPGLPKQPSFRQYSGFLDVPEGKHLHYWFVESQKDPSTDPLVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNDYSWNKIANVLYLEAPAGVGFSYSDDKNYKTNDSEVAHNNYLALKQFFQLYPQFSKNDFYITGESYGGVYVPSLAVEVSQDS---SINLKGIAVGNGLSSYENNDNSLIFFAYYHGILGSQLWSGLQRYCCAKG----PCQFYNNPDGNCSLLVQEAMHDVYSTGLNIYNLYESC-TGGAPGEVRVRDILVVETDF--------------HLLC-----FLSLAQKLLSLSLVQKPIRMDPPCVNSTASRTFLNNGLVRLALHIPSSVQQWEVCSYDVYSAYGRVYQSMKDQYLKLLSTMKYRILVYNGDVDMACNFLGDQWFVDSLQQKLQVQRRPWLYKEGEQQQQIGGFVKEFSNLSFLTIKGAGHMVPTDKPNAAFVVFSRFIKN 465          
BLAST of Carboxypeptidase vs. Ensembl Xenopus
Match: cct7 (chaperonin containing TCP1 subunit 7 [Source:Xenbase;Acc:XB-GENE-988120])

HSP 1 Score: 419.853 bits (1078), Expect = 5.074e-142
Identity = 223/469 (47.55%), Postives = 284/469 (60.55%), Query Frame = 1
Query:  136 EDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAM-DGYKN-LNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKN-KLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFL 1530
            +DEV  LPGL  QP+F+ YSG+L+  + K LHYWFVESQK P+ DPLVLWLNGGPGCSSLDG +TEHGPF +  +G  ++ N YSWNKIANV+YLE+P+ VGFSYS D     ND   +  N+ AL+ F   +PQ+   DFYITGESYGG YVP+L+V +  +    ++  KGIAVGNGLSS+  NDN    FAYYHG++   LWS +   CCA G     C    N +     +V+ AM D Y   LN+YN+Y  C   +      I     I      F +L                 +++L  K   + LV K  +++ PC N TAS  +LNN  VR ALHIP  VQ W VCS  V   Y  +Y +M  QY KL +   + I +YNGDVDMAC +L D+WF +S QQK+   R+PW YK+    QQIGGFVK F   + LTI+G+GHMVPTDKP  A  +F  F+
Sbjct:   23 KDEVTYLPGLPKQPSFRQYSGFLDVPEGKHLHYWFVESQKDPSTDPLVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNDYSWNKIANVLYLEAPAGVGFSYSDDKNYKTNDSEVAHNNYLALKQFFQLYPQFSKNDFYITGESYGGVYVPSLAVEVSQDS---SINLKGIAVGNGLSSYENNDNSLIFFAYYHGILGSQLWSGLQRYCCAKG----PCQFYNNPDGNLVEQVQEAMHDVYSTGLNIYNLYESCTGGAPGERCTINGTHQILVVETDFHLLC----------------FLSLAQKLLSLSLVQKPIRMDPPCVNSTASRTFLNNGLVRLALHIPSSVQQWEVCSYDVYSAYGRVYQSMKDQYLKLLSTMKYRILVYNGDVDMACNFLGDQWFVDSLQQKLQVQRRPWLYKEGEQQQQIGGFVKEFSNLSFLTIKGAGHMVPTDKPNAAFVVFSRFI 468          
BLAST of Carboxypeptidase vs. Ensembl Xenopus
Match: cct7 (chaperonin containing TCP1 subunit 7 [Source:Xenbase;Acc:XB-GENE-988120])

HSP 1 Score: 419.468 bits (1077), Expect = 2.174e-141
Identity = 226/486 (46.50%), Postives = 289/486 (59.47%), Query Frame = 1
Query:   94 FYVLISKIVAFNYQEDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAM-DGYKN-LNVYNIYSDCYTPSSAIDQAIWSQLNIF-SNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKN-KLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNH 1536
            F +L    +   Y  DEV  LPGL  QP+F+ YSG+L+  + K LHYWFVESQK P+ DPLVLWLNGGPGCSSLDG +TEHGPF +  +G  ++ N YSWNKIANV+YLE+P+ VGFSYS D     ND   +  N+ AL+ F   +PQ+   DFYITGESYGG YVP+L+V +  +    ++  KGIAVGNGLSS+  NDN    FAYYHG++   LWS +   CCA G     C    N +  C   V+ AM D Y   LN+YN+Y  C   +    +     + ++       Q+L  WN                   K   + LV K  +++ PC N TAS  +LNN  VR ALHIP  VQ W VCS  V   Y  +Y +M  QY KL +   + I +YNGDVDMAC +L D+WF +S QQK+   R+PW YK+    QQIGGFVK F   + LTI+G+GHMVPTDKP  A  +F  F+ +
Sbjct:   47 FMLLGGLFLVACYTADEVTYLPGLPKQPSFRQYSGFLDVPEGKHLHYWFVESQKDPSTDPLVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNDYSWNKIANVLYLEAPAGVGFSYSDDKNYKTNDSEVAHNNYLALKQFFQLYPQFSKNDFYITGESYGGVYVPSLAVEVSQDS---SINLKGIAVGNGLSSYENNDNSLIFFAYYHGILGSQLWSGLQRYCCAKG----PCQFYNNPDGNCSLLVQEAMHDVYSTGLNIYNLYESCTGGAPGEVRDNGDHVTVYHPGMISPQLLKHWN------------------KKLLSLSLVQKPIRMDPPCVNSTASRTFLNNGLVRLALHIPSSVQQWEVCSYDVYSAYGRVYQSMKDQYLKLLSTMKYRILVYNGDVDMACNFLGDQWFVDSLQQKLQVQRRPWLYKEGEQQQQIGGFVKEFSNLSFLTIKGAGHMVPTDKPNAAFVVFSRFIKN 507          
BLAST of Carboxypeptidase vs. Ensembl Xenopus
Match: cct7 (chaperonin containing TCP1 subunit 7 [Source:Xenbase;Acc:XB-GENE-988120])

HSP 1 Score: 417.542 bits (1072), Expect = 3.855e-141
Identity = 219/483 (45.34%), Postives = 285/483 (59.01%), Query Frame = 1
Query:   94 FYVLISKIVAFNYQEDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAMDGYKNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKN-KLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNH 1536
            F +L    +   Y  DEV  LPGL  QP+F+ YSG+L+  + K LHYWFVESQK P+ DPLVLWLNGGPGCSSLDG +TEHGPF +  +G  ++ N YSWNKIANV+YLE+P+ VGFSYS D     ND   +  N+ AL+ F   +PQ+   DFYITGESYGG YVP+L+V +  +    ++  KGIAVGNGLSS+  NDN    FAYYHG++   LWS +   CCA G     C    N +  C   V++       LN+YN+Y  C   +      + +  ++                           +++L  K   + LV K  +++ PC N TAS  +LNN  VR ALHIP  VQ W VCS  V   Y  +Y +M  QY KL +   + I +YNGDVDMAC +L D+WF +S QQK+   R+PW YK+    QQIGGFVK F   + LTI+G+GHMVPTDKP  A  +F  F+ +
Sbjct:   24 FMLLGGLFLVACYTADEVTYLPGLPKQPSFRQYSGFLDVPEGKHLHYWFVESQKDPSTDPLVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNDYSWNKIANVLYLEAPAGVGFSYSDDKNYKTNDSEVAHNNYLALKQFFQLYPQFSKNDFYITGESYGGVYVPSLAVEVSQDS---SINLKGIAVGNGLSSYENNDNSLIFFAYYHGILGSQLWSGLQRYCCAKG----PCQFYNNPDGNCSLLVRVT-----GLNIYNLYESCTGGAPGEILVVETDFHLLC-------------------------FLSLAQKLLSLSLVQKPIRMDPPCVNSTASRTFLNNGLVRLALHIPSSVQQWEVCSYDVYSAYGRVYQSMKDQYLKLLSTMKYRILVYNGDVDMACNFLGDQWFVDSLQQKLQVQRRPWLYKEGEQQQQIGGFVKEFSNLSFLTIKGAGHMVPTDKPNAAFVVFSRFIKN 469          
BLAST of Carboxypeptidase vs. Ensembl Xenopus
Match: cct7 (chaperonin containing TCP1 subunit 7 [Source:Xenbase;Acc:XB-GENE-988120])

HSP 1 Score: 417.542 bits (1072), Expect = 4.741e-141
Identity = 219/483 (45.34%), Postives = 285/483 (59.01%), Query Frame = 1
Query:   94 FYVLISKIVAFNYQEDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAMDGYKNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKN-KLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNH 1536
            F +L    +   Y  DEV  LPGL  QP+F+ YSG+L+  + K LHYWFVESQK P+ DPLVLWLNGGPGCSSLDG +TEHGPF +  +G  ++ N YSWNKIANV+YLE+P+ VGFSYS D     ND   +  N+ AL+ F   +PQ+   DFYITGESYGG YVP+L+V +  +    ++  KGIAVGNGLSS+  NDN    FAYYHG++   LWS +   CCA G     C    N +  C   V++       LN+YN+Y  C   +      + +  ++                           +++L  K   + LV K  +++ PC N TAS  +LNN  VR ALHIP  VQ W VCS  V   Y  +Y +M  QY KL +   + I +YNGDVDMAC +L D+WF +S QQK+   R+PW YK+    QQIGGFVK F   + LTI+G+GHMVPTDKP  A  +F  F+ +
Sbjct:   26 FMLLGGLFLVACYTADEVTYLPGLPKQPSFRQYSGFLDVPEGKHLHYWFVESQKDPSTDPLVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNDYSWNKIANVLYLEAPAGVGFSYSDDKNYKTNDSEVAHNNYLALKQFFQLYPQFSKNDFYITGESYGGVYVPSLAVEVSQDS---SINLKGIAVGNGLSSYENNDNSLIFFAYYHGILGSQLWSGLQRYCCAKG----PCQFYNNPDGNCSLLVRVT-----GLNIYNLYESCTGGAPGEILVVETDFHLLC-------------------------FLSLAQKLLSLSLVQKPIRMDPPCVNSTASRTFLNNGLVRLALHIPSSVQQWEVCSYDVYSAYGRVYQSMKDQYLKLLSTMKYRILVYNGDVDMACNFLGDQWFVDSLQQKLQVQRRPWLYKEGEQQQQIGGFVKEFSNLSFLTIKGAGHMVPTDKPNAAFVVFSRFIKN 471          
BLAST of Carboxypeptidase vs. Ensembl Mouse
Match: Ctsa (cathepsin A [Source:MGI Symbol;Acc:MGI:97748])

HSP 1 Score: 409.453 bits (1051), Expect = 8.716e-138
Identity = 214/471 (45.44%), Postives = 291/471 (61.78%), Query Frame = 1
Query:  136 EDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLA--MDGYKNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKF--QVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLN 1533
            +DE++ LPGL  QP+F+ YSGYL  SD+K  HYWFVESQ  P   P+VLWLNGGPGCSSLDG +TEHGPF +  +G  ++ NPY+WN IANV+Y+ESP+ VGFSYS D     ND   +  N+ AL+ F   FP+YK    ++TGESY G Y+PTL+V LV + P  ++  +G+AVGNGL+S+  NDN   +FAYYHGL+ + LW+ + + CCA      KCN   NK+ +C   +     + G   LN+YN+Y+ C        +           YE   ++     D  +  ++L      L  +F   +M   +K +L+ PC+N TA ++YLNNP VR ALHIP+ +  W +C+  VN  Y+ +Y +M  QY KL + Q + I +YNGDVDMAC ++ DEWF +S  QK+   R+PW      SG+Q+ GFVK     T LTI+G+GHMVPTDKP  A  MF  FLN
Sbjct:   45 QDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAV-LVMQDP--SMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCA----QNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHR-----------YEDTLVVQ----DFGNIFTRLP-----LKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLN 488          
BLAST of Carboxypeptidase vs. Ensembl Mouse
Match: Ctsa (cathepsin A [Source:MGI Symbol;Acc:MGI:97748])

HSP 1 Score: 408.297 bits (1048), Expect = 1.156e-137
Identity = 214/471 (45.44%), Postives = 291/471 (61.78%), Query Frame = 1
Query:  136 EDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLA--MDGYKNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKF--QVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLN 1533
            +DE++ LPGL  QP+F+ YSGYL  SD+K  HYWFVESQ  P   P+VLWLNGGPGCSSLDG +TEHGPF +  +G  ++ NPY+WN IANV+Y+ESP+ VGFSYS D     ND   +  N+ AL+ F   FP+YK    ++TGESY G Y+PTL+V LV + P  ++  +G+AVGNGL+S+  NDN   +FAYYHGL+ + LW+ + + CCA      KCN   NK+ +C   +     + G   LN+YN+Y+ C        +           YE   ++     D  +  ++L      L  +F   +M   +K +L+ PC+N TA ++YLNNP VR ALHIP+ +  W +C+  VN  Y+ +Y +M  QY KL + Q + I +YNGDVDMAC ++ DEWF +S  QK+   R+PW      SG+Q+ GFVK     T LTI+G+GHMVPTDKP  A  MF  FLN
Sbjct:   27 QDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAV-LVMQDP--SMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCA----QNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHR-----------YEDTLVVQ----DFGNIFTRLP-----LKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLN 470          
BLAST of Carboxypeptidase vs. Ensembl Mouse
Match: Ctsa (cathepsin A [Source:MGI Symbol;Acc:MGI:97748])

HSP 1 Score: 216.468 bits (550), Expect = 1.123e-66
Identity = 104/188 (55.32%), Postives = 135/188 (71.81%), Query Frame = 1
Query:  136 EDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDN 696
            +DE++ LPGL  QP+F+ YSGYL  SD+K  HYWFVESQ  P   P+VLWLNGGPGCSSLDG +TEHGPF +  +G  ++ NPY+WN IANV+Y+ESP+ VGFSYS D     ND   +  N+ AL+ F   FP+YK    ++TGESY G Y+PTL+V LV + P  ++  +G+AVGNGL+S+  NDN
Sbjct:   27 QDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAV-LVMQDP--SMNLQGLAVGNGLASYEQNDN 211          
BLAST of Carboxypeptidase vs. Ensembl Mouse
Match: Ctsa (cathepsin A [Source:MGI Symbol;Acc:MGI:97748])

HSP 1 Score: 187.193 bits (474), Expect = 1.890e-55
Identity = 100/232 (43.10%), Postives = 130/232 (56.03%), Query Frame = 1
Query:  136 EDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKC 828
            +DE++ LPGL  QP+F+ YSGYL  SD+K  HYWFVESQ  P   P+VLWLNGGPGCSSLDG +TEHGPF +  +G  ++ NPY+WN IANV+Y+ESP+ VGFSYS D                                 Y+T ++ G                        +AVGNGL+S+  NDN   +FAYYHGL+ + LW+ + + CCA      KCN   NK+ +C
Sbjct:   39 QDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDD-------------------------------KMYVTNDTEG------------------------LAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCA----QNKCNFYDNKDPEC 211          
BLAST of Carboxypeptidase vs. Ensembl Mouse
Match: Cpvl (carboxypeptidase, vitellogenic-like [Source:MGI Symbol;Acc:MGI:1918537])

HSP 1 Score: 122.865 bits (307), Expect = 1.378e-29
Identity = 70/209 (33.49%), Postives = 111/209 (53.11%), Query Frame = 1
Query:  133 QEDEVNILPGLRFQPNFKHYSGYLNGSDT--KKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYST--DGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHP--GLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDS 741
            ++  V+  PG+    N K Y+GY+  + T    L +WF  ++  P   P+VLWL GGPG SS+ G   EHGP+ +T+   ++   + W    +++Y+++P   GFS++    G   + DD    L + AL  F   FP+Y   DFY+TGESY G YVP L+  + + +P     ++ KGIA+G+  +       G   F Y  GL+ + 
Sbjct:   61 RKSMVSPFPGM----NDKSYAGYITVNQTYNSNLFFWFFPARMQPEDAPVVLWLQGGPGGSSMFGLFVEHGPYIITSNMTVVARDFPWTFTLSMLYIDNPVGTGFSFTDHFQGYATSEDDVAQDL-YSALIQFFTLFPEYAKNDFYVTGESYAGKYVPALAHYIHSLNPVRKFKIRLKGIAIGDAYTDPESIIGGYAAFLYEIGLLDEQ 264          
BLAST of Carboxypeptidase vs. UniProt/SwissProt
Match: sp|Q3MI05|PPGB_BOVIN (Lysosomal protective protein OS=Bos taurus OX=9913 GN=CTSA PE=2 SV=1)

HSP 1 Score: 427.172 bits (1097), Expect = 4.827e-144
Identity = 224/479 (46.76%), Postives = 297/479 (62.00%), Query Frame = 1
Query:  130 YQEDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLA--MDGYKNLNVYNIYSDCY--TPSSAI---DQAIWSQL-NIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNHN 1539
            + +DE+  LPGL  QP+F+ YSGYL GS +K+LHYWFVESQK P   P+VLWLNGGPGCSSLDG +TEHGPF +  +G  ++ NPYSWN IANV+YLESP+ VGFSYS D     ND   +  NF AL+ F   FP+YKG + ++TGESY G Y+PTL+V LV + P  ++  +G+AVGNGLSS+  NDN   +FAYYHGL+ + LWS + + CC+      +CN   NKE +C   ++    +     LN+YN+Y+ C    PS      D  +   L NIF+                 R+   R  +  L+   +      K  L+ PC+N TA+++YLN+P VR ALHIP+ +  W +C+  VN  Y+ +Y +M  QY KL + Q + I +YNGDVDMAC ++ DEWF +S  QK+   R+PW      SG+QI GFVK F     LTI+G+GHMVPTDKP  AL MF  FLN  
Sbjct:   29 HDQDEIRFLPGLAKQPSFRQYSGYLKGSGSKRLHYWFVESQKDPKSSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKSYATNDTEVAQSNFEALKDFFCLFPEYKGNELFLTGESYAGIYIPTLAV-LVMQDP--SMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCS----QNQCNFHDNKEPECVANLQEVSHIVASSGLNIYNLYAPCAGGVPSHVRHEKDTVVVQDLGNIFT-----------------RLPLKRVWHQTLLRSGE------KVHLDPPCTNTTAASNYLNDPHVRKALHIPEQLPRWDLCNFLVNIQYRRLYQSMCSQYLKLLSAQKYRILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPQAALTMFSRFLNRQ 477          
BLAST of Carboxypeptidase vs. UniProt/SwissProt
Match: sp|P10619|PPGB_HUMAN (Lysosomal protective protein OS=Homo sapiens OX=9606 GN=CTSA PE=1 SV=2)

HSP 1 Score: 424.861 bits (1091), Expect = 4.229e-143
Identity = 226/475 (47.58%), Postives = 297/475 (62.53%), Query Frame = 1
Query:  136 EDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVK--LAMDGYKNLNVYNIYSDCY--TPSS---AIDQAIWSQL-NIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLN 1533
            +DE+  LPGL  QP+F+ YSGYL GS +K LHYWFVESQK P   P+VLWLNGGPGCSSLDG +TEHGPF V  +G  ++ NPYSWN IANV+YLESP+ VGFSYS D     ND   +  NF ALQ F   FP+YK    ++TGESY G Y+PTL+V LV + P  ++  +G+AVGNGLSS+  NDN   +FAYYHGL+ + LWS + + CC+      KCN   NK+ +C T ++    + G   LN+YN+Y+ C    PS      D  +   L NIF+   +  +   W+       + LR                +K +++ PC+N TA++ YLNNP VR AL+IP+ +  W +C+  VN  Y+ +Y +M  QY KL + Q + I +YNGDVDMAC ++ DEWF +S  QK+   R+PW  K   SG+QI GFVK F     LTI+G+GHMVPTDKP+ A  MF  FLN
Sbjct:   32 QDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAV-LVMQDP--SMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCS----QNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFT---RLPLKRMWHQ------ALLRSG--------------DKVRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLN 476          
BLAST of Carboxypeptidase vs. UniProt/SwissProt
Match: sp|P16675|PPGB_MOUSE (Lysosomal protective protein OS=Mus musculus OX=10090 GN=Ctsa PE=1 SV=1)

HSP 1 Score: 408.297 bits (1048), Expect = 8.086e-137
Identity = 214/471 (45.44%), Postives = 291/471 (61.78%), Query Frame = 1
Query:  136 EDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLA--MDGYKNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKF--QVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLN 1533
            +DE++ LPGL  QP+F+ YSGYL  SD+K  HYWFVESQ  P   P+VLWLNGGPGCSSLDG +TEHGPF +  +G  ++ NPY+WN IANV+Y+ESP+ VGFSYS D     ND   +  N+ AL+ F   FP+YK    ++TGESY G Y+PTL+V LV + P  ++  +G+AVGNGL+S+  NDN   +FAYYHGL+ + LW+ + + CCA      KCN   NK+ +C   +     + G   LN+YN+Y+ C        +           YE   ++     D  +  ++L      L  +F   +M   +K +L+ PC+N TA ++YLNNP VR ALHIP+ +  W +C+  VN  Y+ +Y +M  QY KL + Q + I +YNGDVDMAC ++ DEWF +S  QK+   R+PW      SG+Q+ GFVK     T LTI+G+GHMVPTDKP  A  MF  FLN
Sbjct:   27 QDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAV-LVMQDP--SMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCA----QNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHR-----------YEDTLVVQ----DFGNIFTRLP-----LKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLN 470          
BLAST of Carboxypeptidase vs. UniProt/SwissProt
Match: sp|P52717|CTS11_CAEEL (Serine carboxypeptidase ctsa-1.1 OS=Caenorhabditis elegans OX=6239 GN=ctsa-1.1 PE=1 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 1.151e-109
Identity = 187/478 (39.12%), Postives = 267/478 (55.86%), Query Frame = 1
Query:  139 DEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEG-YLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVK--LAMDGYKNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKN------KLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNHNSL 1545
            +E+  LPGL F+PNFKHYSG+   SD   LHYWFVESQ  P+ DPL+ W NGGPGCSSLDG + E GP+    +G  L +N YSWNK+A+V+Y+ESP+ VG+SY+TDG    NDD TSL N+ A++ F  +FPQ++    +I GESYGG YVPTL+ R+V       +  KG+A+GNG  +  LN + +  FAY HGLI + +W+ +   CC    DS  C++T      C T V+       +  LN Y++Y DC  P+ +++      +           L G      H    L+ +    + +F    L NK+      K ++PC NDT    Y+NNPKVR A+HIP  +  W +CS  V   Y+  YT+MT    K+    +  + +Y GD DMAC ++  + F +    +    + PW Y      +QI GF  +FD  + +TIRG+GHM P  +     +  + FLN++ L
Sbjct:   17 EEIKDLPGLDFEPNFKHYSGFFQVSDNHVLHYWFVESQNEPSNDPLIFWFNGGPGCSSLDGLLNEMGPYVANEDGKTLRENEYSWNKMASVVYIESPAGVGYSYATDGNITTNDDLTSLENYEAVKQFFTEFPQFRHHQTFIMGESYGGVYVPTLTARIVDGQKDFPINLKGMALGNGYVNEKLNIDTSVRFAYGHGLIDEKIWNTLERDCCRGCIDS--CDLT-QVTGHCATLVEDIFQFLWFGGLNPYDLYRDC-DPNPSVNSKRMKHM-----------LRGVAPAMAHFDELLKNQTKTSLYQF----LKNKSQSQKPLKADVPCLNDTEMLSYMNNPKVRKAIHIPFNLGKWDICSDKVTTTYQKQYTDMTPFIKKIVK-NHVRVLLYYGDTDMACNFMMGQQFSDQLGLRRTLKKTPWKYD-----RQIAGFKTLFDGLSFITIRGAGHMAPQWRAPQMYYAVQQFLNNHPL 469          
BLAST of Carboxypeptidase vs. UniProt/SwissProt
Match: sp|Q09991|CTS41_CAEEL (Serine carboxypeptidase ctsa-4.1 OS=Caenorhabditis elegans OX=6239 GN=ctsa-4.1 PE=3 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 3.262e-104
Identity = 191/476 (40.13%), Postives = 259/476 (54.41%), Query Frame = 1
Query:  139 DEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNK-EEKCKTKVKLAMDGYKNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLE--IP-CSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRK----PWFYKDPHSGQQIGGF-VKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNH 1536
            D+VN LPGL F P+F HYSGYL     K LHYW  ES ++PT+DPLVLWLNGGPGCSSLDG I E GPF V + G  I  N Y+WNK ANV++LESP+ VG+SYST+     +DD  SL N+ AL  FL KFP+YKGRDF+ITGESY G Y+PTL+VR++ +       FKG+A+GNG  ++P N N    F YYH L+ D L+++I   CC    +   C+I     +  C+ KV  A+DG   LN+YN+Y  CY                              Y+P    + L++ +I    +  V     K+     +P C+    +  YLN   VR +LHIP  +  W  CS  V  NY   + N+  ++  +       I +YNGDVD AC  + ++ F  S    ++  ++     W Y    +G  + GF  K       LT+RGSGH VP DKP  +  M  +F+N+
Sbjct:   24 DKVNDLPGLTFTPDFFHYSGYLRAWTDKYLHYWLTESSRAPTQDPLVLWLNGGPGCSSLDGLIEELGPFHVKDFGNSIYYNEYAWNKFANVLFLESPAGVGYSYSTNFNLTVSDDEVSLHNYMALLDFLSKFPEYKGRDFWITGESYAGVYIPTLAVRILNDKKNFP-NFKGVAIGNGALNFPNNYNTMVPFYYYHALVRDDLYNDIARNCC--NNNIGTCDIYSKFFDPNCRDKVINALDGTNELNMYNLYDVCY------------------------------YNP---TTNLKKAFIERQMRIAVGLPARKHNAATTVPLCAQTNNTHVYLNRADVRKSLHIPSSLPAWEECSDQVGKNYVVTHFNVIPEFQTMI-AAGIKILVYNGDVDTACNSIMNQQFLTSLNLTVLGEQEKVNEAWHYSG-QTGTAVAGFQTKFAGNVDFLTVRGSGHFVPEDKPKESQQMIFNFINN 461          
BLAST of Carboxypeptidase vs. TrEMBL
Match: F8WPA7 (Carboxypeptidase OS=Oplegnathus fasciatus OX=163134 GN=CTS-A PE=2 SV=1)

HSP 1 Score: 439.499 bits (1129), Expect = 1.616e-146
Identity = 218/467 (46.68%), Postives = 301/467 (64.45%), Query Frame = 1
Query:  139 DEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAMDGY--KNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFL 1530
            DEV  LPGL+ QPNF+HYSGYLN +D K LHYWF+ESQK+P+ DP+VLWLNGGPGCSSLDG +TEHGPF + ++G  +  NPYSWN IAN++YLESP+ VGFSYS D K   ND   S+ N+ AL+ F   FP++   + ++TGESYGG Y+PTL+ R++ +    ++  +G+AVGNG+SS+ +NDN   +FAYYHGL+   LW+E+ + CC+ G    +CN   N+++ C   +    D      LN+YN+Y+ C  P     +A   +        K  I +  N   +H+ ++L  + +  ++   +       +L+ PC+N T S+ YLNNP VR ALHI     DW +CSS VN NY  +Y ++  QY KL +   + I +YNGDVDMAC ++ DEWF ES  Q++   R+PW Y D   G+Q+GGFVK FD    LT++GSGHMVP+DKPI A  MF  F+
Sbjct:   23 DEVTYLPGLQKQPNFRHYSGYLNVADGKHLHYWFLESQKNPSSDPVVLWLNGGPGCSSLDGLLTEHGPFLIQDDGVTLQYNPYSWNMIANMLYLESPAGVGFSYSDDQKYVTNDTEVSMNNYLALKEFFRLFPEFNKNELFLTGESYGGIYIPTLAERVMEDA---SLNLQGVAVGNGMSSYEMNDNSLVYFAYYHGLLGSRLWTELQTFCCSDG----RCNFYDNQDQNCSASLSEVQDIVYSSGLNMYNLYAPC--PGGVRQRASIER-------GKLVIRDLGNSFINHQWTQLWNQKLRGLASLHL-----SVRLDPPCTNSTPSSLYLNNPYVRAALHISPKALDWVICSSEVNLNYGRLYMDVRKQYLKLLSALKYRILVYNGDVDMACNFMGDEWFVESLHQQVEVQRRPWLYDD-EDGRQVGGFVKEFDNIAFLTVKGSGHMVPSDKPIAAFAMFSRFI 467          
BLAST of Carboxypeptidase vs. TrEMBL
Match: A0A3Q1C1Y6 (Carboxypeptidase OS=Amphiprion ocellaris OX=80972 PE=3 SV=1)

HSP 1 Score: 439.113 bits (1128), Expect = 2.387e-146
Identity = 223/474 (47.05%), Postives = 302/474 (63.71%), Query Frame = 1
Query:  139 DEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAMDGY--KNLNVYNIYSDC-----YTPSSAIDQAIWSQL-NIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKN-KLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFL 1530
            DE+  LPGL+ QP+F+HYSGYLN +D K LHYWFVESQ  P+ DPLVLWLNGGPGCSSLDG +TEHGP+ V ++G  +  NPYSWNKIAN++YLESP  VGFSYS D +   ND   S+ N+ AL+ FL  FP++     ++TGESYGG Y+PTL+ R++ +    ++  +G+AVGNG+SS+ LNDN   +FAYYHGL+   LW+++ + CC+ G    KCN   N+++ C   +           LN+YN+Y+ C        S   DQ +   L N F N++  Q    W+                   KF+ + L+ ++ +L+ PC+N T S+ YLNNP VR ALHI     DW++CS+ VN NY  +Y ++  QY KL +   + + +YNGDVDMAC ++ DEWF ES QQ++   R+PW Y D   G+Q+GGFVK FD    LT++GSGHMVPTDKPI A  MF  F+
Sbjct:   22 DEITFLPGLQKQPSFRHYSGYLNVADGKHLHYWFVESQNDPSSDPLVLWLNGGPGCSSLDGLLTEHGPYLVQDDGMTLQYNPYSWNKIANMLYLESPVGVGFSYSDDQRYVTNDTEVSMNNYLALKEFLRLFPEFSSNQVFLTGESYGGIYIPTLAERVMEDA---SINLQGVAVGNGMSSYELNDNSLVYFAYYHGLLGSRLWADLQNFCCSAG----KCNFYNNQDQNCSESLSEVQTIVYASGLNMYNLYASCPGGVHCRVSVERDQLVIRDLGNSFINHQTTQ---QWS------------------QKFRGLALMFRSVRLDPPCTNSTPSSLYLNNPYVRTALHISPKALDWAICSAEVNLNYGRLYLDVRKQYLKLLSALKYRVLVYNGDVDMACNFMGDEWFVESLQQQVEVQRRPWLYDDV-DGRQVGGFVKEFDNIAFLTVKGSGHMVPTDKPIVAFAMFSRFI 466          
BLAST of Carboxypeptidase vs. TrEMBL
Match: V9KI55 (Carboxypeptidase OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 438.343 bits (1126), Expect = 4.251e-146
Identity = 232/481 (48.23%), Postives = 296/481 (61.54%), Query Frame = 1
Query:   97 YVLISKIVAFNYQEDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAMDGYKN--LNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFL 1530
            +VL S  VA     DE+  LPGL  QP+FK YSGYLN SD K L YWFVESQ SP KDP+VLWLNGGPGCSSLDG + EHGPF +  +G  +  NPYSWN IAN++YLESP+ VGFSYS D     ND   S  N+ AL+ F   FP+Y   DFY+TGESYGG YVPTL+ R++T+    +++ KGIAVGNGL SW LN N   +FAYYHG+I   LW ++   CCA G     CN   NK++ C+ KV   +    N  LN YNIY+DC          +   +      ++    +  N  P H  S+L  K   L+  +Q  G +   +L+ PC+N T S+ +LN+  +R ALH+P  VQ+W +CSS+VN  Y  +Y +M  QY KL N   + I +YNGDVDMAC ++ D+WF ES QQ +   R+PW Y       QIGGFVK F     +TI+G+GHMVPTDKP  A  +F  FL
Sbjct:   14 FVLESAPVA-----DEIVYLPGLAKQPSFKQYSGYLNISDNKHLFYWFVESQSSPKKDPVVLWLNGGPGCSSLDGLLNEHGPFLIQQDGKSLQYNPYSWNLIANMLYLESPAGVGFSYSDDQIYKTNDTEVSFNNYLALKEFFHLFPEYSKNDFYVTGESYGGIYVPTLAERVMTDS---SIQLKGIAVGNGLGSWELNGNSVVYFAYYHGVIGSKLWGDLQKFCCAKG----TCNFYKNKDQDCQNKVGEVIAAVWNSGLNAYNIYADC-------AGGVPGDIRFDEKRKQLVTYDLGNLFPWHESSQLWRK--KLLDLYQTNGRL---RLDTPCTNSTPSSTFLNDWAIRRALHVPNVVQNWEICSSAVNLQYTRLYADMKDQYLKLLNAWQYRILVYNGDVDMACNFMGDQWFVESLQQLVTVNRRPWLYN--KGVNQIGGFVKEFSNLAFVTIKGAGHMVPTDKPQAAFTIFSRFL 468          
BLAST of Carboxypeptidase vs. TrEMBL
Match: A0A3Q1GFW4 (Carboxypeptidase OS=Acanthochromis polyacanthus OX=80966 PE=3 SV=1)

HSP 1 Score: 437.958 bits (1125), Expect = 5.274e-146
Identity = 225/473 (47.57%), Postives = 306/473 (64.69%), Query Frame = 1
Query:  139 DEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKC-KTKVKLAMDGYKN-LNVYNIYSDC-----YTPSSAIDQAIWSQL-NIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFL 1530
            DE+  LPGL+ QP+F+HYSGYLN +D K LHYWFVESQ  P+ DPLVLWLNGGPGCSSLDG +TEHGP+ V ++G  +  NPYSWNKIAN++YLESP  VGFSYS D +   ND   S+ N+ AL+ FL  FP++     ++TGESYGG Y+PTL+ R++ +    ++  +G+AVGNG+SS+ LNDN   +FAYYHGL+   LW+++   CC+ G    KCN   N+++ C ++  ++    Y + LN+YN+Y+ C        S   DQ +   L N F N+   Q+   W+           +K+  L S F+ +      +L+ PC+N T S+ YLNNP V+ ALHI     DW++CSS VN NY  +Y ++  QY KL +   + + +YNGDVDMAC ++ DEWF ES QQ++   R+PW Y D   G+Q+GGFVK FD    LT++GSGHMVPTDKPI A  MF  F+
Sbjct:   22 DEITFLPGLQKQPSFRHYSGYLNVADGKHLHYWFVESQNDPSSDPLVLWLNGGPGCSSLDGLLTEHGPYLVQDDGITLQYNPYSWNKIANMLYLESPVGVGFSYSDDQRYVTNDTEVSMNNYLALKEFLRLFPKFSNNQVFLTGESYGGIYIPTLAERVMEDA---SINLQGVAVGNGMSSYELNDNSLVYFAYYHGLLGSRLWTDLQKFCCSAG----KCNFYNNQDQNCIESLSEVQTIVYASGLNMYNLYAPCPGGVHRRVSLEGDQLVIRDLGNSFINH---QMTQEWS-----------QKFRGLASVFRSV------RLDPPCTNSTPSSLYLNNPLVKAALHISPKALDWAICSSEVNLNYGRLYLDVRKQYLKLLSALKYRVLVYNGDVDMACNFMGDEWFVESLQQQVEVQRRPWLYDDI-DGRQVGGFVKEFDNIAFLTVKGSGHMVPTDKPIAAFAMFSRFI 466          
BLAST of Carboxypeptidase vs. TrEMBL
Match: A0A4W3J6U1 (Carboxypeptidase OS=Callorhinchus milii OX=7868 PE=3 SV=1)

HSP 1 Score: 437.958 bits (1125), Expect = 8.781e-146
Identity = 236/491 (48.07%), Postives = 302/491 (61.51%), Query Frame = 1
Query:   97 YVLISKIVAFNYQEDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAMDGYKN-LNVYNIYSDCY--TPSSAIDQAIWSQL------NIFSNYEKFQILNGWNYDPDHRISKLREKY---INLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFL 1530
            +VL S  VA     DE+  LPGL  QP+FK YSGYLN SD K L YWFVESQ SP KDP+VLWLNGGPGCSSLDG + EHGPF +  +G  +  NPYSWN IAN++YLESP+ VGFSYS D     ND   S  N+ AL+ F   FP+Y   DFY+TGESYGG YVPTL+ R++T+    +++ KGIAVGNGL SW LN N   +FAYYHG+I   LW ++   CCA G     CN   NK++ C+ KV +    + + LN YNIY+DC    P          QL      N+F  +E  Q+    N      +S L+ K    + L+  +Q  G   + +L+ PC+N T S+ +LN+  +R ALH+P  VQ+W +CSS+VN  Y  +Y +M  QY KL N   + I +YNGDVDMAC ++ D+WF ES QQ +   R+PW Y       QIGGFVK F     +TI+G+GHMVPTDKP  A  +F  FL
Sbjct:   14 FVLESAPVA-----DEIVYLPGLAKQPSFKQYSGYLNVSDNKHLFYWFVESQSSPKKDPVVLWLNGGPGCSSLDGLLNEHGPFLIQQDGKSLQYNPYSWNLIANMLYLESPAGVGFSYSDDQIYKTNDTEVSFNNYLALKEFFHLFPEYSKNDFYVTGESYGGIYVPTLAERVMTDS---SIQLKGIAVGNGLGSWELNGNSVVYFAYYHGVIGSKLWGDLQKFCCAKG----TCNFYKNKDQDCQNKVSVIAAVWNSGLNAYNIYADCAGGVPGDIRFDEKRKQLVTYDLGNLFPWHESSQLWRKVN-----ALSFLKRKLHPNLKLLDLYQTNG---RLRLDTPCTNSTPSSTFLNDWAIRRALHVPNVVQNWEICSSAVNLQYTRLYADMKDQYLKLLNAWQYRILVYNGDVDMACNFMGDQWFVESLQQLVTVNRRPWLYN--KGVNQIGGFVKEFSNLAFVTIKGAGHMVPTDKPQAAFTIFSRFL 482          
BLAST of Carboxypeptidase vs. Ensembl Cavefish
Match: si:ch211-122f10.4 (lysosomal protective protein-like [Source:NCBI gene;Acc:103027152])

HSP 1 Score: 382.874 bits (982), Expect = 6.072e-128
Identity = 204/469 (43.50%), Postives = 277/469 (59.06%), Query Frame = 1
Query:  139 DEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAMDGYKN--LNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIP-CSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNH 1536
            D V  LPGL   PNF+HYSGYL     K  HYWFVESQ +P+ DP++LWLNGGPGCSS++G + E+GPF + ++G +  NPYSWN +ANV+YLESP+ VGFSYST G    +D   +  N+ AL  F  KFP +   DFY+  ESYGG Y PTLS  + +      + FKG+ VGNG++S+ +NDN   +F YYHGLI +SLWSEI   CC+ G     C   GN    C+  V  A+   ++  LN+YN+Y+ CY  + A  +                      YD D  +S L        S F+    V+ +    P C N TA   +LNNP VR ALHIP  VQ W +CSS+V   Y+  Y++MT  Y  L   +N  + ++NGDVDMAC +L  EWF E+  Q ++S   PW+Y +     QI G+VK ++  T LT++G+GHMVP  KP  AL +F+++L++
Sbjct:   35 DLVTSLPGLSETPNFQHYSGYLQAGQGKYFHYWFVESQNNPSTDPVLLWLNGGPGCSSMEGLLAENGPFHLNDDGTVYINPYSWNLLANVLYLESPAGVGFSYSTTGNYQTSDPQVAEDNYNALLDFFSKFPSFTSNDFYVFAESYGGVYAPTLSKLIASGSAN--INFKGMGVGNGMTSYAVNDNSLVYFGYYHGLIGESLWSEINEYCCSSG----TCTYYGNTNTNCQNAVYDALYLIQDIGLNIYNLYAPCYGGAQAQSR----------------------YDAD--MSNLFRH-----SGFKFQAQVDVSVPGDPKCFNGTAMYVWLNNPNVRAALHIPSTVQSWELCSSTVGSQYQRTYSDMTPFYQYLLQ-KNLRLLVFNGDVDMACNFLGAEWFVEALNQSVVSQYAPWYYNN-----QIAGYVKQYENITFLTVKGAGHMVPQYKPAVALQLFKNYLSN 462          
BLAST of Carboxypeptidase vs. Ensembl Cavefish
Match: ctsa (cathepsin A [Source:ZFIN;Acc:ZDB-GENE-030131-537])

HSP 1 Score: 341.658 bits (875), Expect = 2.503e-112
Identity = 191/468 (40.81%), Postives = 260/468 (55.56%), Query Frame = 1
Query:  133 QEDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAMDGY--KNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFL 1530
            ++DE+  LPGL  QP+FK YSGY N +  K LHYW+++                       DG   E+             NPYSWN IAN++YLESP+ VGFSYS D K   ND   S+ N+ AL+ F   FP+Y   + Y+TGESY G Y+PTL+ R++ +    ++  +GIAVGNGLSS+ LNDN   +FAYYHGL   SLWS +   CC  G     CN   + +  C   V    +      LN+YN+Y+ C   +  +  ++ +         +  I +  N   +H+ S L  + +  +S F+ +      KL+ PC+N TASA YLN+P V+ A+HI     +W +CS  VN NY  IY ++  QY KL     + I +YNGDVDMAC +L DEWF ES QQK+   R+ W Y +  + QQ+GGFVK F     LT++GSGHMVPTDKPI A  MF  F+
Sbjct:   20 EKDEIKFLPGLSKQPSFKQYSGYFNVAGNKHLHYWWIQD----------------------DGTTLEY-------------NPYSWNMIANMLYLESPAGVGFSYSDDKKYTTNDTEVSMNNYLALKEFFRLFPEYSKNEVYLTGESYAGIYIPTLAERVMEDS---SINLQGIAVGNGLSSYELNDNSLVYFAYYHGLFGSSLWSSLQKYCCKDG----NCNFYNSPDPDCSASVSQVQNIVYSSGLNMYNLYAPC---AGGVGTSVENG--------RLVIRDMGNNFINHKWSSLWNQKLLGLSMFKSI------KLDPPCTNSTASALYLNDPYVKSAIHISPDALEWVICSGEVNLNYNRIYMDVKKQYLKLLGAMKYRILVYNGDVDMACNFLGDEWFVESLQQKVEVQRRTWLYFNGQN-QQVGGFVKEFTNLAFLTVKGSGHMVPTDKPIAAYTMFSRFI 427          
BLAST of Carboxypeptidase vs. Ensembl Cavefish
Match: scpep1 (serine carboxypeptidase 1 [Source:NCBI gene;Acc:103022695])

HSP 1 Score: 73.1738 bits (178), Expect = 2.258e-13
Identity = 56/187 (29.95%), Postives = 87/187 (46.52%), Query Frame = 1
Query:  145 VNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKD-PLVLWLNGGPGCSSLD-GFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRA-LQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVK--FKGIAVGNGLSSWPLN 690
            V++  G       K   GY++  +   + +W   +     KD PLV+WL GGPG SS   G   E GP        L     SW   A+V+++++P   G+SY+   K  A D +    +    LQ F  +  +++   FYI  ESYGG     +S+ L       ++K  F G+A+G+   S PL+
Sbjct:   17 VSVCRGWSLPVQEKEVWGYVDVREGAHMFWWLYYANSPSFKDLPLVMWLQGGPGGSSCGFGNFGEIGPLDTD----LKPRKTSWVNAASVLFVDNPVGTGYSYTDSEKALATDVSMVAADMMVLLQSFFSQRTEFQTVPFYIFSESYGGKMASAISLELTKAVQKGSIKCNFAGVALGDSWIS-PLD 198          
BLAST of Carboxypeptidase vs. Ensembl Sea Lamprey
Match: ctsa (cathepsin A [Source:ZFIN;Acc:ZDB-GENE-030131-537])

HSP 1 Score: 404.06 bits (1037), Expect = 9.825e-137
Identity = 212/471 (45.01%), Postives = 288/471 (61.15%), Query Frame = 1
Query:  136 EDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAMDGY--KNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNHN 1539
            EDE++ LPGL  QP F+HYSGYL+ S TK+LHYWFVESQ +P+KDPLVLW+NGGPGCSSL+G ITE+GP+ V ++G  ++ NPYSWN I++V+YLE+P+ VGFSYS D     +DD  S+ N+ AL++F  KFP++   D Y+TGESY GFY+P L++R++ E P  ++  KG+A+GNGLSS  +NDN   +FAYYHG+    LW+ +   CC+ G    KC+ + ++ ++C   V+ A        L+ YN+Y+ C     A  Q     L                 DP  R    R+  + L  +    G +N +    PC+N +  A YLN+P VR ALHIP  +  W  CS  VN ++   Y +M  Q+ +L     + I  YNGDVDM C +L +EWF ES QQK+   R+PW YKD  S  QIGGF+K F     LT+RG+GHM P DKP+     F  FL HN
Sbjct:   28 EDEISYLPGLAKQPAFRHYSGYLDASGTKRLHYWFVESQGNPSKDPLVLWMNGGPGCSSLEGIITENGPYLVQSDGIHLEYNPYSWNMISSVLYLEAPAGVGFSYSADKNYTTSDDQVSMDNYLALKNFFAKFPEWSKHDLYLTGESYAGFYLPALAMRIM-EDP--SINLKGLAIGNGLSSIAMNDNSAIYFAYYHGIFGADLWALLQQYCCSQG----KCDFSSSESKQCNDAVQQAARHIFQGGLDPYNLYAPCAGGVRAPRQNGSKPLGA---------------DP-RRSFVFRKHGLRLHQRVMEHGGLNSDS---PCTNTSTMASYLNSPLVRKALHIPAVLPPWEDCSDFVNRHFVWQYEDMRKQHLRLLGSLKYRILFYNGDVDMVCNFLGEEWFVESLQQKVTVERRPWLYKDGGS-NQIGGFIKEFQNLAFLTVRGAGHMSPKDKPLQVFTAFSHFL-HN 470          
BLAST of Carboxypeptidase vs. Ensembl Sea Lamprey
Match: ctsa (cathepsin A [Source:ZFIN;Acc:ZDB-GENE-030131-537])

HSP 1 Score: 387.111 bits (993), Expect = 1.122e-130
Identity = 207/450 (46.00%), Postives = 278/450 (61.78%), Query Frame = 1
Query:  136 EDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGY-LIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCK---TKVKLAMDGYKNLNVYNIYSDC---YTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIR 1464
            EDE++ LPGL  QP F+HYSGYL+ S TK+LHYWFVESQ +P+KDPLVLWLNGGPGCSS++G + EHGP+ V  +G  L+ NPY+WNKI++V+YLE+P+ VGFSY+ D     +DD  S+ N+ AL+ F  KFP++   D Y+TGESY GFY+PTL+VR V E P  ++  KG+AVGN LSS+ +NDN   +FAYYHGLI + LW  +   CC+ G    KCN     + +C     KV + + G   LN+YN+Y+ C     P + ++Q   +   + +N                    L +    L S+    G V   +L+ PC N +  A YLN+  VR ALHIP  V  W +CS  V  +Y+S YT+M   Y KL     + I +YNGDVDMAC +L +EWF ES QQK+   R+PW ++D  S  QI GFVK F    LLT++
Sbjct:   21 EDEISYLPGLAKQPAFRHYSGYLDASGTKRLHYWFVESQSNPSKDPLVLWLNGGPGCSSMEGLLAEHGPYLVQPDGVSLLYNPYAWNKISSVLYLEAPAGVGFSYAADKNYTTSDDQVSMDNYLALKSFFAKFPEWSKHDLYLTGESYAGFYLPTLAVR-VMEDP--SINLKGMAVGNALSSFEINDNSIVYFAYYHGLIGEDLWVNLQQHCCSEG----KCNFFSPGDPQCSKLVEKVSVVVGGI-GLNIYNLYAPCAGGVPPPATLNQCCLTARYVGAN-----------------TCALPQALWKLHSR---RGPV---RLDPPCVNSSNMAAYLNDDYVRRALHIPSGVPTWEICSFEVGSHYQSTYTSMKDHYLKLLGALKYRILLYNGDVDMACNFLGEEWFVESLQQKVAVERRPWLFEDGSS--QIAGFVKEFSNLALLTVK 437          
BLAST of Carboxypeptidase vs. Ensembl Sea Lamprey
Match: si:ch211-122f10.4 (si:ch211-122f10.4 [Source:ZFIN;Acc:ZDB-GENE-140106-45])

HSP 1 Score: 369.392 bits (947), Expect = 2.512e-123
Identity = 208/473 (43.97%), Postives = 270/473 (57.08%), Query Frame = 1
Query:  145 VNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGY-LIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAMD-GYK-NLNVYNIYSDC---YTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNHNSL 1545
            V  LPGL  QP F HYSG+L+G     LHYWFVES ++P  DP+VLWLNGGPGCSS+DGF++E+GPF V ++G  L  N  SWNK+AN++YLESP+ VGFS+S D     +DD  +  N+ ALQ F  KFP++ G DF+I GESYGG YVPTLS+R+ T      + FKG AVGNGLSS+ +ND    +FAYYHGL+ +SLW+++ S CC+      KCN   +    CK  V       Y+  LNVY +Y DC     P SA  +A  S L  F  Y     L      P H+                V       +   PC N T   +++N   VR ALHIP  VQ W  CS  V  NY  +Y++M   Y KL         +YNGD DMAC +L D+WF ES Q+K ++ ++ W   D     QI GF   +D  T LT++G+GHMVP   P  +  MF+SF+ +  L
Sbjct:   32 VKGLPGLEPQPAFAHYSGFLSGGHGAHLHYWFVESARNPASDPVVLWLNGGPGCSSIDGFLSENGPFHVNDDGRTLYYNNDSWNKVANILYLESPAGVGFSFSDDKNYTIDDDQVADRNYAALQDFFAKFPEFSGNDFFIFGESYGGIYVPTLSLRVTTG--AAKINFKGFAVGNGLSSYAINDQSLVYFAYYHGLLGESLWADLNSYCCS----GAKCNFYNSSSSDCKEAVMRTFHIVYEIGLNVYALYLDCAGGIGPHSARYRADMSHL--FRAYSPVLPL----LPPHHQ---------------SVAAPGGGLRGVPPCLNGTGETNWINQRSVRAALHIPDGVQAWQFCSDVVGANYVRVYSDMFDVYQKLLG-HGLRGLVYNGDTDMACNFLGDKWFVESLQRKKLAAQRAWIVDD-----QIAGFCHEYDGITFLTVKGAGHMVPQWAPRASFKMFQSFIANKPL 471          
BLAST of Carboxypeptidase vs. Ensembl Sea Lamprey
Match: ctsa (cathepsin A [Source:ZFIN;Acc:ZDB-GENE-030131-537])

HSP 1 Score: 363.229 bits (931), Expect = 3.838e-121
Identity = 198/449 (44.10%), Postives = 266/449 (59.24%), Query Frame = 1
Query:  136 EDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCK---TKVKLAMDGYKNLNVYNIYSDC---YTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIR 1464
            EDE++ LPGL  QP F+HYSGYL+ S TK+LHYWFVESQ +P+KDPLVLWLNGGPGCSS++G + EHGP+                 I++V+YLE+P+ VGFSY+ D     +DD  S+ N+ AL+ F  KFP++   D Y+TGESY GFY+PTL+VR V E P  ++  KG+AVGN LSS+ +NDN   +FAYYHGLI + LW  +   CC+ G    KCN     + +C     KV + + G   LN+YN+Y+ C     P + ++Q   +   + +N                    L +    L S+    G V   +L+ PC N +  A YLN+  VR ALHIP  V  W +CS  V  +Y+S YT+M   Y KL     + I +YNGDVDMAC +L +EWF ES QQK+   R+PW ++D  S  QI GFVK F    LLT++
Sbjct:   48 EDEISYLPGLAKQPAFRHYSGYLDASGTKRLHYWFVESQSNPSKDPLVLWLNGGPGCSSMEGLLAEHGPYL----------------ISSVLYLEAPAGVGFSYAADKNYTTSDDQVSMDNYLALKSFFAKFPEWSKHDLYLTGESYAGFYLPTLAVR-VMEDP--SINLKGMAVGNALSSFEINDNSIVYFAYYHGLIGEDLWVNLQQHCCSEG----KCNFFSPGDPQCSKLVEKVSVVVGGI-GLNIYNLYAPCAGGVPPPATLNQCCLTARYVGAN-----------------TCALPQALWKLHSR---RGPV---RLDPPCVNSSNMAAYLNDDYVRRALHIPSGVPTWEICSFEVGSHYQSTYTSMKDHYLKLLGALKYRILLYNGDVDMACNFLGEEWFVESLQQKVAVERRPWLFEDGSS--QIAGFVKEFSNLALLTVK 447          
BLAST of Carboxypeptidase vs. Ensembl Yeast
Match: YBR139W_mRNA (Putative serine type carboxypeptidase; role in phytochelatin synthesis; green fluorescent protein (GFP)-fusion protein localizes to the vacuole; expression induced by nitrogen limitation in a GLN3, GAT1-independent manner [Source:SGD;Acc:S000000343])

HSP 1 Score: 175.252 bits (443), Expect = 6.433e-49
Identity = 138/472 (29.24%), Postives = 209/472 (44.28%), Query Frame = 1
Query:  184 KHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRA---LQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGE-----DSRKCNITGNKEEKCKTKVKLAMDGYKNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINL-MSKFQVMGLVNKNKLEIPCSNDTASAD-YLNNPKVRFALHIPKFVQDWSVCSSSV--NFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLAD-------EWFFE-SFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNHN 1539
            K +SGY++  D+K   YWF ES+  P  DP++LWLNGGPGCSS  G + E GP  +  +   I NPYSWN  A++I+LE P  VGFSY      D    +T L    A   L+ F   FP  +  DF+I GESY G Y+P ++  +V ++P        + +GNG++  PL         YY              + C  G       S +C        +C+   KL                CY   S++   + +                      +  S L E YIN  ++ + + G    N  +  C       D Y+N P+V+  L     V ++S C + V   F +    +    QY       N  + IY GD D  C +L +       EW  +  +Q++++   +PW  K+  +G+++G  VK +  FT L I  +GHMVP D+P  +L M  S+++ N
Sbjct:   92 KQWSGYMDYKDSKHFFYWFFESRNDPANDPIILWLNGGPGCSSFTGLLFELGPSSIGADMKPIHNPYSWNNNASMIFLEQPLGVGFSYG-----DEKVSSTKLAGKDAYIFLELFFEAFPHLRSNDFHIAGESYAGHYIPQIAHEIVVKNPERTFNLTSVMIGNGITD-PL-----IQADYYE------------PMACGKGGYHPVLSSEECEKMSKAAGRCRRLNKL----------------CYASKSSLPCIVATA---------------------YCDSALLEPYINTGLNVYDIRGPCEDNSTDGMCYTGLRYVDQYMNFPEVQETLG--SDVHNYSGCDNDVFTGFLFTGDGSKPFQQYIAELLNHNIPVLIYAGDKDYICNWLGNHAWSNELEWINKRRYQRRML---RPWVSKE--TGEELGQ-VKNYGPFTFLRIYDAGHMVPYDQPEASLEMVNSWISGN 495          
BLAST of Carboxypeptidase vs. Ensembl Yeast
Match: PRC1 (Vacuolar carboxypeptidase Y (proteinase C, CPY); broad-specificity C-terminal exopeptidase involved in non-specific protein degradation in the vacuole; member of the serine carboxypeptidase family [Source:SGD;Acc:S000004912])

HSP 1 Score: 161.77 bits (408), Expect = 7.188e-44
Identity = 139/486 (28.60%), Postives = 206/486 (42.39%), Query Frame = 1
Query:  163 LRFQPNFKHYSGYLNGSDTKK-LHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYS-TDGKCDANDDTTSLLNFRALQHFLIKFPQY--KGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGED-----SRKCNITGNKEEKCKTKVKLAMDGYKNLNVYNIYSDCYTPSSAIDQAIWSQL--NIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNY-------KSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQ-----------QIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLN 1533
            L   PN   Y+GYL+  D  K   +W  ES+  P KDP++LWLNGGPGCSSL G   E GP  +  +   I NPYSWN  A VI+L+ P  VGFSYS + G  +       + NF  L+ F  +FP+Y  KG+DF+I GESY G Y+P  +  +++ H         + +GNGL+  PL       + YY              + C  G +     S +C+   +  E+C                  +   CY       Q++WS +   I+ N  +          P  R  +         + + +        L  P   D    DYLN   V+ A+     V  +  C+  +N N+       K  +T +T   N     Q+  I +Y GD D  C +L ++ + +           PW Y +  + Q           ++ G VK +  FT L +   GHMVP D P  AL M   +++
Sbjct:  119 LGIDPNVTQYTGYLDVEDEDKHFFFWTFESRNDPAKDPVILWLNGGPGCSSLTGLFFELGPSSIGPDLKPIGNPYSWNSNATVIFLDQPVNVGFSYSGSSGVSNTVAAGKDVYNF--LELFFDQFPEYVNKGQDFHIAGESYAGHYIPVFASEILS-HKDRNFNLTSVLIGNGLTD-PLT-----QYNYYE------------PMACGEGGEPSVLPSEECSAMEDSLERC----------------LGLIESCYD-----SQSVWSCVPATIYCNNAQLA--------PYQRTGR---------NVYDIRKDCEGGNLCYPTLQDI--DDYLNQDYVKEAVGAE--VDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLN-----QDLPILVYAGDKDFICNWLGNKAWTDVL---------PWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVPFDVPENALSMVNEWIH 527          
BLAST of Carboxypeptidase vs. Ensembl Yeast
Match: KEX1 (Cell death protease essential for hypochlorite-induced apoptosis; involved in the processing of killer toxin and alpha factor precursor; cleaves Lys and Arg residues from the C-terminus of peptides and proteins [Source:SGD;Acc:S000003171])

HSP 1 Score: 94.7449 bits (234), Expect = 6.117e-21
Identity = 61/203 (30.05%), Postives = 102/203 (50.25%), Query Frame = 1
Query:  151 ILPGLRFQPNF----KHYSGYL-------NGSDTKKLHYWFVE----SQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYST---DGKCDAN-------DDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHP-----GLAVKFKGIAVGNG 669
            +LPGL   P+     + ++G++       +  D+  L Y+F +            PL++WLNGGPGCSS+DG + E GPF+V ++G L  N  SW    ++++++ P+  GFS      +GK D N       D T   ++F  L+++   FP+   R   ++GESY G Y+P  +  ++  +      G     K + +GNG
Sbjct:   35 LLPGLSEVPDPSNIPQMHAGHIPLRSEDADEQDSSDLEYFFWKFTNNDSNGNVDRPLIIWLNGGPGCSSMDGALVESGPFRVNSDGKLYLNEGSWISKGDLLFIDQPTGTGFSVEQNKDEGKIDKNKFDEDLEDVTKHFMDF--LENYFKIFPEDLTRKIILSGESYAGQYIPFFANAILNHNKFSKIDGDTYDLKALLIGNG 235          
BLAST of Carboxypeptidase vs. Ensembl Nematostella
Match: EDO31722 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX44])

HSP 1 Score: 72.4034 bits (176), Expect = 1.101e-13
Identity = 69/241 (28.63%), Postives = 104/241 (43.15%), Query Frame = 1
Query:  199 YLNGSDTKKLHYWFVESQKSPTK---DPLVLWLNGGPGCSSLD-GFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYSTD-GKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRL--VTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKV-----KLAMDGYKNLNVYNI 885
            Y+    +  + +W   ++  P++    PL+LWL GGPG SS   G   E GP  V     L     SW ++ANV+++++P   GFSY TD G    N    +       + F+ + P ++    YI  ESYGG       V L    +   +   FKG+A+G+   SW    +    +  Y  L S SL  + L L           N   N+E K  T +      +      N++VYNI
Sbjct:    5 YVTVRPSAHMFWWLYGARGEPSERENKPLILWLQGGPGGSSTGYGNFMELGPLDVN----LKLRNTSWVEVANVLFVDNPVGAGFSYVTDKGAYTTNVTGIAQDLLTMFKAFVNEMPAFQTIPLYIFCESYGGKMTSAFGVTLYNAIQQGEIRCNFKGVALGD---SWISPVDSVLSWGPY--LYSASLLDQ-LDLDRVNQYAQATANAVANQEWKKATDLWSETENVIAQTTDNVDVYNI 235          
BLAST of Carboxypeptidase vs. Ensembl Medaka
Match: ctsa (cathepsin A [Source:NCBI gene;Acc:101173697])

HSP 1 Score: 422.165 bits (1084), Expect = 3.386e-143
Identity = 222/470 (47.23%), Postives = 298/470 (63.40%), Query Frame = 1
Query:  139 DEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLID-NPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAMDGY--KNLNVYNIYSDCYTPSSAIDQAIWSQL---NIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFL 1530
            DE+  LPGL+ QP+FK YSGYL+G++ K LHYWFVESQ  P++DP+VLWLNGGPGCSSLDG +TEHGPF + ++G  +  NPYSWNKIANV+YLESP  VGFSYS DGK   ND   SL N+ AL+ F   FP++     ++TGESYGG Y+PTL+ R++ +     +  +G+AVGNG+SS+ LNDN    FAYYHGL+   LWSE+ + CC  G+    CN   N+   C T +    D      LN+YN+Y+ C         A   QL   ++ +N+   Q    WN           +K ++L++  + +      +L+ PC+N T S  YLNN  V+ ALHI     DW +CS+ VN NY  +Y ++  QY KL +   + + +YNGDVDMAC ++ DEWF ES QQ++   R+PW+Y+D   G+Q+GGFVK FD    LTI+GSGHMVPTDKP+ A  MF  F+
Sbjct:   22 DEITYLPGLQKQPSFKQYSGYLSGTEGKHLHYWFVESQNDPSQDPVVLWLNGGPGCSSLDGLLTEHGPFLIMDDGATLQYNPYSWNKIANVLYLESPVGVGFSYSDDGKFATNDTEVSLNNYLALKDFFRLFPEFSKNQLFLTGESYGGIYIPTLAERVMEDAD---LNLQGVAVGNGMSSYELNDNSLVFFAYYHGLLGSQLWSELQTFCCKDGQ----CNFYNNQNPNCSTCLGDVQDIVYSSGLNMYNLYASCPGGVRHRVSAERGQLVIRDLGNNFINHQWTRLWN-----------QKLLSLVALHESV------RLDPPCTNSTPSTLYLNNQYVKKALHISPKALDWVICSAEVNLNYGRLYMDVKKQYLKLLSAMKYRVLVYNGDVDMACNFMGDEWFVESLQQQVQVQRRPWYYEDV-DGRQVGGFVKEFDNIAFLTIKGSGHMVPTDKPVAAFAMFTRFI 466          
BLAST of Carboxypeptidase vs. Ensembl Medaka
Match: si:ch211-122f10.4 (lysosomal protective protein [Source:NCBI gene;Acc:101168356])

HSP 1 Score: 357.066 bits (915), Expect = 5.307e-118
Identity = 198/491 (40.33%), Postives = 280/491 (57.03%), Query Frame = 1
Query:   97 YVLISKIVAF------NYQEDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEG-YLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAMDGY--KNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNHNS 1542
            ++++  + AF       Y  DEV  LPG+ F+PN++ +SGYL     + LHYWFV SQ+ P  DP+VLWLNGGPGCSSLDGF++E+GPF V ++G  L +N YSWNKIAN++YLESP+ VG+SYS D     +D+  +  N++ALQ F  KFP +   +F+I GESYGG Y PTLS+ + T      + FKG AVGNGLSS+ LND    +F YYHGL  + LW ++   CC    +   CN   +  E C+T V +A +      LN Y +Y DC                     ++F    G+ +   H     +++    +  ++V    +   +  PC N TA  ++LN   VR ALHIP  +  W +CS +V   YK++Y+ +   Y KL +L   ++ +YNGD DMAC +L D+WF E    K  +  + W Y+D     Q+ GF + F   T LT++G+GHMVP   P PAL MF SF+ + S
Sbjct:    4 HIVLCLLAAFGLGSHAQYAPDEVTELPGMTFKPNYRQWSGYLQAGPGRFLHYWFVTSQEDPATDPVVLWLNGGPGCSSLDGFLSENGPFHVNDDGTTLYENLYSWNKIANMLYLESPAGVGYSYS-DQPYPIDDNQVAEDNYKALQSFFKKFPNFTQNEFFIFGESYGGIYAPTLSLHVATGEA--KINFKGFAVGNGLSSFALNDQSLIYFGYYHGLFGEDLWRDLNINCC----NKSNCNFYNSSSETCQTMVNVAFNIVYETGLNEYALYLDC------------------EGGQRFH--RGYEFAMRHLFKMFKKQ----LHTYKVTPTPSLGGVP-PCINSTAQTNWLNRGDVRKALHIPDVLPLWDICSDAVGEKYKTLYSTVKDVYQKLLSLGLRSL-VYNGDTDMACNFLGDQWFVEDLGIKPTTRYQTWLYED-----QVAGFYQQFANITFLTVKGAGHMVPQWAPGPALQMFRSFITNTS 456          
BLAST of Carboxypeptidase vs. Ensembl Medaka
Match: si:ch211-122f10.4 (lysosomal protective protein [Source:NCBI gene;Acc:101168356])

HSP 1 Score: 355.91 bits (912), Expect = 2.020e-117
Identity = 198/494 (40.08%), Postives = 279/494 (56.48%), Query Frame = 1
Query:   97 YVLISKIVAF------NYQEDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEG-YLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAMDGY--KNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKL---EIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNHNS 1542
            ++++  + AF       Y  DEV  LPG+ F+PN++ +SGYL     + LHYWFV SQ+ P  DP+VLWLNGGPGCSSLDGF++E+GPF V ++G  L +N YSWNKIAN++YLESP+ VG+SYS D     +D+  +  N++ALQ F  KFP +   +F+I GESYGG Y PTLS+ + T      + FKG AVGNGLSS+ LND    +F YYHGL  + LW ++   CC    +   CN   +  E C+T V +A +      LN Y +Y DC                     ++F    G+ +   H     +++    +  +++ G            PC N TA  ++LN   VR ALHIP  +  W +CS +V   YK++Y+ +   Y KL +L   ++ +YNGD DMAC +L D+WF E    K  +  + W Y+D     Q+ GF + F   T LT++G+GHMVP   P PAL MF SF+ + S
Sbjct:    2 HIVLCLLAAFGLGSHAQYAPDEVTELPGMTFKPNYRQWSGYLQAGPGRFLHYWFVTSQEDPATDPVVLWLNGGPGCSSLDGFLSENGPFHVNDDGTTLYENLYSWNKIANMLYLESPAGVGYSYS-DQPYPIDDNQVAEDNYKALQSFFKKFPNFTQNEFFIFGESYGGIYAPTLSLHVATGEA--KINFKGFAVGNGLSSFALNDQSLIYFGYYHGLFGEDLWRDLNINCC----NKSNCNFYNSSSETCQTMVNVAFNIVYETGLNEYALYLDC------------------EGGQRFH--RGYEFAMRHLFKMFKKQ----LHTYKLPGTRTPTPSLGGVPPCINSTAQTNWLNRGDVRKALHIPDVLPLWDICSDAVGEKYKTLYSTVKDVYQKLLSLGLRSL-VYNGDTDMACNFLGDQWFVEDLGIKPTTRYQTWLYED-----QVAGFYQQFANITFLTVKGAGHMVPQWAPGPALQMFRSFITNTS 458          
BLAST of Carboxypeptidase vs. Ensembl Medaka
Match: cpvl (carboxypeptidase vitellogenic like [Source:NCBI gene;Acc:101157084])

HSP 1 Score: 121.709 bits (304), Expect = 2.986e-29
Identity = 77/204 (37.75%), Postives = 107/204 (52.45%), Query Frame = 1
Query:  145 VNILPGLRFQPNFKHYSGYL--NGSDTKKLHYWFVES-QKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDA-NDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVK--FKGIAVGNGLSSWPLNDNGNFHFAYYHGLISD 738
            V  LPG     N K Y+GYL  N +    L +WFV +      K P++LWL GGPG +S+ G   EHGP+ V     +     +W    +V+Y+++P   GFS++ D K  A N D      + AL  F   FP+Y+  +FY TGESY G YVP +S  +   +P   VK  FKG+A+G+GL    +   G   F Y  G+I D
Sbjct:   68 VGNLPG----ANVKSYAGYLTVNKAYNSNLFFWFVPAFMAGQEKAPVLLWLQGGPGGTSMFGLFVEHGPYVVYKNLTIGLRNITWTSRYSVLYIDNPVGTGFSFTDDDKGFAQNQDDVGRDLYSALTQFFQMFPEYQSNEFYATGESYAGKYVPAISYYIHKNNPTAKVKINFKGMAIGDGLCDPEVMLQGYGEFLYQTGMIDD 267          
BLAST of Carboxypeptidase vs. Ensembl Medaka
Match: cpvl (carboxypeptidase vitellogenic like [Source:NCBI gene;Acc:101157084])

HSP 1 Score: 121.709 bits (304), Expect = 3.170e-29
Identity = 77/204 (37.75%), Postives = 107/204 (52.45%), Query Frame = 1
Query:  145 VNILPGLRFQPNFKHYSGYL--NGSDTKKLHYWFVES-QKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDA-NDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVK--FKGIAVGNGLSSWPLNDNGNFHFAYYHGLISD 738
            V  LPG     N K Y+GYL  N +    L +WFV +      K P++LWL GGPG +S+ G   EHGP+ V     +     +W    +V+Y+++P   GFS++ D K  A N D      + AL  F   FP+Y+  +FY TGESY G YVP +S  +   +P   VK  FKG+A+G+GL    +   G   F Y  G+I D
Sbjct:   68 VGNLPG----ANVKSYAGYLTVNKAYNSNLFFWFVPAFMAGQEKAPVLLWLQGGPGGTSMFGLFVEHGPYVVYKNLTIGLRNITWTSRYSVLYIDNPVGTGFSFTDDDKGFAQNQDDVGRDLYSALTQFFQMFPEYQSNEFYATGESYAGKYVPAISYYIHKNNPTAKVKINFKGMAIGDGLCDPEVMLQGYGEFLYQTGMIDD 267          
BLAST of Carboxypeptidase vs. Planmine SMEST
Match: SMESG000029164.1 (SMESG000029164.1)

HSP 1 Score: 1001.12 bits (2587), Expect = 0.000e+0
Identity = 482/484 (99.59%), Postives = 482/484 (99.59%), Query Frame = 1
Query:   94 FYVLISKIVAFNYQEDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAMDGYKNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNHNSL 1545
            F VLISKIVAFNYQEDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAMDGY NLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNHNSL
Sbjct:    7 FAVLISKIVAFNYQEDEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAMDGYNNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNHNSL 490          
BLAST of Carboxypeptidase vs. Planmine SMEST
Match: SMESG000029163.1 (SMESG000029163.1)

HSP 1 Score: 593.193 bits (1528), Expect = 0.000e+0
Identity = 284/467 (60.81%), Postives = 347/467 (74.30%), Query Frame = 1
Query:  139 DEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAMDGYKNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNHN 1539
            DEV ILPGLRFQP FKHYSG LNGSDT+ LHYWFVESQ S  +DPLVLWLNGGPGCSSL G +TE+GPFQVT  GYLI NPYSWNK ANVIYLESPSCVGFSYSTDGKCDA+DD+T+ LNF AL+HFLIKFPQYK R FYITGESY G Y+PTL+ ++ + +P LAV+FKGI +GNGLSS  +N NG F+FAYYHGL+SD  W+EI+ LCC   ++   C+I GNK+  C+ KV    + +  +N YNIY  CY PS+  +Q IWS+ ++ SNY K  I+NGWN + + R+ ++RE +             +++ + +PC ++ A+  Y N P VR ALH+P  V  W  CS SVN  Y   Y NMT+QY  LF L++F IWIYNGDVD+ C YLA+EWFFE F QK++SPRKPWFY D    QQIGGF KV++KF LLT++GSGHMVPTDKP PA H+FESF+  N
Sbjct:   23 DEVIILPGLRFQPTFKHYSGTLNGSDTRMLHYWFVESQNSSEEDPLVLWLNGGPGCSSLMGLLTENGPFQVTPPGYLIHNPYSWNKYANVIYLESPSCVGFSYSTDGKCDASDDSTANLNFNALKHFLIKFPQYKNRKFYITGESYAGIYIPTLADKITSSNPRLAVQFKGILIGNGLSSRAINHNGAFYFAYYHGLMSDRTWTEIVHLCCQK-KNPTHCDIIGNKDPICQAKVLQVANSFAGINPYNIYDACYKPSNDSNQNIWSKFDVKSNYLKLLIINGWNSNLNGRLMEIREMFNG-----------HQHPIVLPCVDNRAATKYFNLPLVRLALHVPDHVGKWEDCSFSVNTKYIKTYENMTNQYKNLFQLKDFKIWIYNGDVDLVCSYLAEEWFFEMFNQKVVSPRKPWFYTDHDQSQQIGGFFKVWEKFVLLTVKGSGHMVPTDKPKPAFHIFESFIKGN 477          
BLAST of Carboxypeptidase vs. Planmine SMEST
Match: SMESG000029163.1 (SMESG000029163.1)

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 284/467 (60.81%), Postives = 347/467 (74.30%), Query Frame = 1
Query:  139 DEVNILPGLRFQPNFKHYSGYLNGSDTKKLHYWFVESQKSPTKDPLVLWLNGGPGCSSLDGFITEHGPFQVTNEGYLIDNPYSWNKIANVIYLESPSCVGFSYSTDGKCDANDDTTSLLNFRALQHFLIKFPQYKGRDFYITGESYGGFYVPTLSVRLVTEHPGLAVKFKGIAVGNGLSSWPLNDNGNFHFAYYHGLISDSLWSEILSLCCAPGEDSRKCNITGNKEEKCKTKVKLAMDGYKNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDPDHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRFALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGDVDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFTLLTIRGSGHMVPTDKPIPALHMFESFLNHN 1539
            DEV ILPGLRFQP FKHYSG LNGSDT+ LHYWFVESQ S  +DPLVLWLNGGPGCSSL G +TE+GPFQVT  GYLI NPYSWNK ANVIYLESPSCVGFSYSTDGKCDA+DD+T+ LNF AL+HFLIKFPQYK R FYITGESY G Y+PTL+ ++ + +P LAV+FKGI +GNGLSS  +N NG F+FAYYHGL+SD  W+EI+ LCC   ++   C+I GNK+  C+ KV    + +  +N YNIY  CY PS+  +Q IWS+ ++ SNY K  I+NGWN + + R+ ++RE +             +++ + +PC ++ A+  Y N P VR ALH+P  V  W  CS SVN  Y   Y NMT+QY  LF L++F IWIYNGDVD+ C YLA+EWFFE F QK++SPRKPWFY D    QQIGGF KV++KF LLT++GSGHMVPTDKP PA H+FESF+  N
Sbjct:   18 DEVIILPGLRFQPTFKHYSGTLNGSDTRMLHYWFVESQNSSEEDPLVLWLNGGPGCSSLMGLLTENGPFQVTPPGYLIHNPYSWNKYANVIYLESPSCVGFSYSTDGKCDASDDSTANLNFNALKHFLIKFPQYKNRKFYITGESYAGIYIPTLADKITSSNPRLAVQFKGILIGNGLSSRAINHNGAFYFAYYHGLMSDRTWTEIVHLCCQK-KNPTHCDIIGNKDPICQAKVLQVANSFAGINPYNIYDACYKPSNDSNQNIWSKFDVKSNYLKLLIINGWNSNLNGRLMEIREMFNG-----------HQHPIVLPCVDNRAATKYFNLPLVRLALHVPDHVGKWEDCSFSVNTKYIKTYENMTNQYKNLFQLKDFKIWIYNGDVDLVCSYLAEEWFFEMFNQKVVSPRKPWFYTDHDQSQQIGGFFKVWEKFVLLTVKGSGHMVPTDKPKPAFHIFESFIKGN 472          
The following BLAST results are available for this feature:
BLAST of Carboxypeptidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CTSA8.806e-14447.58cathepsin A [Source:HGNC Symbol;Acc:HGNC:9251][more]
CTSA8.806e-14447.58cathepsin A [Source:HGNC Symbol;Acc:HGNC:9251][more]
CTSA8.806e-14447.58cathepsin A [Source:HGNC Symbol;Acc:HGNC:9251][more]
CTSA1.040e-14347.58cathepsin A [Source:HGNC Symbol;Acc:HGNC:9251][more]
CTSA1.222e-13445.99cathepsin A [Source:HGNC Symbol;Acc:HGNC:9251][more]
back to top
BLAST of Carboxypeptidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F41C3.59.048e-11139.12Uncharacterized serine carboxypeptidase F41C3.5 [... [more]
F41C3.59.048e-11139.12Uncharacterized serine carboxypeptidase F41C3.5 [... [more]
F41C3.59.048e-11139.12Uncharacterized serine carboxypeptidase F41C3.5 [... [more]
ctsa-12.564e-10540.13Uncharacterized serine carboxypeptidase ctsa-1 [S... [more]
ctsa-12.564e-10540.13Uncharacterized serine carboxypeptidase ctsa-1 [S... [more]
back to top
BLAST of Carboxypeptidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG45723.564e-2535.26gene:FBgn0038738 transcript:FBtr0302327[more]
CG45723.564e-2535.26gene:FBgn0038738 transcript:FBtr0083861[more]
CG45723.564e-2535.26gene:FBgn0038738 transcript:FBtr0083860[more]
CG318235.043e-1427.78gene:FBgn0051823 transcript:FBtr0080810[more]
CG318211.395e-1232.16gene:FBgn0051821 transcript:FBtr0080809[more]
back to top
BLAST of Carboxypeptidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctsa2.980e-14547.97cathepsin A [Source:ZFIN;Acc:ZDB-GENE-030131-537][more]
si:ch211-122f10.46.482e-12242.33si:ch211-122f10.4 [Source:ZFIN;Acc:ZDB-GENE-140106... [more]
cpvl1.142e-2836.45carboxypeptidase vitellogenic like [Source:ZFIN;Ac... [more]
cpvl1.142e-2836.45carboxypeptidase vitellogenic like [Source:ZFIN;Ac... [more]
ctsa1.354e-1458.49cathepsin A [Source:ZFIN;Acc:ZDB-GENE-030131-537][more]
back to top
BLAST of Carboxypeptidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct79.840e-14346.60chaperonin containing TCP1 subunit 7 [Source:Xenba... [more]
cct75.074e-14247.55chaperonin containing TCP1 subunit 7 [Source:Xenba... [more]
cct72.174e-14146.50chaperonin containing TCP1 subunit 7 [Source:Xenba... [more]
cct73.855e-14145.34chaperonin containing TCP1 subunit 7 [Source:Xenba... [more]
cct74.741e-14145.34chaperonin containing TCP1 subunit 7 [Source:Xenba... [more]
back to top
BLAST of Carboxypeptidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ctsa8.716e-13845.44cathepsin A [Source:MGI Symbol;Acc:MGI:97748][more]
Ctsa1.156e-13745.44cathepsin A [Source:MGI Symbol;Acc:MGI:97748][more]
Ctsa1.123e-6655.32cathepsin A [Source:MGI Symbol;Acc:MGI:97748][more]
Ctsa1.890e-5543.10cathepsin A [Source:MGI Symbol;Acc:MGI:97748][more]
Cpvl1.378e-2933.49carboxypeptidase, vitellogenic-like [Source:MGI Sy... [more]
back to top
BLAST of Carboxypeptidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3MI05|PPGB_BOVIN4.827e-14446.76Lysosomal protective protein OS=Bos taurus OX=9913... [more]
sp|P10619|PPGB_HUMAN4.229e-14347.58Lysosomal protective protein OS=Homo sapiens OX=96... [more]
sp|P16675|PPGB_MOUSE8.086e-13745.44Lysosomal protective protein OS=Mus musculus OX=10... [more]
sp|P52717|CTS11_CAEEL1.151e-10939.12Serine carboxypeptidase ctsa-1.1 OS=Caenorhabditis... [more]
sp|Q09991|CTS41_CAEEL3.262e-10440.13Serine carboxypeptidase ctsa-4.1 OS=Caenorhabditis... [more]
back to top
BLAST of Carboxypeptidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F8WPA71.616e-14646.68Carboxypeptidase OS=Oplegnathus fasciatus OX=16313... [more]
A0A3Q1C1Y62.387e-14647.05Carboxypeptidase OS=Amphiprion ocellaris OX=80972 ... [more]
V9KI554.251e-14648.23Carboxypeptidase OS=Callorhinchus milii OX=7868 PE... [more]
A0A3Q1GFW45.274e-14647.57Carboxypeptidase OS=Acanthochromis polyacanthus OX... [more]
A0A4W3J6U18.781e-14648.07Carboxypeptidase OS=Callorhinchus milii OX=7868 PE... [more]
back to top
BLAST of Carboxypeptidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch211-122f10.46.072e-12843.50lysosomal protective protein-like [Source:NCBI gen... [more]
ctsa2.503e-11240.81cathepsin A [Source:ZFIN;Acc:ZDB-GENE-030131-537][more]
scpep12.258e-1329.95serine carboxypeptidase 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Carboxypeptidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ctsa9.825e-13745.01cathepsin A [Source:ZFIN;Acc:ZDB-GENE-030131-537][more]
ctsa1.122e-13046.00cathepsin A [Source:ZFIN;Acc:ZDB-GENE-030131-537][more]
si:ch211-122f10.42.512e-12343.97si:ch211-122f10.4 [Source:ZFIN;Acc:ZDB-GENE-140106... [more]
ctsa3.838e-12144.10cathepsin A [Source:ZFIN;Acc:ZDB-GENE-030131-537][more]
back to top
BLAST of Carboxypeptidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
YBR139W_mRNA6.433e-4929.24Putative serine type carboxypeptidase; role in phy... [more]
PRC17.188e-4428.60Vacuolar carboxypeptidase Y (proteinase C, CPY); b... [more]
KEX16.117e-2130.05Cell death protease essential for hypochlorite-ind... [more]
back to top
BLAST of Carboxypeptidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO317221.101e-1328.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Carboxypeptidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctsa3.386e-14347.23cathepsin A [Source:NCBI gene;Acc:101173697][more]
si:ch211-122f10.45.307e-11840.33lysosomal protective protein [Source:NCBI gene;Acc... [more]
si:ch211-122f10.42.020e-11740.08lysosomal protective protein [Source:NCBI gene;Acc... [more]
cpvl2.986e-2937.75carboxypeptidase vitellogenic like [Source:NCBI ge... [more]
cpvl3.170e-2937.75carboxypeptidase vitellogenic like [Source:NCBI ge... [more]
back to top
BLAST of Carboxypeptidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000029164.10.000e+099.59SMESG000029164.1[more]
SMESG000029163.10.000e+060.81SMESG000029163.1[more]
SMESG000029163.10.000e+060.81SMESG000029163.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004147 ID=SMED30004147|Name=Carboxypeptidase|organism=Schmidtea mediterranea sexual|type=transcript|length=1649bp
GTAAATTTAATTTTCGTTTAAATAGTTTATTTCATTCTATGACACCTATT
TATTCATGTCCAAAGTTCATTTATAAATCGTATATTATGAGGATTCTACG
TGTTAATATCAAAAATAGTAGCATTTAACTACCAAGAAGATGAAGTTAAT
ATTTTACCGGGCTTGAGATTTCAGCCTAATTTTAAACACTATTCTGGTTA
TTTAAATGGATCTGATACAAAAAAATTACATTATTGGTTTGTGGAAAGTC
AAAAGTCTCCGACAAAGGATCCATTAGTGTTGTGGCTTAATGGCGGTCCT
GGCTGCAGTTCATTAGACGGATTTATTACTGAACATGGCCCATTTCAAGT
AACAAATGAGGGATATCTTATAGATAATCCATATAGTTGGAACAAAATTG
CTAATGTTATTTATCTTGAATCTCCATCGTGCGTTGGATTTTCTTATTCA
ACTGATGGTAAATGTGATGCAAATGATGATACTACTTCGCTGTTAAATTT
CAGAGCCTTACAACATTTTCTGATTAAATTTCCTCAATACAAAGGCCGTG
ATTTCTACATAACGGGTGAAAGTTATGGGGGATTCTACGTGCCAACACTA
TCTGTACGACTGGTCACTGAACATCCAGGATTGGCTGTTAAATTTAAGGG
CATTGCTGTTGGTAATGGGCTTTCAAGTTGGCCACTCAATGACAATGGGA
ATTTCCATTTCGCTTACTATCACGGACTTATCAGTGACAGTCTTTGGTCT
GAAATTCTATCACTCTGCTGTGCACCTGGTGAAGATTCACGCAAATGTAA
TATAACTGGCAATAAAGAAGAAAAATGTAAAACAAAGGTGAAATTAGCAA
TGGATGGTTACAAAAATTTGAATGTTTACAACATCTATTCTGATTGCTAT
ACTCCATCAAGCGCTATTGACCAAGCTATTTGGAGCCAACTGAATATCTT
CTCCAATTATGAGAAATTCCAGATTTTGAACGGTTGGAATTACGATCCAG
ATCATAGGATTTCAAAGCTGCGGGAAAAATACATAAATTTAATGTCAAAA
TTCCAAGTAATGGGATTAGTTAATAAGAATAAATTAGAAATTCCATGTTC
AAATGATACTGCATCGGCTGATTATTTGAACAATCCGAAAGTTCGATTTG
CTTTACATATTCCAAAATTTGTTCAAGACTGGAGTGTTTGTTCTTCTTCT
GTTAATTTCAATTACAAAAGTATTTATACCAACATGACTCATCAATATAA
TAAACTTTTTAATTTGCAAAATTTTACGATCTGGATTTACAATGGAGATG
TAGATATGGCTTGTTGTTATTTGGCTGACGAATGGTTTTTTGAAAGCTTC
CAGCAAAAAATAATTTCACCGAGAAAGCCTTGGTTTTATAAAGATCCACA
TAGTGGCCAACAGATAGGAGGATTCGTCAAAGTTTTCGATAAATTTACTC
TACTAACAATAAGAGGGTCAGGTCACATGGTTCCAACGGATAAGCCGATA
CCTGCTTTGCACATGTTCGAGTCTTTCCTTAATCATAATTCATTGTAGAA
TTTCCAAAGGATTAATTGTGATTTGATTGGTTATTTTCTTATAAAATTTC
AATATTGCGTTTGTTCATTATTTTGACCATATTAGGATGTTTAATGTGC
back to top

protein sequence of SMED30004147-orf-1

>SMED30004147-orf-1 ID=SMED30004147-orf-1|Name=SMED30004147-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=233bp
MDGYKNLNVYNIYSDCYTPSSAIDQAIWSQLNIFSNYEKFQILNGWNYDP
DHRISKLREKYINLMSKFQVMGLVNKNKLEIPCSNDTASADYLNNPKVRF
ALHIPKFVQDWSVCSSSVNFNYKSIYTNMTHQYNKLFNLQNFTIWIYNGD
VDMACCYLADEWFFESFQQKIISPRKPWFYKDPHSGQQIGGFVKVFDKFT
LLTIRGSGHMVPTDKPIPALHMFESFLNHNSL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: molecular function
TermDefinition
GO:0004185serine-type carboxypeptidase activity
GO:0004180carboxypeptidase activity
GO:0008233peptidase activity
GO:0016787hydrolase activity
Vocabulary: INTERPRO
TermDefinition
IPR001563Peptidase_S10
IPR029058AB_hydrolase
IPR018202Ser_caboxypep_ser_AS
IPR033124Ser_caboxypep_his_AS
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001563Peptidase S10, serine carboxypeptidasePFAMPF00450Peptidase_S10coord: 4..228
e-value: 4.8E-43
score: 148.1
IPR001563Peptidase S10, serine carboxypeptidasePANTHERPTHR11802SERINE PROTEASE FAMILY S10 SERINE CARBOXYPEPTIDASEcoord: 6..229
NoneNo IPR availableGENE3DG3DSA:3.40.50.12670coord: 79..232
e-value: 7.5E-54
score: 183.8
NoneNo IPR availablePANTHERPTHR11802:SF242LYSOSOMAL PROTECTIVE PROTEINcoord: 6..229
IPR033124Serine carboxypeptidases, histidine active sitePROSITEPS00560CARBOXYPEPT_SER_HIScoord: 199..216
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 6..229