3-oxoacyl-[acyl-carrier-protein] synthase

Overview
Name3-oxoacyl-[acyl-carrier-protein] synthase
Smed IDSMED30004140
Length (bp)1379
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 3-oxoacyl-[acyl-carrier-protein] synthase (SMED30004140) t-SNE clustered cells

Violin plots show distribution of expression levels for 3-oxoacyl-[acyl-carrier-protein] synthase (SMED30004140) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 3-oxoacyl-[acyl-carrier-protein] synthase (SMED30004140) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 3-oxoacyl-[acyl-carrier-protein] synthase (SMED30004140) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004140

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30004140SMESG000069530.1 SMESG000066274.1 SMESG000062787.1 SMESG000050992.1 SMESG000041908.1 SMESG000020877.1 SMESG000005064.1 SMESG000002444.1 SMESG000000320.1 SMESG000055828.1 SMESG000014398.1 SMESG000012251.1 SMESG000009925.1 Contig44GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30004140SMESG000066332.1 Contig44GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
epidermisSMED30004140SMESG000066335.1 dd_Smed_v4_7826_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Human
Match: OXSM (3-oxoacyl-ACP synthase, mitochondrial [Source:HGNC Symbol;Acc:HGNC:26063])

HSP 1 Score: 216.853 bits (551), Expect = 1.006e-64
Identity = 120/311 (38.59%), Postives = 186/311 (59.81%), Query Frame = 1
Query:   25 RVVVTGIGVICSLGNTSKDVWSKLILGHSE-VNILSDLYAHLPCRIASEI--NEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIG---FDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            RVV+TGIG++  LG  +  VW +LI G S  V+++ + Y  +PC +A+ +    D  Q  ++  ++ ++ K+MS  +++ + A+  AM ++G+      + +   GV++G+G    + V  +  + Q K     Y+ + P+ + + L NM A  + +RYKL+GP+ +V+TAC  G HA+GD+FR I  G+AD M+AGG ++ ISP S+A FSR RAL T  N DP  A RPF   R GFVM EGA  LVLE   HAV+       E++G+G SGD   + APD  G+GA R M AA++ A + PE   +++
Sbjct:   43 RVVITGIGLVTPLGVGTHLVWDRLIGGESGIVSLVGEEYKSIPCSVAAYVPRGSDEGQFNEQNFVSKSDIKSMSSPTIMAIGAAELAMKDSGWHPQSEADQVAT-GVAIGMGMIPLEVVSETALNFQTKG----YNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAGFSRARALST--NSDPKLACRPFHPKRDGFVMGEGAAVLVLEEYEHAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQPEEISYIN 346          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Human
Match: OXSM (3-oxoacyl-ACP synthase, mitochondrial [Source:HGNC Symbol;Acc:HGNC:26063])

HSP 1 Score: 110.923 bits (276), Expect = 2.093e-27
Identity = 64/194 (32.99%), Postives = 114/194 (58.76%), Query Frame = 1
Query:   25 RVVVTGIGVICSLGNTSKDVWSKLILGHSE-VNILSDLYAHLPCRIASEI--NEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIG---FDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFM 588
            RVV+TGIG++  LG  +  VW +LI G S  V+++ + Y  +PC +A+ +    D  Q  ++  ++ ++ K+MS  +++ + A+  AM ++G+      + +   GV++G+G    + V  +  + Q K     Y+ + P+ + + L NM A  + +RYKL+GP+ +V+TAC  G HA+GD+FR I  G+AD M
Sbjct:   43 RVVITGIGLVTPLGVGTHLVWDRLIGGESGIVSLVGEEYKSIPCSVAAYVPRGSDEGQFNEQNFVSKSDIKSMSSPTIMAIGAAELAMKDSGWHPQSEADQVAT-GVAIGMGMIPLEVVSETALNFQTKG----YNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDSFRFIAHGDADVM 231          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Human
Match: OXSM (3-oxoacyl-ACP synthase, mitochondrial [Source:HGNC Symbol;Acc:HGNC:26063])

HSP 1 Score: 108.227 bits (269), Expect = 2.843e-25
Identity = 63/196 (32.14%), Postives = 114/196 (58.16%), Query Frame = 1
Query:   25 RVVVTGIGVICSLGNTSKDVWSKLILGHSE-VNILSDLYAHLPCRIASEI--NEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIG---FDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLA 594
            RVV+TGIG++  LG  +  VW +LI G S  V+++ + Y  +PC +A+ +    D  Q  ++  ++ ++ K+MS  +++ + A+  AM ++G+      + +   GV++G+G    + V  +  + Q K     Y+ + P+ + + L NM A  + +RYKL+GP+ +V+TAC  G HA+GD+FR I  G+A  + A
Sbjct:   43 RVVITGIGLVTPLGVGTHLVWDRLIGGESGIVSLVGEEYKSIPCSVAAYVPRGSDEGQFNEQNFVSKSDIKSMSSPTIMAIGAAELAMKDSGWHPQSEADQVAT-GVAIGMGMIPLEVVSETALNFQTKG----YNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDSFRFIAHGDAGHITA 233          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Human
Match: OXSM (3-oxoacyl-ACP synthase, mitochondrial [Source:HGNC Symbol;Acc:HGNC:26063])

HSP 1 Score: 100.523 bits (249), Expect = 8.983e-24
Identity = 58/183 (31.69%), Postives = 107/183 (58.47%), Query Frame = 1
Query:   25 RVVVTGIGVICSLGNTSKDVWSKLILGHSE-VNILSDLYAHLPCRIASEI--NEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIG---FDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAF 555
            RVV+TGIG++  LG  +  VW +LI G S  V+++ + Y  +PC +A+ +    D  Q  ++  ++ ++ K+MS  +++ + A+  AM ++G+      + +   GV++G+G    + V  +  + Q K     Y+ + P+ + + L NM A  + +RYKL+GP+ +V+TAC  G HA+GD+F
Sbjct:   43 RVVITGIGLVTPLGVGTHLVWDRLIGGESGIVSLVGEEYKSIPCSVAAYVPRGSDEGQFNEQNFVSKSDIKSMSSPTIMAIGAAELAMKDSGWHPQSEADQVAT-GVAIGMGMIPLEVVSETALNFQTKG----YNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDSF 220          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Human
Match: FASN (fatty acid synthase [Source:HGNC Symbol;Acc:HGNC:3594])

HSP 1 Score: 72.0182 bits (175), Expect = 1.422e-12
Identity = 64/249 (25.70%), Postives = 118/249 (47.39%), Query Frame = 1
Query:  214 PNEFKTMSRSSVLMMKASSEAMSNAGFT-DNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYS---LVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVDTGG 948
            P +  TM     L+++ + EA+ + G   D+L        G   G+ + GV  S  S  +     P +++G Y++      M A  L   +  RGPS +++TAC++ L A+ +A+++I  G+    + GG+   + P +   F R+  L       P    + FDT  +G+  +EG  A++L   +     AR     I+  G + DG+    +  P  +GD   + +++  +SA + PE FE+++  G
Sbjct:   69 PKQAHTMDPQLRLLLEVTYEAIVDGGINPDSLR-------GTHTGV-WVGVSGSETSEALSRD--PETLVG-YSMVGCQRAMMANRLSFFFDFRGPSIALDTACSSSLMALQNAYQAIHSGQCPAAIVGGINVLLKPNTSVQFLRLGML------SPEGTCKAFDTAGNGYCRSEGVVAVLLTKKSL----ARRVYATILNAGTNTDGFKEQGVTFP--SGDIQEQLIRSLYQSAGVAPESFEYIEAHG 294          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Celegans
Match: F10G8.9 (pep chromosome:WBcel235:I:10048087:10050770:1 gene:WBGene00008667.1 transcript:F10G8.9b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G8.9)

HSP 1 Score: 161.384 bits (407), Expect = 9.247e-45
Identity = 111/309 (35.92%), Postives = 171/309 (55.34%), Query Frame = 1
Query:   19 MNRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSDLYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQ-VKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHA-VKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            M+RVV+TG+G I   G T   + + L  G S +    ++   +   +  E  ED +   Q+        + MS++S+ ++ AS EA+  A   D    E L    V++G     + +  E+ Q V  G      + PY + R L N+PA ++ ++YK+RG   S +TACA GLH IG++FRSI  G++   LAG VE +++P ++A F R+RAL     D PN  SRPFD  R+GFVM+EG G + +E L  A  +GA++ L E+VG+G S D Y +  PD +  GA  +M  AI +A + P+   +V+
Sbjct:    1 MHRVVITGMGAISPFGVTVNALRNGLNEGRSGLK-YDEILKFVVGAVPGERVEDRWSTGQQ--------REMSKASMFVLAASEEALKQAKAEDVDHNETL----VNIGTCMSDLEHIGETAQKVSEGQ--SRRVSPYFVPRILNNLPAGYVAMKYKMRGGVESTSTACATGLHCIGNSFRSIRYGDSRRALAGAVECALNPIALAGFDRMRAL--ARGDQPN-ISRPFDKKRAGFVMSEGVGLVFMERLEDAQARGAQI-LAEVVGYGISSDCYHISTPDPSAIGAVLSMNRAIGNAHLEPKDIGYVN 290          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Celegans
Match: F10G8.9 (pep chromosome:WBcel235:I:10049055:10050703:1 gene:WBGene00008667.1 transcript:F10G8.9a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G8.9)

HSP 1 Score: 120.939 bits (302), Expect = 3.419e-31
Identity = 68/152 (44.74%), Postives = 97/152 (63.82%), Query Frame = 1
Query:  487 LRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHA-VKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            +RG   S +TACA GLH IG++FRSI  G++   LAG VE +++P ++A F R+RAL     D PN  SRPFD  R+GFVM+EG G + +E L  A  +GA++ L E+VG+G S D Y +  PD +  GA  +M  AI +A + P+   +V+
Sbjct:    1 MRGGVESTSTACATGLHCIGNSFRSIRYGDSRRALAGAVECALNPIALAGFDRMRAL--ARGDQPN-ISRPFDKKRAGFVMSEGVGLVFMERLEDAQARGAQI-LAEVVGYGISSDCYHISTPDPSAIGAVLSMNRAIGNAHLEPKDIGYVN 148          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Celegans
Match: fasn-1 (Fatty Acid SyNthase [Source:UniProtKB/TrEMBL;Acc:P91871])

HSP 1 Score: 66.6254 bits (161), Expect = 2.644e-11
Identity = 66/250 (26.40%), Postives = 110/250 (44.00%), Query Frame = 1
Query:  208 LTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYS---LVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVDTGG 948
            +TP +   M     L+++AS EAM +AG      +   D  G   G+ F G   S  S  +     P +V G Y LT  + +M +  +   + L+GPS SV+TAC++ L A+  A  SI  G+ D  +  G   +++P +   F R+  L  K       + R FD    G+   EG  A+ ++      K A+     +V    + DG+    +  P  +G+   + ++     A I P    +V+  G
Sbjct:  103 VTPKQANFMDPQVRLLLEASWEAMVDAG------INPTDLRGSKTGV-FVGCSASETSGMLTQD--PDTVTG-YTLTGCVRSMFSNRISYTFDLQGPSFSVDTACSSSLLALQLAVDSIRQGQCDAAIVAGAHLTLTPTAALQFLRLGMLTDK------GSCRSFDESGDGYCRTEGVAAIFIQR----KKKAQRLYATVVHAKSNTDGHKEHGITFP--SGERQAQLLQEVYSEAGIDPNSVYYVEAHG 330          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Celegans
Match: pks-1 (PolyKetide Synthase [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSM6])

HSP 1 Score: 53.1434 bits (126), Expect = 3.914e-7
Identity = 37/129 (28.68%), Postives = 59/129 (45.74%), Query Frame = 1
Query:  487 LRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGY---SLVAPDTNG 864
            L+G + SV +AC+  L A+ +A +SI+ G  D+ L G    +    +++ F   +    K     +   RPFD D  G V   G G  VL+  + A+         I  F  + DG+   S +AP+  G
Sbjct: 5389 LKGEAVSVYSACSTALVAVANAVKSIQSGSMDYALVGAASIAEVSGALSGFDDQK----KTMFSKSGVCRPFDKDSEGIVRGSGVGCFVLKRYSQALLDNDNVHFVIKDFAINNDGHSRASFMAPNPAG 5513          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Fly
Match: CG12170 (gene:FBgn0037356 transcript:FBtr0078709)

HSP 1 Score: 253.447 bits (646), Expect = 2.502e-79
Identity = 143/308 (46.43%), Postives = 193/308 (62.66%), Query Frame = 1
Query:   25 RVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSDLYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFT-DNLSVENLDRFGVSVGIG-FDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHA-VKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            RVVVTG G +  LGN   D W +++ G S ++ LS  +  LPC++A++I  +N QL Q   LT ++ K MS ++ L + A+ EA+S        LS E L+RFGV VG+G FD        +Q++ GY   + + P+ + R L +M   H+ +R+ LRGP+ SV+TACA G HA+GDA R I  G+AD MLAG  EA I P SIA F R+RAL T +ND+P  ASRPFD  R GFVM EGA  L+LE L HA  +GA + L EI+G+G SGD Y + +P  +G GA  AMK AI+ A I PE   +V+
Sbjct:   25 RVVVTGSGAVTPLGNNGPDSWRRILAGESAISRLSAEFKGLPCQVAAQIPRENLQLDQH--LTKSDIKLMSPATQLAVLAAEEALSTGKLCPKQLSEEELERFGVCVGMGMFDLAEVYGAWNQLQRGY---NRVSPFFVPRLLPSMACGHISMRHGLRGPNHSVSTACATGAHALGDAMRFIRSGDADLMLAGSGEACIDPLSIAGFCRLRALSTAFNDNPAVASRPFDKSRDGFVMGEGAAVLLLEELEHARARGAPI-LAEILGYGLSGDAYHITSPSDDGAGATLAMKRAIQDAGIAPEDVTYVN 326          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Fly
Match: FASN3 (gene:FBgn0040001 transcript:FBtr0305959)

HSP 1 Score: 61.2326 bits (147), Expect = 1.407e-9
Identity = 32/96 (33.33%), Postives = 51/96 (53.12%), Query Frame = 1
Query:  487 LRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHA 774
            L GPS  ++TAC++ ++A+ +AF +I  GE D  + GG    + P+    F+R+  L       P+   RPFD + SG+  +E    L L+   HA
Sbjct:  167 LEGPSFLLDTACSSSMYALDNAFSAIRNGEIDAAIIGGSNLLLHPFVTLQFARLGVLA------PDGFCRPFDKNASGYTRSETINCLFLQKKKHA 256          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Fly
Match: FASN1 (gene:FBgn0283427 transcript:FBtr0335387)

HSP 1 Score: 59.3066 bits (142), Expect = 5.943e-9
Identity = 61/256 (23.83%), Postives = 109/256 (42.58%), Query Frame = 1
Query:  196 QKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINS-IESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIV----GFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVDTGG 948
            Q +C+ P     + R   ++++ + EA+ +AG   +      D  G   G+ + GV NS  E H   +       +  Y LT     M A  +   +  +GPS S++TAC++ L+A+  AF  +  G+ D  L  G    + P     F R+  L       P+ + + FD   +G+V ++G   L+L+  T A +     ++ +     GF + G  Y +      G    R ++   E   + P    +V+  G
Sbjct:  211 QAECMDP-----LLR---MLLELTHEAIIDAGLNPS------DLRGSRTGV-YIGVSNSETEQHWCSDA----DRVNGYGLTGCARAMFANRISFTFDFKGPSYSIDTACSSSLYALEQAFSDMREGKVDNALVAGAGLILKPTMSLQFKRLNML------SPDGSCKAFDESGNGYVRSDGCVVLLLQR-TSAARRVYASILNVRTNTDGFKEQGITYPI------GKMQNRLIRETYEEIGLNPADVVYVEAHG 434          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Fly
Match: FASN1 (gene:FBgn0283427 transcript:FBtr0077659)

HSP 1 Score: 59.3066 bits (142), Expect = 6.797e-9
Identity = 61/256 (23.83%), Postives = 109/256 (42.58%), Query Frame = 1
Query:  196 QKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINS-IESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIV----GFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVDTGG 948
            Q +C+ P     + R   ++++ + EA+ +AG   +      D  G   G+ + GV NS  E H   +       +  Y LT     M A  +   +  +GPS S++TAC++ L+A+  AF  +  G+ D  L  G    + P     F R+  L       P+ + + FD   +G+V ++G   L+L+  T A +     ++ +     GF + G  Y +      G    R ++   E   + P    +V+  G
Sbjct:  109 QAECMDP-----LLR---MLLELTHEAIIDAGLNPS------DLRGSRTGV-YIGVSNSETEQHWCSDA----DRVNGYGLTGCARAMFANRISFTFDFKGPSYSIDTACSSSLYALEQAFSDMREGKVDNALVAGAGLILKPTMSLQFKRLNML------SPDGSCKAFDESGNGYVRSDGCVVLLLQR-TSAARRVYASILNVRTNTDGFKEQGITYPI------GKMQNRLIRETYEEIGLNPADVVYVEAHG 332          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Fly
Match: FASN2 (gene:FBgn0042627 transcript:FBtr0077657)

HSP 1 Score: 53.5286 bits (127), Expect = 4.151e-7
Identity = 54/218 (24.77%), Postives = 95/218 (43.58%), Query Frame = 1
Query:  145 LPCRIAS-------EINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIES-HQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHA 774
            LP R+A        + ++  F + QKQ       + M     ++++ + EA+ +AG   N       R GV +G+ F      +E+ H++ N  +  S I  Y LT     M A  +   +  +GPS  V+TAC++ L A+  AF  +  G  D+ L  GV   + P     F R+  +        + + + FD   +G+  A+    ++L+    A
Sbjct:   62 LPERMAKMKDSDLEKFDDKFFSVHQKQA------ELMDPCMRMLLELTHEAIIDAGI--NPVQLRGSRTGVYIGLSF------VETEHEIPN--MEPSSINGYCLTGCARAMFANRISYTFDFKGPSFIVDTACSSSLVALNHAFADMRAGRCDYALVAGVNLILKPIFALQFLRLGIV------SHDGSCKTFDAAANGYARADTCAVVLLQRRKEA 257          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Zebrafish
Match: oxsm (3-oxoacyl-ACP synthase, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-170215-2])

HSP 1 Score: 228.794 bits (582), Expect = 1.511e-69
Identity = 126/312 (40.38%), Postives = 192/312 (61.54%), Query Frame = 1
Query:   25 RVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILS-DLYAHLPCRIASEI--NEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIG---FDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAV-KGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            RVV+TGIG++C LG  S   W +LI G S +  L+ + Y  +PC++A+ +   E      Q+   +  E  +MS+++V+ + A++ A+++ G+    S E  +  GV+VG+G    + + N+  + Q +     YS + P+ + R L NM A H+ +++KL+GP+ +V+TAC  G HA+GDA R I  G+A+ MLAGG EA I P SIA F+R RAL T +N +P  +SRPF  DR GFVM EGA  LVLE  + A  +GAR+   EI+G+G SGD   + AP  +GDGA+R M AA+ +A + P    +++
Sbjct:   36 RVVITGIGLVCPLGTGSALPWQRLIGGESGLVALNGEEYKSVPCKVAARVPRGEKPGDFTQESFASKAEINSMSQATVMAIGAANLALNDCGWYPR-SPEEQESTGVAVGMGMVPLEEIYNTASAFQTRG----YSKVSPFFVPRILVNMAAGHISIKHKLKGPNHAVSTACTTGAHAVGDAARFISHGDAEVMLAGGTEACIGPLSIAGFARARALSTSWNHEPRLSSRPFHPDREGFVMGEGAAVLVLEEFSRAQRRGARV-YAEIMGYGLSGDASHITAPTADGDGAFRCMSAALRNAGLSPSDVSYIN 341          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Zebrafish
Match: fasn (fatty acid synthase [Source:ZFIN;Acc:ZDB-GENE-030131-7802])

HSP 1 Score: 68.9366 bits (167), Expect = 7.930e-12
Identity = 62/248 (25.00%), Postives = 113/248 (45.56%), Query Frame = 1
Query:  214 PNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYS---LVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVDTGG 948
            P +  TM     LM++ S EA+ + G  + +S+    + GV +G+       +           P  ++G Y++T     M A  L   +   GPS +++TAC++ L A+ +AF +I  G+ D  L GGV   + P +   F ++  L       P    + FD   +G+  +E A A++L   + A +        ++  G + DGY    +  P  +G+   R +++  + A I PE  E+++  G
Sbjct:   69 PKQAHTMDPQLRLMLEISYEAIVDGGI-NPVSMRG-SKTGVYIGVSGSEAGEAFSKD-------PEELLG-YSMTGCQRAMFANRLSYFFDFNGPSTAIDTACSSSLLALENAFNAIRHGKCDAALIGGVNLLLKPNTSVQFMKLGML------SPEGTCKSFDASGNGYCRSEAAVAVLLTKKSMAKR----IYATVLNAGNNTDGYKEQGVTFP--SGEMQQRLVRSLYQEANISPEQVEYIEAHG 294          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Zebrafish
Match: fasn (fatty acid synthase [Source:ZFIN;Acc:ZDB-GENE-030131-7802])

HSP 1 Score: 68.9366 bits (167), Expect = 7.930e-12
Identity = 62/248 (25.00%), Postives = 113/248 (45.56%), Query Frame = 1
Query:  214 PNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYS---LVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVDTGG 948
            P +  TM     LM++ S EA+ + G  + +S+    + GV +G+       +           P  ++G Y++T     M A  L   +   GPS +++TAC++ L A+ +AF +I  G+ D  L GGV   + P +   F ++  L       P    + FD   +G+  +E A A++L   + A +        ++  G + DGY    +  P  +G+   R +++  + A I PE  E+++  G
Sbjct:   69 PKQAHTMDPQLRLMLEISYEAIVDGGI-NPVSMRG-SKTGVYIGVSGSEAGEAFSKD-------PEELLG-YSMTGCQRAMFANRLSYFFDFNGPSTAIDTACSSSLLALENAFNAIRHGKCDAALIGGVNLLLKPNTSVQFMKLGML------SPEGTCKSFDASGNGYCRSEAAVAVLLTKKSMAKR----IYATVLNAGNNTDGYKEQGVTFP--SGEMQQRLVRSLYQEANISPEQVEYIEAHG 294          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Zebrafish
Match: si:dkey-61p9.11 (si:dkey-61p9.11 [Source:ZFIN;Acc:ZDB-GENE-041210-242])

HSP 1 Score: 55.8398 bits (133), Expect = 1.102e-7
Identity = 47/194 (24.23%), Postives = 91/194 (46.91%), Query Frame = 1
Query:  208 LTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLG---NMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVK 780
            +T  E  +M     L+++ +  A+ +AG    +   +  R GV +G+    +    E   V+N   P  +    + T G G   ++ A  +   +   GPS +++ AC++ L A+  A ++I+ G+ D  + GGV   + P    A S+ + +       P+  S+PF +   G+   EG G ++L+ L  A++
Sbjct:   79 ITEAESLSMDPQHKLLLQCTYRALEDAGIP--MEKASGTRTGVYLGL----MNRDFELATVRNN--PKHI----SHTTGTGVAMSIAANRISYIFNFTGPSVAIDCACSSSLVALHFACQAIKQGDCDMSVCGGVSCILEPALFVALSKAKMI------SPDGTSKPFSSKADGYGRGEGCGVVLLKPLKRALE 254          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Zebrafish
Match: si:dkey-61p9.11 (si:dkey-61p9.11 [Source:ZFIN;Acc:ZDB-GENE-041210-242])

HSP 1 Score: 55.4546 bits (132), Expect = 1.134e-7
Identity = 47/194 (24.23%), Postives = 91/194 (46.91%), Query Frame = 1
Query:  208 LTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLG---NMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVK 780
            +T  E  +M     L+++ +  A+ +AG    +   +  R GV +G+    +    E   V+N   P  +    + T G G   ++ A  +   +   GPS +++ AC++ L A+  A ++I+ G+ D  + GGV   + P    A S+ + +       P+  S+PF +   G+   EG G ++L+ L  A++
Sbjct:   81 ITEAESLSMDPQHKLLLQCTYRALEDAGIP--MEKASGTRTGVYLGL----MNRDFELATVRNN--PKHI----SHTTGTGVAMSIAANRISYIFNFTGPSVAIDCACSSSLVALHFACQAIKQGDCDMSVCGGVSCILEPALFVALSKAKMI------SPDGTSKPFSSKADGYGRGEGCGVVLLKPLKRALE 256          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Xenopus
Match: oxsm (3-oxoacyl-ACP synthase, mitochondrial [Source:NCBI gene;Acc:779998])

HSP 1 Score: 230.72 bits (587), Expect = 5.901e-70
Identity = 127/312 (40.71%), Postives = 200/312 (64.10%), Query Frame = 1
Query:   25 RVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILS-DLYAHLPCRIASEINEDNFQ-LIQKQC-LTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIG---FDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAV-KGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            RVV+TGIG++  LG  ++ VW +LI G S +  L  + Y +LPCR+A+ +   + +    +QC ++ +E K MS ++++ + A+ +A+S++G+   ++ E+    GV++G+G    D +  +    Q K     Y+ I P+ + R L NM A H+ ++YKL+GP+ +V+TAC  G HA+GD++R I  G+AD M+AGG EA I P S+A F+R RAL T +N  P+ A RPF  +R GFVM EGA  L+LE  THA+ + AR+   EI+G+G SGD   + AP ++GDGA+R MKAAI+++ I  E   +++
Sbjct:   41 RVVITGIGIVSPLGVGTQLVWDRLIQGASGIGALEREEYKNLPCRVAACVPRGHSEGQFNEQCFVSRSEVKAMSSATIMALGAAEQAISDSGWKP-ITEEDQVSTGVALGMGMVPLDDISAAAMLLQSKG----YNKISPFFVPRILVNMAAGHISIKYKLKGPNHAVSTACTTGAHAVGDSYRFIAYGDADVMVAGGTEACIGPLSLAGFARARALSTSFNLTPDLACRPFHPEREGFVMGEGAAVLILEEYTHALARNARI-YAEILGYGLSGDACHITAPSSDGDGAFRCMKAAIKNSHIQVEDITYIN 346          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Xenopus
Match: tmem100 (transmembrane protein 100 [Source:Xenbase;Acc:XB-GENE-5755009])

HSP 1 Score: 60.4622 bits (145), Expect = 5.022e-9
Identity = 75/321 (23.36%), Postives = 139/321 (43.30%), Query Frame = 1
Query:   19 MNRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSD--------LYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYS---LVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVDTGG 948
            M  +V+ G+       N  ++ W  LI G   V+++++        LY  LP R       D F       + P +  TM     L+++   EA+ +AG   N      +  G + G+ + GV  S           P  ++G Y++T     M A  +   +  +GPS S++TAC++ L A+ +A+++I+ G+ +  +  GV   + P +   F ++  L       P+ A + FD   +G+  +E A A++   +T      RL    I+  G + DG+    +  P  +G      + +  + A I P   E+++  G
Sbjct:    1 MEDIVIAGMSGRLPESNNLQEFWDNLIQG---VDMVTEDDRRWKPGLYG-LPKRNGKLKELDKFD-AAFFGVHPKQAHTMDPQLRLLLEICYEAIVDAGINPN------ELRGTNTGV-WVGVSGSEAGEAFSRD--PEELLG-YSMTGCQRAMFANRISYFFNFKGPSLSIDTACSSSLLALENAYKAIQHGQCNAAIVAGVNVLLKPNTSVQFMKLGML------SPDGACKSFDASGNGYCRSEAAVAVL---VTKKSLAKRL-YSTILNAGSNTDGFKEQGVTFP--SGAVQQELLTSLYKEAGIHPSQVEYLEAHG 294          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Xenopus
Match: tmem100 (transmembrane protein 100 [Source:Xenbase;Acc:XB-GENE-5755009])

HSP 1 Score: 60.4622 bits (145), Expect = 5.209e-9
Identity = 75/321 (23.36%), Postives = 139/321 (43.30%), Query Frame = 1
Query:   19 MNRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSD--------LYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYS---LVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVDTGG 948
            M  +V+ G+       N  ++ W  LI G   V+++++        LY  LP R       D F       + P +  TM     L+++   EA+ +AG   N      +  G + G+ + GV  S           P  ++G Y++T     M A  +   +  +GPS S++TAC++ L A+ +A+++I+ G+ +  +  GV   + P +   F ++  L       P+ A + FD   +G+  +E A A++   +T      RL    I+  G + DG+    +  P  +G      + +  + A I P   E+++  G
Sbjct:    1 MEDIVIAGMSGRLPESNNLQEFWDNLIQG---VDMVTEDDRRWKPGLYG-LPKRNGKLKELDKFD-AAFFGVHPKQAHTMDPQLRLLLEICYEAIVDAGINPN------ELRGTNTGV-WVGVSGSEAGEAFSRD--PEELLG-YSMTGCQRAMFANRISYFFNFKGPSLSIDTACSSSLLALENAYKAIQHGQCNAAIVAGVNVLLKPNTSVQFMKLGML------SPDGACKSFDASGNGYCRSEAAVAVL---VTKKSLAKRL-YSTILNAGSNTDGFKEQGVTFP--SGAVQQELLTSLYKEAGIHPSQVEYLEAHG 294          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Xenopus
Match: tmem100 (transmembrane protein 100 [Source:Xenbase;Acc:XB-GENE-5755009])

HSP 1 Score: 60.4622 bits (145), Expect = 5.377e-9
Identity = 75/321 (23.36%), Postives = 139/321 (43.30%), Query Frame = 1
Query:   19 MNRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSD--------LYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYS---LVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVDTGG 948
            M  +V+ G+       N  ++ W  LI G   V+++++        LY  LP R       D F       + P +  TM     L+++   EA+ +AG   N      +  G + G+ + GV  S           P  ++G Y++T     M A  +   +  +GPS S++TAC++ L A+ +A+++I+ G+ +  +  GV   + P +   F ++  L       P+ A + FD   +G+  +E A A++   +T      RL    I+  G + DG+    +  P  +G      + +  + A I P   E+++  G
Sbjct:    1 MEDIVIAGMSGRLPESNNLQEFWDNLIQG---VDMVTEDDRRWKPGLYG-LPKRNGKLKELDKFD-AAFFGVHPKQAHTMDPQLRLLLEICYEAIVDAGINPN------ELRGTNTGV-WVGVSGSEAGEAFSRD--PEELLG-YSMTGCQRAMFANRISYFFNFKGPSLSIDTACSSSLLALENAYKAIQHGQCNAAIVAGVNVLLKPNTSVQFMKLGML------SPDGACKSFDASGNGYCRSEAAVAVL---VTKKSLAKRL-YSTILNAGSNTDGFKEQGVTFP--SGAVQQELLTSLYKEAGIHPSQVEYLEAHG 294          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Xenopus
Match: tmem100 (transmembrane protein 100 [Source:Xenbase;Acc:XB-GENE-5755009])

HSP 1 Score: 60.4622 bits (145), Expect = 5.384e-9
Identity = 75/321 (23.36%), Postives = 139/321 (43.30%), Query Frame = 1
Query:   19 MNRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSD--------LYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYS---LVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVDTGG 948
            M  +V+ G+       N  ++ W  LI G   V+++++        LY  LP R       D F       + P +  TM     L+++   EA+ +AG   N      +  G + G+ + GV  S           P  ++G Y++T     M A  +   +  +GPS S++TAC++ L A+ +A+++I+ G+ +  +  GV   + P +   F ++  L       P+ A + FD   +G+  +E A A++   +T      RL    I+  G + DG+    +  P  +G      + +  + A I P   E+++  G
Sbjct:    1 MEDIVIAGMSGRLPESNNLQEFWDNLIQG---VDMVTEDDRRWKPGLYG-LPKRNGKLKELDKFD-AAFFGVHPKQAHTMDPQLRLLLEICYEAIVDAGINPN------ELRGTNTGV-WVGVSGSEAGEAFSRD--PEELLG-YSMTGCQRAMFANRISYFFNFKGPSLSIDTACSSSLLALENAYKAIQHGQCNAAIVAGVNVLLKPNTSVQFMKLGML------SPDGACKSFDASGNGYCRSEAAVAVL---VTKKSLAKRL-YSTILNAGSNTDGFKEQGVTFP--SGAVQQELLTSLYKEAGIHPSQVEYLEAHG 294          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Mouse
Match: Oxsm (3-oxoacyl-ACP synthase, mitochondrial [Source:MGI Symbol;Acc:MGI:1918397])

HSP 1 Score: 219.55 bits (558), Expect = 6.416e-66
Identity = 126/319 (39.50%), Postives = 194/319 (60.82%), Query Frame = 1
Query:   25 RVVVTGIGVICSLGNTSKDVWSKLILGHSE-VNILSDLYAHLPCRIAS---------EINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIG---FDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAV-KGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            RVV+TGIG++  LG  ++ VW +L+ G S  V+++ D Y ++PC +A+         + NE+NF       ++ ++ K+MS S+++ + A+  A+ ++G+      + +   GV++G+G    + +  +    Q K     Y+ + P+ + + L NM A  + +RYKL+GP+ SV+TAC  G HA+GD+FR I  G+AD M+AGG ++ ISP S+A FSR RAL +  N DP  A RPF  +R GFVM EGA  LVLE   HAV +GAR+   EI+G+G SGD   + APD  G+GA R M AA++ A + PE   +V+
Sbjct:   43 RVVITGIGLVTPLGVGTQLVWDRLLRGESGIVSVVGDEYKNIPCSVAAYVPRGPHEGQFNEENF-------VSKSDAKSMSSSTIMAVGAAELALKDSGWHPKREADQVAT-GVAIGMGMVPLEVISETALLFQTKG----YNKVSPFFVPKILINMAAGQVSIRYKLKGPNHSVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAGFSRARALSS--NPDPKLACRPFHPERDGFVMGEGAAVLVLEEHEHAVQRGARI-YAEILGYGLSGDAGHITAPDPEGEGALRCMAAAVKDAGVSPEQISYVN 346          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Mouse
Match: Oxsm (3-oxoacyl-ACP synthase, mitochondrial [Source:MGI Symbol;Acc:MGI:1918397])

HSP 1 Score: 219.55 bits (558), Expect = 6.416e-66
Identity = 126/319 (39.50%), Postives = 194/319 (60.82%), Query Frame = 1
Query:   25 RVVVTGIGVICSLGNTSKDVWSKLILGHSE-VNILSDLYAHLPCRIAS---------EINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIG---FDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAV-KGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            RVV+TGIG++  LG  ++ VW +L+ G S  V+++ D Y ++PC +A+         + NE+NF       ++ ++ K+MS S+++ + A+  A+ ++G+      + +   GV++G+G    + +  +    Q K     Y+ + P+ + + L NM A  + +RYKL+GP+ SV+TAC  G HA+GD+FR I  G+AD M+AGG ++ ISP S+A FSR RAL +  N DP  A RPF  +R GFVM EGA  LVLE   HAV +GAR+   EI+G+G SGD   + APD  G+GA R M AA++ A + PE   +V+
Sbjct:   43 RVVITGIGLVTPLGVGTQLVWDRLLRGESGIVSVVGDEYKNIPCSVAAYVPRGPHEGQFNEENF-------VSKSDAKSMSSSTIMAVGAAELALKDSGWHPKREADQVAT-GVAIGMGMVPLEVISETALLFQTKG----YNKVSPFFVPKILINMAAGQVSIRYKLKGPNHSVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAGFSRARALSS--NPDPKLACRPFHPERDGFVMGEGAAVLVLEEHEHAVQRGARI-YAEILGYGLSGDAGHITAPDPEGEGALRCMAAAVKDAGVSPEQISYVN 346          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Mouse
Match: Oxsm (3-oxoacyl-ACP synthase, mitochondrial [Source:MGI Symbol;Acc:MGI:1918397])

HSP 1 Score: 219.55 bits (558), Expect = 6.416e-66
Identity = 126/319 (39.50%), Postives = 194/319 (60.82%), Query Frame = 1
Query:   25 RVVVTGIGVICSLGNTSKDVWSKLILGHSE-VNILSDLYAHLPCRIAS---------EINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIG---FDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAV-KGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            RVV+TGIG++  LG  ++ VW +L+ G S  V+++ D Y ++PC +A+         + NE+NF       ++ ++ K+MS S+++ + A+  A+ ++G+      + +   GV++G+G    + +  +    Q K     Y+ + P+ + + L NM A  + +RYKL+GP+ SV+TAC  G HA+GD+FR I  G+AD M+AGG ++ ISP S+A FSR RAL +  N DP  A RPF  +R GFVM EGA  LVLE   HAV +GAR+   EI+G+G SGD   + APD  G+GA R M AA++ A + PE   +V+
Sbjct:   43 RVVITGIGLVTPLGVGTQLVWDRLLRGESGIVSVVGDEYKNIPCSVAAYVPRGPHEGQFNEENF-------VSKSDAKSMSSSTIMAVGAAELALKDSGWHPKREADQVAT-GVAIGMGMVPLEVISETALLFQTKG----YNKVSPFFVPKILINMAAGQVSIRYKLKGPNHSVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAGFSRARALSS--NPDPKLACRPFHPERDGFVMGEGAAVLVLEEHEHAVQRGARI-YAEILGYGLSGDAGHITAPDPEGEGALRCMAAAVKDAGVSPEQISYVN 346          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Mouse
Match: Fasn (fatty acid synthase [Source:MGI Symbol;Acc:MGI:95485])

HSP 1 Score: 61.2326 bits (147), Expect = 2.471e-9
Identity = 61/248 (24.60%), Postives = 110/248 (44.35%), Query Frame = 1
Query:  214 PNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDG---YSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVDTGG 948
            P +  TM     L+++ S EA+ + G    ++  +L      V +G  G   S    +     L YS++G     R    M A  L   +  +GPS +++TAC++ L A+ +A+++I  GE    L GG+   + P +   F ++  L       P+   R FD   SG+  +E   A++L   +     AR     I+  G + DG     +  P  +G+   + + +  + A + PE  E+++  G
Sbjct:   69 PKQAHTMDPQLRLLLEVSYEAIVDGG----INPASLRGTNTGVWVGVSGSEASEALSRDPETLLGYSMVG---CQRA---MMANRLSFFFDFKGPSIALDTACSSSLLALQNAYQAIRSGECPAALVGGINLLLKPNTSVQFMKLGML------SPDGTCRSFDDSGSGYCRSEAVVAVLLTKKSL----ARRVYATILNAGTNTDGSKEQGVTFP--SGEVQEQLICSLYQPAGLAPESLEYIEAHG 294          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Mouse
Match: Fasn (fatty acid synthase [Source:MGI Symbol;Acc:MGI:95485])

HSP 1 Score: 61.2326 bits (147), Expect = 2.492e-9
Identity = 61/248 (24.60%), Postives = 110/248 (44.35%), Query Frame = 1
Query:  214 PNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDG---YSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVDTGG 948
            P +  TM     L+++ S EA+ + G    ++  +L      V +G  G   S    +     L YS++G     R    M A  L   +  +GPS +++TAC++ L A+ +A+++I  GE    L GG+   + P +   F ++  L       P+   R FD   SG+  +E   A++L   +     AR     I+  G + DG     +  P  +G+   + + +  + A + PE  E+++  G
Sbjct:   69 PKQAHTMDPQLRLLLEVSYEAIVDGG----INPASLRGTNTGVWVGVSGSEASEALSRDPETLLGYSMVG---CQRA---MMANRLSFFFDFKGPSIALDTACSSSLLALQNAYQAIRSGECPAALVGGINLLLKPNTSVQFMKLGML------SPDGTCRSFDDSGSGYCRSEAVVAVLLTKKSL----ARRVYATILNAGTNTDGSKEQGVTFP--SGEVQEQLICSLYQPAGLAPESLEYIEAHG 294          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. UniProt/SwissProt
Match: sp|Q9D404|OXSM_MOUSE (3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus OX=10090 GN=Oxsm PE=1 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 4.488e-65
Identity = 126/319 (39.50%), Postives = 194/319 (60.82%), Query Frame = 1
Query:   25 RVVVTGIGVICSLGNTSKDVWSKLILGHSE-VNILSDLYAHLPCRIAS---------EINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIG---FDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAV-KGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            RVV+TGIG++  LG  ++ VW +L+ G S  V+++ D Y ++PC +A+         + NE+NF       ++ ++ K+MS S+++ + A+  A+ ++G+      + +   GV++G+G    + +  +    Q K     Y+ + P+ + + L NM A  + +RYKL+GP+ SV+TAC  G HA+GD+FR I  G+AD M+AGG ++ ISP S+A FSR RAL +  N DP  A RPF  +R GFVM EGA  LVLE   HAV +GAR+   EI+G+G SGD   + APD  G+GA R M AA++ A + PE   +V+
Sbjct:   43 RVVITGIGLVTPLGVGTQLVWDRLLRGESGIVSVVGDEYKNIPCSVAAYVPRGPHEGQFNEENF-------VSKSDAKSMSSSTIMAVGAAELALKDSGWHPKREADQVAT-GVAIGMGMVPLEVISETALLFQTKG----YNKVSPFFVPKILINMAAGQVSIRYKLKGPNHSVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAGFSRARALSS--NPDPKLACRPFHPERDGFVMGEGAAVLVLEEHEHAVQRGARI-YAEILGYGLSGDAGHITAPDPEGEGALRCMAAAVKDAGVSPEQISYVN 346          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. UniProt/SwissProt
Match: sp|Q0VCA7|OXSM_BOVIN (3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus OX=9913 GN=OXSM PE=2 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 4.648e-65
Identity = 124/312 (39.74%), Postives = 192/312 (61.54%), Query Frame = 1
Query:   25 RVVVTGIGVICSLGNTSKDVWSKLILGHSE-VNILSDLYAHLPCRIASEINE--DNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIG---FDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAV-KGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            RVV+TGIG++  LG  ++ VW +L+ G S  V+++ D Y  +PC +A+ +    D  Q  ++  +  ++ K+MS  +V+ + A+  A+ +AG+    S  +    GV++G+G    + +  +  + Q K     YS + P+ + + L NM +  + +R+KL+GP+ +V+TAC  G HA+GD+FR +  G+AD M+AGG ++ ISP S+A F+R RAL T  N DP SA RPF   R GFVM EGA  LVLE   HA+ +GAR+   EIVG+G SGD   + APD  G+GA+R M AA++ A I PE   +++
Sbjct:   44 RVVITGIGLVTPLGVGTQLVWDRLVRGESGIVSLVGDEYQSIPCSVAAYVPRGCDEGQFNEQNFVPKSDTKSMSPPTVMAIAAAELALKDAGWHPQ-SEADQAATGVAIGMGMVPLEVISETALTFQTKG----YSKVSPFFVPKILVNMASGQVSIRHKLKGPNHAVSTACTTGAHAVGDSFRFVAHGDADVMVAGGTDSCISPLSLAGFARARALST--NTDPKSACRPFHPQRDGFVMGEGAAVLVLEEHRHALRRGARV-YAEIVGYGLSGDAGHITAPDPGGEGAFRCMAAAVKDAGIQPEEVSYIN 347          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. UniProt/SwissProt
Match: sp|Q9NWU1|OXSM_HUMAN (3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens OX=9606 GN=OXSM PE=1 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 4.833e-64
Identity = 120/311 (38.59%), Postives = 186/311 (59.81%), Query Frame = 1
Query:   25 RVVVTGIGVICSLGNTSKDVWSKLILGHSE-VNILSDLYAHLPCRIASEI--NEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIG---FDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            RVV+TGIG++  LG  +  VW +LI G S  V+++ + Y  +PC +A+ +    D  Q  ++  ++ ++ K+MS  +++ + A+  AM ++G+      + +   GV++G+G    + V  +  + Q K     Y+ + P+ + + L NM A  + +RYKL+GP+ +V+TAC  G HA+GD+FR I  G+AD M+AGG ++ ISP S+A FSR RAL T  N DP  A RPF   R GFVM EGA  LVLE   HAV+       E++G+G SGD   + APD  G+GA R M AA++ A + PE   +++
Sbjct:   43 RVVITGIGLVTPLGVGTHLVWDRLIGGESGIVSLVGEEYKSIPCSVAAYVPRGSDEGQFNEQNFVSKSDIKSMSSPTIMAIGAAELAMKDSGWHPQSEADQVAT-GVAIGMGMIPLEVVSETALNFQTKG----YNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAGFSRARALST--NSDPKLACRPFHPKRDGFVMGEGAAVLVLEEYEHAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQPEEISYIN 346          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. UniProt/SwissProt
Match: sp|O94297|OXSM_SCHPO (Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC887.13c PE=3 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 1.052e-58
Identity = 114/316 (36.08%), Postives = 181/316 (57.28%), Query Frame = 1
Query:   19 MNRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSDL--YAHLPCRIASEI----NEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVI---GPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            M RVV+TG+G +  LGN  K  W  LI G S +  L     Y  +P ++A  I     ++ + ++    +   + + ++  + L + +++EA+ +A + D    E L     + G+ F   I +++    +NG L  + I    P  +++ L NMPA ++  RY     + +  TACAAG HAIGDAF  I++G AD ++AGG E+ I+P ++A FS+ R+L TK+ND+P +ASRPFD +R GFV+ EG+ ALVLE L HA         EIVG+G + D Y + AP+ NGD AY AMK +++ A +     ++++
Sbjct:    1 MKRVVITGLGAVTPLGNGVKTNWRNLIQGKSGIVSLKGFPEYEQIPSKVAGVIPRGKEKEEWNVLDY--VDQGKLREVATFTQLALTSAAEALKDARWIDIDEQEKL-----ATGVCFGTGIGNLDDALNENGVLNKAGIRKVSPRVISKILINMPAGYISQRYGFTALNHTTTTACAAGCHAIGDAFNFIKLGHADVIIAGGSESCINPLTVAGFSKARSLSTKFNDNPKAASRPFDANRDGFVIGEGSAALVLEELEHAKNRNAHIYAEIVGYGLASDSYHITAPNPNGDAAYYAMKRSLKQAGLSASQLDYIN 309          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. UniProt/SwissProt
Match: sp|P56902|FABF_RHIME (3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) OX=266834 GN=fabF PE=3 SV=2)

HSP 1 Score: 191.43 bits (485), Expect = 1.154e-54
Identity = 119/325 (36.62%), Postives = 183/325 (56.31%), Query Frame = 1
Query:   19 MNRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILS-----DLYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHA-VKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVDTGGMEKFRTMTE 975
            M RVV+TG G++  LG  ++  W++L+ G +    ++     DL A + CRI      D         + P E + +    V  M A+  A+++AG+    S E+    GV +G G  G+   +++        P   I P+ +   L N+ A  + +R+KLRGP+ SV TAC+ G HAIGDA R I +G+AD M+AGG E+ I   S+A F+  +AL T++ND+P  ASRP+D DR GFVM EGAG +VLE L HA  +GA++   E++G+G SGD + + AP  +G+GAYR M+ A++ A +     ++++  G        E
Sbjct:    1 MRRVVITGTGMVSPLGCGTEVSWARLLTGDNAARKVTEFEVEDLPAKIACRIPFGDGSDG-TFNADDWMEPKEQRKVDPFIVYAMAAADMALADAGWKPE-SDEDQISTGVLIGSGIGGLEGIVDAGYTLRDKGPRR-ISPFFIPGRLINLAAGQVSIRHKLRGPNHSVVTACSTGAHAIGDASRLIALGDADVMVAGGTESPICRISLAGFAACKALSTQHNDNPEKASRPYDADRDGFVMGEGAGIVVLEELEHARARGAKI-YAEVIGYGLSGDAFHITAPSEDGEGAYRCMQMALKRAGVTAADIDYINAHGTSTMADTIE 321          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. TrEMBL
Match: Q9VNF5 (3-oxoacyl-[acyl-carrier-protein] synthase OS=Drosophila melanogaster OX=7227 GN=anon-WO0118547.367 PE=1 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 7.434e-76
Identity = 143/308 (46.43%), Postives = 193/308 (62.66%), Query Frame = 1
Query:   25 RVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSDLYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFT-DNLSVENLDRFGVSVGIG-FDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHA-VKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            RVVVTG G +  LGN   D W +++ G S ++ LS  +  LPC++A++I  +N QL Q   LT ++ K MS ++ L + A+ EA+S        LS E L+RFGV VG+G FD        +Q++ GY   + + P+ + R L +M   H+ +R+ LRGP+ SV+TACA G HA+GDA R I  G+AD MLAG  EA I P SIA F R+RAL T +ND+P  ASRPFD  R GFVM EGA  L+LE L HA  +GA + L EI+G+G SGD Y + +P  +G GA  AMK AI+ A I PE   +V+
Sbjct:   25 RVVVTGSGAVTPLGNNGPDSWRRILAGESAISRLSAEFKGLPCQVAAQIPRENLQLDQH--LTKSDIKLMSPATQLAVLAAEEALSTGKLCPKQLSEEELERFGVCVGMGMFDLAEVYGAWNQLQRGY---NRVSPFFVPRLLPSMACGHISMRHGLRGPNHSVSTACATGAHALGDAMRFIRSGDADLMLAGSGEACIDPLSIAGFCRLRALSTAFNDNPAVASRPFDKSRDGFVMGEGAAVLLLEELEHARARGAPI-LAEILGYGLSGDAYHITSPSDDGAGATLAMKRAIQDAGIAPEDVTYVN 326          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. TrEMBL
Match: Q8IGI4 (RH10820p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CG12170 PE=2 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 1.369e-75
Identity = 143/308 (46.43%), Postives = 193/308 (62.66%), Query Frame = 1
Query:   25 RVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSDLYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFT-DNLSVENLDRFGVSVGIG-FDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHA-VKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            RVVVTG G +  LGN   D W +++ G S ++ LS  +  LPC++A++I  +N QL Q   LT ++ K MS ++ L + A+ EA+S        LS E L+RFGV VG+G FD        +Q++ GY   + + P+ + R L +M   H+ +R+ LRGP+ SV+TACA G HA+GDA R I  G+AD MLAG  EA I P SIA F R+RAL T +ND+P  ASRPFD  R GFVM EGA  L+LE L HA  +GA + L EI+G+G SGD Y + +P  +G GA  AMK AI+ A I PE   +V+
Sbjct:   34 RVVVTGSGAVTPLGNNGPDSWRRILAGESAISRLSAEFKGLPCQVAAQIPRENLQLDQH--LTKSDIKLMSPATQLAVLAAEEALSTGKLCPKQLSEEELERFGVCVGMGMFDLAEVYGAWNQLQRGY---NRVSPFFVPRLLPSMACGHISMRHGLRGPNHSVSTACATGAHALGDAMRFIRSGDADLMLAGSGEACIDPLSIAGFCRLRALSTAFNDNPAVASRPFDKSRDGFVMGEGAAVLLLEELEHARARGAPI-LAEILGYGLSGDAYHITSPSDDGAGATLAMKRAIQDAGIAPEDVTYVN 335          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. TrEMBL
Match: A0A084W011 (3-oxoacyl-[acyl-carrier-protein] synthase OS=Anopheles sinensis OX=74873 GN=ZHAS_00011369 PE=3 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 1.825e-75
Identity = 135/309 (43.69%), Postives = 196/309 (63.43%), Query Frame = 1
Query:   25 RVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILS-DLYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVEN-LDRFGVSVGIGFDGVINSIESHQ-VKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLV-EIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            RVVVTG+GV+  +G T    W  ++ G S++  L  + Y  LPCR+A+ I++ +  L  + C T  E KTM+R++   + A+ EA++ AG+T ++  EN   R GV++G+G   +++  E+++ +K GY   + + P+ + R L NMPA  L +RY  RGP+ +V+TACA G H+IGDAFR I+ G+AD M+ GG EA ISP  IA F R+RAL T +ND+P  +SRPFD  R GFVM EG+   VLE L HA KG   P++ E++G+G SGD   L AP  +G GA  AMK A+  A + P    +V+
Sbjct:   38 RVVVTGLGVVSPVGCTVDTAWRTILSGQSKIGRLEGESYDKLPCRVAATIDKQDIDL--ENCFTKTELKTMARATAFALIAAKEALTTAGWTPSVEDENACQRTGVAIGMGMVDLMDICETNEALKKGY---NRVSPFFVPRILPNMPAGQLSIRYGFRGPNHAVSTACATGAHSIGDAFRFIQHGDADVMVCGGAEACISPLGIAGFCRLRALSTAFNDEPALSSRPFDKRRDGFVMGEGSAIFVLEELQHA-KGRNAPIIGEVLGYGLSGDASHLTAPREDGTGAILAMKRALADANLSPTDVGYVN 340          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. TrEMBL
Match: A0A0L0BY77 (3-oxoacyl-[acyl-carrier-protein] synthase OS=Lucilia cuprina OX=7375 GN=FF38_11803 PE=3 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 5.629e-74
Identity = 137/307 (44.63%), Postives = 189/307 (61.56%), Query Frame = 1
Query:   25 RVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSDLYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFT-DNLSVENLDRFGVSVGIG-FDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            RVVVTG+G +  LG   ++ W KL+   + +  L D Y  LPC++A++IN++N  +     L+ ++ K MS ++ L + A+ EA+S A     NLS E L+RFGV VG+G FD         Q++ GY   + + P+ + R L +M   H+ +R+ LRGP+ SV+TACA G HAIGDA R I  G+AD MLAG  E+ I P SIA F R+RAL T +ND P  ASRPFD  R GFVM EGA  LVLE L HA+K     L E++G+G SGD Y + +P  +G GA  AM+ AI  A++ P    +V+
Sbjct:   32 RVVVTGMGAVTPLGGNVQESWQKLLKCEAAITSLGDQYKGLPCQVAAQINKENLPI--NDLLSKSDIKLMSPATQLSVLATEEALSTAQIIPKNLSSEELERFGVCVGMGMFDLTEVYGAWQQLQRGY---NRVSPFFVPRLLPSMACGHISMRHGLRGPNHSVSTACATGAHAIGDAMRFIRNGDADIMLAGSGESCIDPLSIAGFCRLRALSTAFNDMPEKASRPFDNKRDGFVMGEGAAILVLEELEHALKRNAPILAEVLGYGLSGDAYHITSPSEDGTGATLAMQRAINDAQVLPGDISYVN 333          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. TrEMBL
Match: A0A1B6JI21 (3-oxoacyl-[acyl-carrier-protein] synthase OS=Homalodisca liturata OX=320908 GN=g.5743 PE=3 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 1.297e-73
Identity = 134/308 (43.51%), Postives = 194/308 (62.99%), Query Frame = 1
Query:   25 RVVVTGIGVICSLGNTSKDVWSKLILGHSEVN-ILSDLYAHLPCRIASEINED--NFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            RVV+TGIG++  LG+ SK  W  ++ G S ++ I ++ Y  +PC++A+ +N++  N + I  +  T +E +TMSR ++  M A+ EA+ +A +      ++L+  GV VG+G   +++  E+ +  N  L YS + PY + R L NM A  + ++Y  +GP+ SV+TACA G H+IGDAFR I+ G AD M+ GG EASISP S+A F RIRAL T YNDDP+++SRPFD DR GFVM EG+  LVLE L HA+        EI+G+G SGD   L AP   G GA  AM+ AI  + I  E   +++
Sbjct:    4 RVVITGIGILSPLGHNSKLSWESVLAGRSGISQIKNNDYIKIPCKVAAFVNDETLNKEDIANKYFTKSERRTMSRGTLFGMLAAEEALQDAQWKPE-DTKSLESTGVCVGMGMADLVHICETREALN--LGYSRVSPYFVPRILTNMVAGQISIKYGFQGPNHSVSTACATGAHSIGDAFRLIQNGHADVMVCGGAEASISPLSLAGFCRIRALSTAYNDDPSASSRPFDKDRDGFVMGEGSSILVLEELNHALARQIQIYGEILGYGMSGDASHLTAPHGEGKGAVLAMERAILDSNIKKEEITYIN 308          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Cavefish
Match: oxsm (3-oxoacyl-ACP synthase, mitochondrial [Source:NCBI gene;Acc:103039068])

HSP 1 Score: 215.698 bits (548), Expect = 1.788e-64
Identity = 121/315 (38.41%), Postives = 189/315 (60.00%), Query Frame = 1
Query:   22 NRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNIL-SDLYAHLPCRIASEI----NEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIG---FDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAV-KGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
             RVV+TGIG++  LG  +   W +L+ G S +  L S+ Y  +PC++A+ +     E  F+  +++ +   E   MS ++V+ + A+  A+ + G+      E L+  GV+VG+G    + +  +  + + +     YS + P+ + R L NM A H+ +++KL+GP+ +V+TAC  G HA+GDA R I  G+A  M+AGG EA +SP SIA F+R RAL T +N  P  ASRPF  +R GFVM EGA  L+LE   HA+ +GAR+   E++G+G SGD   + AP  +GDGA+R M AA+ +A + P    +V+
Sbjct:   47 RRVVITGIGLVSPLGTGTALPWQRLVDGESGIVALDSEEYRTVPCKVAARVPRGDGEGEFK--EERFVGRGEMSCMSSATVMAVGAAHLALEDCGWYPRSPEEQLNT-GVAVGMGMVSLEEIARTAAAFETRG----YSKVSPFFVPRILVNMAAGHISIKHKLKGPNHAVSTACTTGAHAVGDAARFIAHGDAVVMVAGGTEACVSPLSIAGFARARALSTNWNQQPKLASRPFHPEREGFVMGEGAAVLILEEYGHAMERGARV-YAEVLGYGLSGDASHITAPTEDGDGAFRCMSAALRNAGVSPSDVTYVN 353          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Cavefish
Match: fasn (fatty acid synthase [Source:NCBI gene;Acc:103030617])

HSP 1 Score: 70.4774 bits (171), Expect = 2.468e-12
Identity = 63/248 (25.40%), Postives = 114/248 (45.97%), Query Frame = 1
Query:  214 PNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYS---LVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVDTGG 948
            P +  TM     LM++ S EA+ + G      +  +   G   G+ + GV  S           P  ++G Y++T     M A  L   +   GPS +++TAC++ L A+ +AF++I  G+ D  L GGV   + P +   F ++  L       P+ + + FD+  +G+  +E A A++L   + A +        ++  G + DGY    +  P  +GD     +++  + A I PE  E+++  G
Sbjct:   69 PKQAHTMDPQLRLMLEISYEAIVDGG------INPVSMRGTKTGV-YIGVSGSEAGEAFSKD--PEELLG-YSMTGCQRAMFANRLSYFFDFNGPSTAIDTACSSSLLALENAFQAIRHGQIDSALVGGVNLLLKPNTSVQFMKLGML------SPDGSCKSFDSSGNGYCRSEAAVAVLLMKKSMAKR----VYATVLNAGNNTDGYKEQGVTFP--SGDMQQLLVRSLYQEANISPEQVEYIEAHG 294          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Cavefish
Match: ENSAMXT00000055595.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000076.1:794093:808476:-1 gene:ENSAMXG00000032136.1 transcript:ENSAMXT00000055595.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 5.542e-9
Identity = 48/191 (25.13%), Postives = 88/191 (46.07%), Query Frame = 1
Query:  208 LTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVIN-SIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAV 777
            LT  E   M     L++ ++  A  NAG         L++   +    F G++N   E +++K      + I  +  T    ++ A  +   + L GPS +++TAC++ L A+    ++I+ G+ +  L GGV     P    A S+ + +       P+  S+PF  D +G+   EG G ++L+ L  A+
Sbjct:   82 LTEAESSQMDPQHKLLLHSTYRAFENAGIP-------LEKASGTKTAVFIGMMNRDYELNKMKGNP---NTISHWTGTGIAMSISANRISYAFNLTGPSLAIDTACSSSLVALHLGCQAIKQGDCEMALCGGVSCIYDPQLFVALSKAKMI------SPDGTSKPFSKDANGYGRGEGCGVVLLKPLKKAI 256          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Cavefish
Match: ENSAMXT00000046746.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000076.1:798620:808476:-1 gene:ENSAMXG00000032136.1 transcript:ENSAMXT00000046746.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 6.271e-9
Identity = 30/99 (30.30%), Postives = 53/99 (53.54%), Query Frame = 1
Query:  481 YKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAV 777
            + L GPS +++TAC++ L A+    ++I+ G+ +  L GGV     P    A S+ + +       P+  S+PF  D +G+   EG G ++L+ L  A+
Sbjct:  164 FNLTGPSLAIDTACSSSLVALHLGCQAIKQGDCEMALCGGVSCIYDPQLFVALSKAKMI------SPDGTSKPFSKDANGYGRGEGCGVVLLKPLKKAI 256          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Cavefish
Match: si:dkey-61p9.11 (phthioceranic/hydroxyphthioceranic acid synthase-like [Source:NCBI gene;Acc:103045045])

HSP 1 Score: 56.225 bits (134), Expect = 5.781e-8
Identity = 44/196 (22.45%), Postives = 87/196 (44.39%), Query Frame = 1
Query:  208 LTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLG-----NMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVK 780
            +T  E + M     ++++ +  A+ NAG    +   +  R GV VG+     +N       ++  L  + + P  +    G     ++ A  +   +   GPS +++ AC++ L A+  A +++  G+ +  + GGV     P    A S+ + +       P+  S+PF     G+   EG G +VL+ L  A++
Sbjct:   81 ITEAEVEQMDPQHKILLQCTYRALENAGIP--MEKASGSRTGVYVGL-----MN-------RDYELTMASVNPVIINHCTGTGLAMSIAANRISYTFNFTGPSLAIDCACSSSLVALHLACQAMRQGDCEMAVCGGVSCIFQPRVFVALSKAKMVA------PDGTSKPFSNTADGYGRGEGCGIVVLKPLKKALQ 256          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Sea Lamprey
Match: oxsm (3-oxoacyl-ACP synthase, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-170215-2])

HSP 1 Score: 193.356 bits (490), Expect = 1.424e-56
Identity = 114/313 (36.42%), Postives = 178/313 (56.87%), Query Frame = 1
Query:   22 NRVVVTGIGVICSLGNTSKDVWSKLILGHS-EVNILSDLYAHLPCRIASEINE----DNFQLIQKQCLTP-NEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAV-KGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
             RVV+TG+G++C LG  +   W +L+ G +  V +    +A LP R+A  +      D           P ++ + +S ++V+ + A+  A+ ++G+      E L           D  +  I +  V    L    + P+ + + L NM  AH+ + + L+GP  SV+TACA G HA+GDA R +  G+AD MLAGG EA++SP ++A F R R+L T +N+ P +ASRPF  +R GFV+AEGA  +VLE +  AV +GAR+ L E++G+G SGD   + AP  +GDGAYR M+AA+  A + P    +++
Sbjct:   43 RRVVITGLGLLCPLGVGTDAAWRRLLRGDTATVALDHPAFASLPSRVAGLVPRGTGGDTAATFDPSLFVPASQARQLSPTTVMALAAARLALDDSGWRPRDPEEQLRAGVAVGVGVAD--LEEIVNAGVALRELGARKLSPFFVPKILTNMAGAHISIAHGLKGPVHSVSTACATGAHALGDAARLVARGDADVMLAGGAEAAVSPLAVAGFCRARSLSTAFNERPEAASRPFHPERDGFVIAEGAAVVVLEEMERAVARGARI-LAEVMGYGMSGDANHITAPSEDGDGAYRCMEAALLDAGLSPSDVGYIN 352          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Yeast
Match: CEM1 (Mitochondrial beta-keto-acyl synthase; possible role in fatty acid synthesis; required for mitochondrial respiration; human homolog OXSM can complement yeast cem1 null mutant [Source:SGD;Acc:S000000863])

HSP 1 Score: 175.637 bits (444), Expect = 1.737e-50
Identity = 116/327 (35.47%), Postives = 173/327 (52.91%), Query Frame = 1
Query:   25 RVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSDLYAH----------LPCRIASEINEDNFQ----LIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGF------TDNLSVENLDRFGVSVGIGFDGVINSI--ESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            RVV+TG+G +  LG +  + W  L+   + +  ++ L  +          +P  I      +NFQ     I K   T  + +  S    L ++ + EA+ NAG       T N S+ NLD FG  +G G  G I  I   S Q  N       I PY + + L NM A ++ +++ LRG S SV+TACA G ++IGDAF  I +G  D  +AG  E S+ P S+A F R +++ T      N  SRPFDT RSGFV+ EG G +V+ESL HA K     + E+VG+G S D   + +P  +G+GA RA++ A++ A++ P   ++V+
Sbjct:    4 RVVITGLGCVTPLGRSLSESWGNLLSSKNGLTPITSLPNYNEDYKLREKSIPSTITVGKIPENFQNENSAINKLLFTSQDERRTSSFIKLALRTTYEALHNAGLLNPNDITINTSLCNLDHFGCLIGSGI-GSIQDIYQTSLQFHNDN---KRINPYFVPKILTNMAAGNVSIKFNLRGLSHSVSTACATGNNSIGDAFNFIRLGMQDICVAGASETSLHPLSLAGFIRAKSITT------NGISRPFDTQRSGFVLGEGCGMIVMESLEHAQKRNANIISELVGYGLSSDACHITSPPADGNGAKRAIEMALKMARLEPTDVDYVN 320          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Nematostella
Match: EDO37289 (3-oxoacyl-[acyl-carrier-protein] synthase [Source:UniProtKB/TrEMBL;Acc:A7SG79])

HSP 1 Score: 167.548 bits (423), Expect = 3.764e-47
Identity = 115/308 (37.34%), Postives = 176/308 (57.14%), Query Frame = 1
Query:   49 VICSLGNTSKDVWSKLILGHSEVNILSD---------LYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQV-KNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAV-KGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            ++  LG+ ++ VW +LI G   +  +SD         +  H    + +   E  F        + ++ ++ S  +   + A+ EA  + G+T   + E  ++ GVS+G G        E   + KN    Y  +GP+ +TR L +M +  + + + L+GP+ +V TACAAG HAIGDA+R I  G+A+ MLAGG E++I+P  +A+  + RAL TKYND P+ ASRPFD DRSGFV+AEGAG LVLE   HAV +GA +   E++G+G SGD + + AP  +G GAY AM  A+  A + P    +++
Sbjct:    2 LVTPLGSGTEYVWRRLINGACGLACISDKGSQQNMENMAWHATGFVPAGTGEGEFDQT-----SWHKSRSTSDEAYFAVAAAQEAFDSCGWTP-ATQEEKEKTGVSIGTGIGDTKGLPEMGAILKN--QGYKKVGPFFVTRSLLSMSSGIVSMYFNLQGPNHAVATACAAGAHAIGDAYRMIAHGDANVMLAGGTESAITPLCMASLCKARALTTKYNDSPHEASRPFDRDRSGFVIAEGAGILVLEEHQHAVSRGAHI-YAEMLGYGLSGDAHHITAPSQDGRGAYLAMSNALRDAGLSPSDIHYIN 300          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Nematostella
Match: EDO25549 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DW60])

HSP 1 Score: 135.576 bits (340), Expect = 9.249e-36
Identity = 89/270 (32.96%), Postives = 140/270 (51.85%), Query Frame = 1
Query:  151 CRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVK----NGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVDTGG 948
             R A EI   NF++     L   E + M + +   M A+ EA++++G   + +  + DR GV  G G  G    +E+ Q +    N         P+ + + + ++   H+ ++   RGP+ +  +ACA+  +AI D+   I +G AD ++ GG EA+++   I  F+ + AL T+ ND P +ASRPFD DR GFV+ EGAGALVLE   HA+        E++G G S D + + AP   G GA   M   +  A I PE  + ++  G
Sbjct:    2 TRFACEIK--NFKV--TDFLDRKEARKMDKFTQYAMVATDEAIADSGL--HSAGFDPDRVGVIWGSGIGG----LETFQTEVTNFNNGDGTPRFNPFFIPKMIADIAPGHISIKNGFRGPNFATVSACASSSNAIIDSLNYIRLGHADVIVTGGSEAAVTEAGIGGFNAMHALSTR-NDSPETASRPFDKDREGFVLGEGAGALVLEEYEHAIARGATIYAEVIGGGMSSDAHHITAPHPEGLGAKNVMLNCLRDAGIQPEEVDAINMHG 260          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Nematostella
Match: EDO26892 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAS5])

HSP 1 Score: 134.035 bits (336), Expect = 1.585e-35
Identity = 83/216 (38.43%), Postives = 129/216 (59.72%), Query Frame = 1
Query:  262 ASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAA-FSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHA-VKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIES 903
            A  +A+ +AG +++  V N+ R G+  G G     + +ES  +         +GPY +TR +G+  +A L   +K++G + S+ +ACA   H IG+A   I++G+ D + AGG E     WS+   F  + AL +KYN+ P  ASR +D +R GFV+A GAG LVLE L HA  +GA++   E+VG+G + DGY +VAP  +G+GA R M+ A+ +
Sbjct:   11 AMDQAIKDAGLSED-QVSNV-RTGLIAGSGGASSADIVESADILRDK-GVRRVGPYRVTRTMGSTVSACLATPFKIKGINYSITSACATSAHCIGNAMEQIQMGKQDVVFAGGGEEL--HWSLTVMFDAMGALSSKYNETPEKASRAYDANRDGFVIAGGAGMLVLEDLEHAKARGAKI-YAEVVGYGATSDGYDMVAP--SGEGAMRCMQQAMST 218          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Nematostella
Match: EDO26077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCY2])

HSP 1 Score: 93.9745 bits (232), Expect = 5.949e-22
Identity = 59/171 (34.50%), Postives = 89/171 (52.05%), Query Frame = 1
Query:  439 RGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYR-AMKAAIESAKIGPEMFEFVDTGG 948
            R + +  AA++ + + L+G     ++AC +G   IG A+ +I+ G    M+AGG E  + P     F  + A   K ND P+++ RP+D+ R G V+ EGAG LVLE L HA+        EIVGFG + DG     P        R AM+ A++ A + P    +V+  G
Sbjct:   17 RMMPHTTAANISIFFGLKGRLIPTSSACTSGSQGIGYAYEAIKFGRLQMMVAGGAE-ELCPTEAMVFDALYATSLK-NDAPHTSPRPYDSGRDGLVIGEGAGILVLEELEHALARGATIYAEIVGFGCNSDGQHATKPV---QATMRGAMELALQDANLAPSAIGYVNGHG 182          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Medaka
Match: oxsm (3-oxoacyl-ACP synthase, mitochondrial [Source:NCBI gene;Acc:101157710])

HSP 1 Score: 224.557 bits (571), Expect = 8.265e-68
Identity = 129/313 (41.21%), Postives = 187/313 (59.74%), Query Frame = 1
Query:   22 NRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNIL-SDLYAHLPCRIASEI--NEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIG---FDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVK-GARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
             RVVVTG+G++C LG      W  LI G S +  L S+ Y  LPCR+A+ +    D  Q    + ++  E   MS ++V+ + A+  A+ +A +    S+E     GV+VG+G    D + ++  + Q +     Y  + P+ + R L NM A H+ +++KL+GP+ +V+TAC  G HA+GDA R I  G+A  M+ GG E+ + P SIA F+R RAL TK+ND P  ASRPF  +R GFVM EGA  L+LE L HAVK GAR+   EI+G+G SGD   + AP  +GDGA+R M AA++ A I P    +++
Sbjct:   40 RRVVVTGLGLVCPLGTGCNLPWECLIQGRSGIVALESEDYRGLPCRVAALVPRGADEGQFKGDRFVSRGEISNMSAATVMALGAAQLALEDAAWFPE-SLEEQLSTGVAVGMGMVSLDDIASTSAAFQERG----YKKVSPFFVPRILVNMAAGHISIKHKLKGPNHAVSTACTTGAHAVGDAARFIAHGDAVAMVTGGTESCVGPLSIAGFARARALATKWNDRPTLASRPFHPEREGFVMGEGAAVLLLEELEHAVKRGARI-YAEILGYGLSGDASHITAPSADGDGAFRCMSAALKDAGISPADVTYIN 346          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Medaka
Match: si:dkey-61p9.11 (equisetin synthetase eqxS [Source:NCBI gene;Acc:101169644])

HSP 1 Score: 66.2402 bits (160), Expect = 4.349e-11
Identity = 50/191 (26.18%), Postives = 90/191 (47.12%), Query Frame = 1
Query:  208 LTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVK 780
            ++ +E + M      +++    A+ NAG    + +E     G   G+ F G++N    ++    ++  SVI  +  T    ++ A  +   + L GPS S++ AC++ L A+  A +SI+ G+ D    GGV   I P    A S+ + +       P   S+PF T   G+   EG G ++L+ L  A++
Sbjct:   82 ISESEVEQMDPQQKQLLQCVYRALENAG----IPMEKAS--GTRTGVFF-GMMN--RDYETNAAHMHPSVINHWTGTGLAMSIAANRVSYVFNLTGPSLSLDCACSSSLVALHLACQSIKQGDCDMAFCGGVNCIIEPRVFVALSKAKMI------SPEGTSKPFSTQADGYGRGEGCGVVLLKPLKRALQ 257          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Medaka
Match: olpks (probable polyketide synthase 16 [Source:NCBI gene;Acc:101169887])

HSP 1 Score: 61.6178 bits (148), Expect = 1.346e-9
Identity = 50/184 (27.17%), Postives = 86/184 (46.74%), Query Frame = 1
Query:  220 EFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLD--RFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESL 765
            E   M     L+++ S  A+ +AG     S+E++   R GV VG+     +N    +++     P + I  Y  T    ++ A  +   + L GPS ++++AC++ L A+  A ++I +G+ +  L GGV   I P    A S+ +         P   S+PF     G+   EG G L+L+ L
Sbjct:   83 EADVMDPQQKLLLQCSYRALEDAG----TSIESISGSRTGVYVGL-----MN--RDYEMLRNNNP-NTISHYNATGTATSVAANRISFTFNLTGPSFAIDSACSSSLVALHVACQAIRLGDCEMALCGGVNCIIEPRVFVALSKAKM------TSPEGTSKPFSIRADGYGRGEGCGVLLLKPL 248          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Medaka
Match: ENSORLT00000004542.2 (probable polyketide synthase 1 [Source:NCBI gene;Acc:101170716])

HSP 1 Score: 59.3066 bits (142), Expect = 6.219e-9
Identity = 47/191 (24.61%), Postives = 88/191 (46.07%), Query Frame = 1
Query:  208 LTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVK 780
            ++  E + M      +++    A+ +AG    L +E     G   G+ F G++N    ++   G +  S+I  Y  T    ++ A  +   +   GPS +++TAC++ L A+  A +SI  G+ +  + GGV     P      SR + +       P   S+PF +  +G+   EG G ++L+ L  A++
Sbjct:  210 ISDTEAEQMDPQQKQLLQCVYRALEDAG----LPMEKAS--GTRTGVFF-GIMN--RDYESNGGNIHPSLINHYTGTGLAMSIAANRVSYSFNFTGPSLTLDTACSSSLVALHLACQSIRQGDCEMAVCGGVNFITEPRVFVVLSRAKMI------SPEGTSKPFSSQANGYGRGEGCGVVLLKPLKKALE 385          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Planmine SMEST
Match: SMESG000066335.1 (SMESG000066335.1)

HSP 1 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 301/306 (98.37%), Postives = 304/306 (99.35%), Query Frame = 1
Query:   22 NRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSDLYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            NRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSDLYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEM  +++
Sbjct:  504 NRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSDLYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMVSYIN 809          

HSP 2 Score: 101.293 bits (251), Expect = 1.674e-22
Identity = 60/153 (39.22%), Postives = 94/153 (61.44%), Query Frame = 1
Query:  925 FEFVDTGGMEKFRTMTEXXXXXXXXXXXVFAIDNRKSFDELKFXXXXXXXXXXXXXXXXLIGNKSDLEGIFEIQDCKSLQYNIGCQEFRMISAKTGEGFQDLLNCVANHWIDTKMSHN-------RSLMKASSITPEEQYNCWNSFFNCCALL 1362
            FEF+DT G+E+FRT+T S F +  +IF +F++D+RKSFDEL+        V+     ++LIGNKSDL     I+DC++L+ +IGC +F +ISAK   GFQ L++ + + W++ K SHN       + L+   ++    + NC +    CC +L
Sbjct:   61 FEFIDTKGLERFRTLTPSHFQHCRVIFLIFSLDSRKSFDELR---NLYDDVLRSLNPEILIGNKSDLHSNINIEDCENLKKDIGCVDFHIISAKEDIGFQTLVSRLISLWVEKKQSHNAESYNEKKQLLNQDNV----EENCVDKPCTCCTIL 206          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Planmine SMEST
Match: SMESG000066335.1 (SMESG000066335.1)

HSP 1 Score: 623.624 bits (1607), Expect = 0.000e+0
Identity = 301/306 (98.37%), Postives = 304/306 (99.35%), Query Frame = 1
Query:   22 NRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSDLYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            NRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSDLYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEM  +++
Sbjct:  493 NRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSDLYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMVSYIN 798          

HSP 2 Score: 101.293 bits (251), Expect = 1.708e-22
Identity = 60/153 (39.22%), Postives = 94/153 (61.44%), Query Frame = 1
Query:  925 FEFVDTGGMEKFRTMTEXXXXXXXXXXXVFAIDNRKSFDELKFXXXXXXXXXXXXXXXXLIGNKSDLEGIFEIQDCKSLQYNIGCQEFRMISAKTGEGFQDLLNCVANHWIDTKMSHN-------RSLMKASSITPEEQYNCWNSFFNCCALL 1362
            FEF+DT G+E+FRT+T S F +  +IF +F++D+RKSFDEL+        V+     ++LIGNKSDL     I+DC++L+ +IGC +F +ISAK   GFQ L++ + + W++ K SHN       + L+   ++    + NC +    CC +L
Sbjct:   61 FEFIDTKGLERFRTLTPSHFQHCRVIFLIFSLDSRKSFDELR---NLYDDVLRSLNPEILIGNKSDLHSNINIEDCENLKKDIGCVDFHIISAKEDIGFQTLVSRLISLWVEKKQSHNAESYNEKKQLLNQDNV----EENCVDKPCTCCTIL 206          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Planmine SMEST
Match: SMESG000066335.1 (SMESG000066335.1)

HSP 1 Score: 623.624 bits (1607), Expect = 0.000e+0
Identity = 301/306 (98.37%), Postives = 304/306 (99.35%), Query Frame = 1
Query:   22 NRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSDLYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            NRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSDLYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEM  +++
Sbjct:  296 NRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSDLYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMVSYIN 601          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Planmine SMEST
Match: SMESG000066335.1 (SMESG000066335.1)

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 301/306 (98.37%), Postives = 304/306 (99.35%), Query Frame = 1
Query:   22 NRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSDLYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMFEFVD 939
            NRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSDLYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEM  +++
Sbjct:  260 NRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSDLYAHLPCRIASEINEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVENLDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAHLCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASISPWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLTHAVKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGPEMVSYIN 565          
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Planmine SMEST
Match: SMESG000066332.1 (SMESG000066332.1)

HSP 1 Score: 218.009 bits (554), Expect = 1.151e-69
Identity = 132/132 (100.00%), Postives = 132/132 (100.00%), Query Frame = 1
Query:  967 MTEXXXXXXXXXXXVFAIDNRKSFDELKFXXXXXXXXXXXXXXXXLIGNKSDLEGIFEIQDCKSLQYNIGCQEFRMISAKTGEGFQDLLNCVANHWIDTKMSHNRSLMKASSITPEEQYNCWNSFFNCCALL 1362
            MTESFFINSNIIFFVFAIDNRKSFDELKFINENVCKVVNKEVIKVLIGNKSDLEGIFEIQDCKSLQYNIGCQEFRMISAKTGEGFQDLLNCVANHWIDTKMSHNRSLMKASSITPEEQYNCWNSFFNCCALL
Sbjct:    1 MTESFFINSNIIFFVFAIDNRKSFDELKFINENVCKVVNKEVIKVLIGNKSDLEGIFEIQDCKSLQYNIGCQEFRMISAKTGEGFQDLLNCVANHWIDTKMSHNRSLMKASSITPEEQYNCWNSFFNCCALL 132          
The following BLAST results are available for this feature:
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OXSM1.006e-6438.593-oxoacyl-ACP synthase, mitochondrial [Source:HGNC... [more]
OXSM2.093e-2732.993-oxoacyl-ACP synthase, mitochondrial [Source:HGNC... [more]
OXSM2.843e-2532.143-oxoacyl-ACP synthase, mitochondrial [Source:HGNC... [more]
OXSM8.983e-2431.693-oxoacyl-ACP synthase, mitochondrial [Source:HGNC... [more]
FASN1.422e-1225.70fatty acid synthase [Source:HGNC Symbol;Acc:HGNC:3... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
F10G8.99.247e-4535.92pep chromosome:WBcel235:I:10048087:10050770:1 gene... [more]
F10G8.93.419e-3144.74pep chromosome:WBcel235:I:10049055:10050703:1 gene... [more]
fasn-12.644e-1126.40Fatty Acid SyNthase [Source:UniProtKB/TrEMBL;Acc:... [more]
pks-13.914e-728.68PolyKetide Synthase [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG121702.502e-7946.43gene:FBgn0037356 transcript:FBtr0078709[more]
FASN31.407e-933.33gene:FBgn0040001 transcript:FBtr0305959[more]
FASN15.943e-923.83gene:FBgn0283427 transcript:FBtr0335387[more]
FASN16.797e-923.83gene:FBgn0283427 transcript:FBtr0077659[more]
FASN24.151e-724.77gene:FBgn0042627 transcript:FBtr0077657[more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oxsm1.511e-6940.383-oxoacyl-ACP synthase, mitochondrial [Source:ZFIN... [more]
fasn7.930e-1225.00fatty acid synthase [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
fasn7.930e-1225.00fatty acid synthase [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
si:dkey-61p9.111.102e-724.23si:dkey-61p9.11 [Source:ZFIN;Acc:ZDB-GENE-041210-2... [more]
si:dkey-61p9.111.134e-724.23si:dkey-61p9.11 [Source:ZFIN;Acc:ZDB-GENE-041210-2... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oxsm5.901e-7040.713-oxoacyl-ACP synthase, mitochondrial [Source:NCBI... [more]
tmem1005.022e-923.36transmembrane protein 100 [Source:Xenbase;Acc:XB-G... [more]
tmem1005.209e-923.36transmembrane protein 100 [Source:Xenbase;Acc:XB-G... [more]
tmem1005.377e-923.36transmembrane protein 100 [Source:Xenbase;Acc:XB-G... [more]
tmem1005.384e-923.36transmembrane protein 100 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Oxsm6.416e-6639.503-oxoacyl-ACP synthase, mitochondrial [Source:MGI ... [more]
Oxsm6.416e-6639.503-oxoacyl-ACP synthase, mitochondrial [Source:MGI ... [more]
Oxsm6.416e-6639.503-oxoacyl-ACP synthase, mitochondrial [Source:MGI ... [more]
Fasn2.471e-924.60fatty acid synthase [Source:MGI Symbol;Acc:MGI:954... [more]
Fasn2.492e-924.60fatty acid synthase [Source:MGI Symbol;Acc:MGI:954... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D404|OXSM_MOUSE4.488e-6539.503-oxoacyl-[acyl-carrier-protein] synthase, mitocho... [more]
sp|Q0VCA7|OXSM_BOVIN4.648e-6539.743-oxoacyl-[acyl-carrier-protein] synthase, mitocho... [more]
sp|Q9NWU1|OXSM_HUMAN4.833e-6438.593-oxoacyl-[acyl-carrier-protein] synthase, mitocho... [more]
sp|O94297|OXSM_SCHPO1.052e-5836.08Putative 3-oxoacyl-[acyl-carrier-protein] synthase... [more]
sp|P56902|FABF_RHIME1.154e-5436.623-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhi... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q9VNF57.434e-7646.433-oxoacyl-[acyl-carrier-protein] synthase OS=Droso... [more]
Q8IGI41.369e-7546.43RH10820p (Fragment) OS=Drosophila melanogaster OX=... [more]
A0A084W0111.825e-7543.693-oxoacyl-[acyl-carrier-protein] synthase OS=Anoph... [more]
A0A0L0BY775.629e-7444.633-oxoacyl-[acyl-carrier-protein] synthase OS=Lucil... [more]
A0A1B6JI211.297e-7343.513-oxoacyl-[acyl-carrier-protein] synthase OS=Homal... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oxsm1.788e-6438.413-oxoacyl-ACP synthase, mitochondrial [Source:NCBI... [more]
fasn2.468e-1225.40fatty acid synthase [Source:NCBI gene;Acc:10303061... [more]
ENSAMXT00000055595.15.542e-925.13pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000046746.16.271e-930.30pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
si:dkey-61p9.115.781e-822.45phthioceranic/hydroxyphthioceranic acid synthase-l... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oxsm1.424e-5636.423-oxoacyl-ACP synthase, mitochondrial [Source:ZFIN... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CEM11.737e-5035.47Mitochondrial beta-keto-acyl synthase; possible ro... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO372893.764e-4737.343-oxoacyl-[acyl-carrier-protein] synthase [Source... [more]
EDO255499.249e-3632.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO268921.585e-3538.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO260775.949e-2234.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
oxsm8.265e-6841.213-oxoacyl-ACP synthase, mitochondrial [Source:NCBI... [more]
si:dkey-61p9.114.349e-1126.18equisetin synthetase eqxS [Source:NCBI gene;Acc:10... [more]
olpks1.346e-927.17probable polyketide synthase 16 [Source:NCBI gene;... [more]
ENSORLT00000004542.26.219e-924.61probable polyketide synthase 1 [Source:NCBI gene;A... [more]
back to top
BLAST of 3-oxoacyl-[acyl-carrier-protein] synthase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066335.11.674e-2298.37SMESG000066335.1[more]
SMESG000066335.11.708e-2298.37SMESG000066335.1[more]
SMESG000066335.10.000e+098.37SMESG000066335.1[more]
SMESG000066335.10.000e+098.37SMESG000066335.1[more]
SMESG000066332.11.151e-69100.00SMESG000066332.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004140 ID=SMED30004140|Name=3-oxoacyl-[acyl-carrier-protein] synthase|organism=Schmidtea mediterranea sexual|type=transcript|length=1379bp
TGTTTTATATAAAATTGAATGAATCGTGTAGTAGTAACTGGAATTGGAGT
AATTTGTTCACTGGGCAATACAAGTAAAGATGTATGGTCTAAATTAATTT
TAGGTCATTCAGAAGTAAACATCTTATCCGATTTATATGCTCATCTTCCG
TGTCGAATTGCTTCTGAAATAAATGAGGATAATTTCCAATTGATTCAAAA
ACAATGTTTAACACCCAATGAATTTAAGACGATGTCTCGATCATCTGTAT
TAATGATGAAAGCTTCGTCTGAAGCAATGTCGAATGCAGGATTTACCGAT
AATTTAAGCGTGGAAAATCTCGACAGATTTGGCGTTAGTGTTGGAATTGG
ATTCGACGGGGTGATCAATTCTATTGAATCTCATCAAGTAAAAAATGGAT
ATTTGCCGTATTCTGTGATTGGTCCATACGCATTGACCCGTGGATTGGGA
AACATGCCAGCAGCGCATTTGTGTGTGAGGTACAAATTACGAGGGCCATC
TCGGTCGGTCAATACTGCTTGTGCTGCTGGGTTGCACGCGATTGGTGACG
CGTTCAGATCCATAGAAATCGGTGAGGCTGATTTCATGCTGGCAGGAGGT
GTGGAAGCCTCCATCAGCCCTTGGTCTATTGCAGCCTTCAGTAGAATTCG
AGCTTTGCCCACTAAATACAATGACGATCCAAATAGCGCGTCCCGTCCTT
TTGATACCGACAGATCGGGCTTTGTAATGGCTGAAGGGGCCGGTGCATTG
GTGCTCGAATCTCTCACCCATGCGGTTAAGGGAGCCCGACTACCGCTGGT
GGAAATTGTCGGATTTGGTCAGTCTGGTGACGGGTACAGCTTGGTTGCTC
CTGATACCAATGGAGATGGAGCATATCGCGCCATGAAAGCTGCCATTGAA
TCCGCTAAAATCGGGCCGGAAATGTTTGAATTCGTAGATACGGGAGGCAT
GGAAAAATTCAGAACAATGACTGAAAGTTTTTTTATAAATTCCAATATCA
TCTTTTTTGTATTTGCTATTGACAATAGAAAATCATTTGATGAGTTAAAA
TTTATAAATGAAAATGTCTGTAAAGTTGTCAACAAAGAAGTTATTAAAGT
GTTAATTGGTAATAAGAGTGATCTTGAAGGAATTTTTGAAATCCAAGATT
GTAAAAGCCTGCAATACAACATTGGATGCCAGGAATTCCGGATGATTTCC
GCTAAAACAGGTGAAGGATTCCAAGATTTGTTGAACTGCGTAGCGAATCA
CTGGATTGACACAAAAATGTCCCATAATCGTAGTTTAATGAAAGCTTCGT
CAATAACACCAGAAGAACAATATAATTGCTGGAATTCATTTTTCAATTGT
TGTGCATTATTGTAAAATATTTGAATATA
back to top

protein sequence of SMED30004140-orf-1

>SMED30004140-orf-1 ID=SMED30004140-orf-1|Name=SMED30004140-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=449bp
MNRVVVTGIGVICSLGNTSKDVWSKLILGHSEVNILSDLYAHLPCRIASE
INEDNFQLIQKQCLTPNEFKTMSRSSVLMMKASSEAMSNAGFTDNLSVEN
LDRFGVSVGIGFDGVINSIESHQVKNGYLPYSVIGPYALTRGLGNMPAAH
LCVRYKLRGPSRSVNTACAAGLHAIGDAFRSIEIGEADFMLAGGVEASIS
PWSIAAFSRIRALPTKYNDDPNSASRPFDTDRSGFVMAEGAGALVLESLT
HAVKGARLPLVEIVGFGQSGDGYSLVAPDTNGDGAYRAMKAAIESAKIGP
EMFEFVDTGGMEKFRTMTESFFINSNIIFFVFAIDNRKSFDELKFINENV
CKVVNKEVIKVLIGNKSDLEGIFEIQDCKSLQYNIGCQEFRMISAKTGEG
FQDLLNCVANHWIDTKMSHNRSLMKASSITPEEQYNCWNSFFNCCALL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR000794Beta-ketoacyl_synthase
IPR020841PKS_Beta-ketoAc_synthase_dom
IPR016039Thiolase-like
IPR001806Small_GTPase
IPR014030Ketoacyl_synth_N
IPR027417P-loop_NTPase
IPR018201Ketoacyl_synth_AS
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0003824catalytic activity
GO:0005525GTP binding
GO:0016740transferase activity
GO:0016747transferase activity, transferring acyl groups other than amino-acyl groups
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0007264small GTPase mediated signal transduction
GO:0006633fatty acid biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 260..414
e-value: 3.4E-4
score: -57.4
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 257..410
e-value: 7.7E-4
score: -50.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 274..438
e-value: 4.5E-24
score: 86.7
NoneNo IPR availablePANTHERPTHR11712:SF2973-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE, MITOCHONDRIALcoord: 2..310
NoneNo IPR availablePROSITEPS51419RABcoord: 226..444
score: 9.546
NoneNo IPR availableCDDcd00834KAS_I_IIcoord: 1..300
e-value: 1.40553E-100
score: 304.461
IPR020841Polyketide synthase, beta-ketoacyl synthase domainSMARTSM00825PKS_KScoord: 3..344
e-value: 1.5E-6
score: -167.0
IPR016039Thiolase-likeGENE3DG3DSA:3.40.47.10coord: 1..257
e-value: 2.2E-66
score: 226.2
IPR016039Thiolase-likeSUPERFAMILYSSF53901Thiolase-likecoord: 1..253
IPR014030Beta-ketoacyl synthase, N-terminalPFAMPF00109ketoacyl-syntcoord: 1..251
e-value: 2.5E-46
score: 158.3
IPR001806Small GTPasePFAMPF00071Rascoord: 301..409
e-value: 3.1E-17
score: 62.6
IPR000794Beta-ketoacyl synthasePANTHERPTHR11712POLYKETIDE SYNTHASE-RELATEDcoord: 2..310
IPR018201Beta-ketoacyl synthase, active sitePROSITEPS00606B_KETOACYL_SYNTHASEcoord: 158..174
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 300..419