WD_REPEATS_REGION domain-containing protein

Overview
NameWD_REPEATS_REGION domain-containing protein
Smed IDSMED30004137
Length (bp)1099
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD_REPEATS_REGION domain-containing protein (SMED30004137) t-SNE clustered cells

Violin plots show distribution of expression levels for WD_REPEATS_REGION domain-containing protein (SMED30004137) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD_REPEATS_REGION domain-containing protein (SMED30004137) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD_REPEATS_REGION domain-containing protein (SMED30004137) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004137

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30004137h1SMcG0014432 SmedASXL_012261SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30004137h1SMcG0014432 SmedASXL_012261SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: THOC6 (THO complex 6 [Source:HGNC Symbol;Acc:HGNC:28369])

HSP 1 Score: 103.605 bits (257), Expect = 2.319e-24
Identity = 84/353 (23.80%), Postives = 157/353 (44.48%), Query Frame = 1
Query:   52 MKDVMKSHLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSSTT--------ASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILR-----DEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL 1068
             + + + H+  +S + SPC  +LA  NN+  I I +L+    S  K  S             +Y++ +    L+   D  + AW W+++    C +       ++  L +       +  + +   E  +I+  G  D  +H   + + G+   +   + + + + CL  + +   ++SG  DG VR WD R +KE   IE  K  E  RP  G  I  +ATD   SDW++CGG   L+LW++R+             T     P+ A  +      +++++ G    V  W LSG+L +++  ++   +   L+++ +   A  C      G    V++++++GYR   FSL
Sbjct:   17 FQALQRLHMTIFSQSVSPCGKFLAAGNNYGQIAIFSLSSALSSEAKEESKKPVVTFQAHDGPVYSMVSTDRHLLSAGDGEVKAWLWAEMLKKGCKELWRRQPPYRTSLEVPE-----INALLLVPKENSLILAGG--DCQLHTMDL-ETGTFTRV--LRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRTAKEVQTIEVYKHEECSRPHNGRWIGCLATD---SDWMVCGGGPALTLWHLRSS------------TPTTIFPIRAPQKHVTFYQDLILSAGQGRCVNQWQLSGELKAQVPGSSPGLLSLSLNQQPA---APECKVLTAAGNSCRVDVFTNLGYRA--FSL 339          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: THOC6 (THO complex 6 [Source:HGNC Symbol;Acc:HGNC:28369])

HSP 1 Score: 100.138 bits (248), Expect = 2.366e-23
Identity = 81/337 (24.04%), Postives = 149/337 (44.21%), Query Frame = 1
Query:   85 YSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSSTT--------ASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL 1068
            +S + SPC  +LA  NN+  I I +L+    S  K  S             +Y++ +    L+   D  + AW W+++    C +       ++  L +       +  + +   E  +I+  G  D  +H   + + G+   +   + + + + CL  + +   ++SG  DG VR WD R +KE   IE  K  E  RP  G  I  +ATD   SDW++CGG   L+LW++R+     +      P              +++++ G    V  W LSG+L +++  ++   +   L+++ +   A  C      G    V++++++GYR   FSL
Sbjct:    4 FSQSVSPCGKFLAAGNNYGQIAIFSLSSALSSEAKEESKKPVVTFQAHDGPVYSMVSTDRHLLSAGDGEVKAWLWAEMLKKGCKELWRRQPPYRTSLEVPE-----INALLLVPKENSLILAGG--DCQLHTMDL-ETGTFTRV--LRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRTAKEVQTIEVYKHEECSRPHNGRWIGCLATD---SDWMVCGGGPALTLWHLRSSTPTTIFPI-RAPQKH------VTFYQDLILSAGQGRCVNQWQLSGELKAQVPGSSPGLLSLSLNQQPA---APECKVLTAAGNSCRVDVFTNLGYRA--FSL 315          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: THOC6 (THO complex 6 [Source:HGNC Symbol;Acc:HGNC:28369])

HSP 1 Score: 100.138 bits (248), Expect = 2.366e-23
Identity = 81/337 (24.04%), Postives = 149/337 (44.21%), Query Frame = 1
Query:   85 YSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSSTT--------ASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL 1068
            +S + SPC  +LA  NN+  I I +L+    S  K  S             +Y++ +    L+   D  + AW W+++    C +       ++  L +       +  + +   E  +I+  G  D  +H   + + G+   +   + + + + CL  + +   ++SG  DG VR WD R +KE   IE  K  E  RP  G  I  +ATD   SDW++CGG   L+LW++R+     +      P              +++++ G    V  W LSG+L +++  ++   +   L+++ +   A  C      G    V++++++GYR   FSL
Sbjct:    4 FSQSVSPCGKFLAAGNNYGQIAIFSLSSALSSEAKEESKKPVVTFQAHDGPVYSMVSTDRHLLSAGDGEVKAWLWAEMLKKGCKELWRRQPPYRTSLEVPE-----INALLLVPKENSLILAGG--DCQLHTMDL-ETGTFTRV--LRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRTAKEVQTIEVYKHEECSRPHNGRWIGCLATD---SDWMVCGGGPALTLWHLRSSTPTTIFPI-RAPQKH------VTFYQDLILSAGQGRCVNQWQLSGELKAQVPGSSPGLLSLSLNQQPA---APECKVLTAAGNSCRVDVFTNLGYRA--FSL 315          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: THOC6 (THO complex 6 [Source:HGNC Symbol;Acc:HGNC:28369])

HSP 1 Score: 92.4337 bits (228), Expect = 1.137e-20
Identity = 72/284 (25.35%), Postives = 124/284 (43.66%), Query Frame = 1
Query:   52 MKDVMKSHLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSSTT--------ASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRV 876
             + + + H+  +S + SPC  +LA  NN+  I I +L+    S  K  S             +Y++ +    L+   D  + AW W+++    C +       ++  L +       +  + +   E  +I+  G  D  +H   + + G+   +   + + + + CL  + +   ++SG  DG VR WD R +KE   IE  K  E  RP  G  I  +ATD   SDW++CGG   L+LW++R+     +      P            +D V+ A GNS RV
Sbjct:   17 FQALQRLHMTIFSQSVSPCGKFLAAGNNYGQIAIFSLSSALSSEAKEESKKPVVTFQAHDGPVYSMVSTDRHLLSAGDGEVKAWLWAEMLKKGCKELWRRQPPYRTSLEVPE-----INALLLVPKENSLILAGG--DCQLHTMDL-ETGTFTRV--LRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRTAKEVQTIEVYKHEECSRPHNGRWIGCLATD---SDWMVCGGGPALTLWHLRSSTPTTIFPI-RAPQKHV-----TFYQDLVLTAAGNSCRV 281          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Match: thoc6 (gene:FBgn0036263 transcript:FBtr0076019)

HSP 1 Score: 83.5741 bits (205), Expect = 1.140e-17
Identity = 72/306 (23.53%), Postives = 134/306 (43.79%), Query Frame = 1
Query:   49 KMKDVMKSHLINYSMTFSPCQNYLAISNNFNSI---KILNLNDGTES----LIKCSSSTTASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLTKGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKP-----TDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAAT 930
            K KD+ +++    +   S  + YL   N F  I   +I  L+ G+E     L      +   I  +      L+  +   IY  +W++ E ++ ++       ++  +P+  + V    + SM+++  + I+  GC DG I+   + ++G I+    Y+ + + V  +       + SG  DGTVR W  +Q +    +E  K+P + RP  G  I  +A +    DW+LCGG  + S++++R+     V     +       DDC            V+ GG  + V  + L+G L + I +  T
Sbjct:    2 KQKDLKRAYNNVLAQAISGSKQYLFAGNLFGDIFVLRIKELDKGSEEPPGKLKIFPQGSDVDINYLAFHRDFLIVGAVGLIYGLEWNEEEESLATKRS-----WEVKIPMQVDAVEVPDVNSMWLDSENSILFAGCGDGVIYQVSL-EDGRIQ--REYRGHTDYVHSVVGNANGQIFSGAEDGTVRVWSTKQQQHTSMLEPYKNPNLLRPDWGKWIGAVAVN---EDWLLCGGGPKASIFHLRSMESTCVFSFPGRVHLCDFVDDC------------VLIGGEHNHVQSYTLNGVLQANIPVEHT 284          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Match: thoc6 (gene:FBgn0036263 transcript:FBtr0333384)

HSP 1 Score: 83.5741 bits (205), Expect = 1.140e-17
Identity = 72/306 (23.53%), Postives = 134/306 (43.79%), Query Frame = 1
Query:   49 KMKDVMKSHLINYSMTFSPCQNYLAISNNFNSI---KILNLNDGTES----LIKCSSSTTASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLTKGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKP-----TDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAAT 930
            K KD+ +++    +   S  + YL   N F  I   +I  L+ G+E     L      +   I  +      L+  +   IY  +W++ E ++ ++       ++  +P+  + V    + SM+++  + I+  GC DG I+   + ++G I+    Y+ + + V  +       + SG  DGTVR W  +Q +    +E  K+P + RP  G  I  +A +    DW+LCGG  + S++++R+     V     +       DDC            V+ GG  + V  + L+G L + I +  T
Sbjct:    2 KQKDLKRAYNNVLAQAISGSKQYLFAGNLFGDIFVLRIKELDKGSEEPPGKLKIFPQGSDVDINYLAFHRDFLIVGAVGLIYGLEWNEEEESLATKRS-----WEVKIPMQVDAVEVPDVNSMWLDSENSILFAGCGDGVIYQVSL-EDGRIQ--REYRGHTDYVHSVVGNANGQIFSGAEDGTVRVWSTKQQQHTSMLEPYKNPNLLRPDWGKWIGAVAVN---EDWLLCGGGPKASIFHLRSMESTCVFSFPGRVHLCDFVDDC------------VLIGGEHNHVQSYTLNGVLQANIPVEHT 284          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Match: thoc6 (gene:FBgn0036263 transcript:FBtr0346911)

HSP 1 Score: 83.5741 bits (205), Expect = 1.140e-17
Identity = 72/306 (23.53%), Postives = 134/306 (43.79%), Query Frame = 1
Query:   49 KMKDVMKSHLINYSMTFSPCQNYLAISNNFNSI---KILNLNDGTES----LIKCSSSTTASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLTKGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKP-----TDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAAT 930
            K KD+ +++    +   S  + YL   N F  I   +I  L+ G+E     L      +   I  +      L+  +   IY  +W++ E ++ ++       ++  +P+  + V    + SM+++  + I+  GC DG I+   + ++G I+    Y+ + + V  +       + SG  DGTVR W  +Q +    +E  K+P + RP  G  I  +A +    DW+LCGG  + S++++R+     V     +       DDC            V+ GG  + V  + L+G L + I +  T
Sbjct:    2 KQKDLKRAYNNVLAQAISGSKQYLFAGNLFGDIFVLRIKELDKGSEEPPGKLKIFPQGSDVDINYLAFHRDFLIVGAVGLIYGLEWNEEEESLATKRS-----WEVKIPMQVDAVEVPDVNSMWLDSENSILFAGCGDGVIYQVSL-EDGRIQ--REYRGHTDYVHSVVGNANGQIFSGAEDGTVRVWSTKQQQHTSMLEPYKNPNLLRPDWGKWIGAVAVN---EDWLLCGGGPKASIFHLRSMESTCVFSFPGRVHLCDFVDDC------------VLIGGEHNHVQSYTLNGVLQANIPVEHT 284          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: thoc6 (THO complex 6 [Source:NCBI gene;Acc:100004014])

HSP 1 Score: 105.531 bits (262), Expect = 2.170e-25
Identity = 82/274 (29.93%), Postives = 127/274 (46.35%), Query Frame = 1
Query:   52 MKDVMKSHLINYSMTFSPCQNYLAISNNFNSIKILNLN-----DGTESLIKCSSSTTA---SIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEV 846
            M  V   H+  +S +FSPC  YLA  NN+  I + +L+     D +E   K   + TA    ++++ +  S L+   +  I AW W+++              ++  L I        +I +M IN  D  + +G  D NIH   I+D  +    +  K + + + CL+ K +   ++SG  DG VR WD R ++    IE  K  E  RP+ G  I+ +ATD   SDW+LCGG   LSLW++R+     V             PLS   R+ V
Sbjct:    1 MGPVELLHMSVFSQSFSPCGRYLAAGNNYGEIAVFSLSAALSPDASERSQKPILNFTAHDGPVFSLLSTESHLLSAGNGEISAWSWAELIKKSTKAAWTRKPNYETSLEIP-------EINAMIINPKDNNLIVGGGDNNIH---IMDMETGTFKSVLKGHTDYIHCLSFKEREGEILSGGEDGAVRIWDSRTNRPVHCIEVFKYEECARPQFGKWISCLATD---SDWMLCGGGPSLSLWHLRSMSPTSV------------FPLSGCQREAV 249          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: thoc6 (THO complex 6 [Source:NCBI gene;Acc:100004014])

HSP 1 Score: 105.531 bits (262), Expect = 2.170e-25
Identity = 82/274 (29.93%), Postives = 127/274 (46.35%), Query Frame = 1
Query:   52 MKDVMKSHLINYSMTFSPCQNYLAISNNFNSIKILNLN-----DGTESLIKCSSSTTA---SIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEV 846
            M  V   H+  +S +FSPC  YLA  NN+  I + +L+     D +E   K   + TA    ++++ +  S L+   +  I AW W+++              ++  L I        +I +M IN  D  + +G  D NIH   I+D  +    +  K + + + CL+ K +   ++SG  DG VR WD R ++    IE  K  E  RP+ G  I+ +ATD   SDW+LCGG   LSLW++R+     V             PLS   R+ V
Sbjct:    1 MGPVELLHMSVFSQSFSPCGRYLAAGNNYGEIAVFSLSAALSPDASERSQKPILNFTAHDGPVFSLLSTESHLLSAGNGEISAWSWAELIKKSTKAAWTRKPNYETSLEIP-------EINAMIINPKDNNLIVGGGDNNIH---IMDMETGTFKSVLKGHTDYIHCLSFKEREGEILSGGEDGAVRIWDSRTNRPVHCIEVFKYEECARPQFGKWISCLATD---SDWMLCGGGPSLSLWHLRSMSPTSV------------FPLSGCQREAV 249          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: thoc6 (THO complex 6 [Source:NCBI gene;Acc:100004014])

HSP 1 Score: 105.531 bits (262), Expect = 2.170e-25
Identity = 82/274 (29.93%), Postives = 127/274 (46.35%), Query Frame = 1
Query:   52 MKDVMKSHLINYSMTFSPCQNYLAISNNFNSIKILNLN-----DGTESLIKCSSSTTA---SIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEV 846
            M  V   H+  +S +FSPC  YLA  NN+  I + +L+     D +E   K   + TA    ++++ +  S L+   +  I AW W+++              ++  L I        +I +M IN  D  + +G  D NIH   I+D  +    +  K + + + CL+ K +   ++SG  DG VR WD R ++    IE  K  E  RP+ G  I+ +ATD   SDW+LCGG   LSLW++R+     V             PLS   R+ V
Sbjct:    1 MGPVELLHMSVFSQSFSPCGRYLAAGNNYGEIAVFSLSAALSPDASERSQKPILNFTAHDGPVFSLLSTESHLLSAGNGEISAWSWAELIKKSTKAAWTRKPNYETSLEIP-------EINAMIINPKDNNLIVGGGDNNIH---IMDMETGTFKSVLKGHTDYIHCLSFKEREGEILSGGEDGAVRIWDSRTNRPVHCIEVFKYEECARPQFGKWISCLATD---SDWMLCGGGPSLSLWHLRSMSPTSV------------FPLSGCQREAV 249          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: thoc6 (THO complex 6 [Source:NCBI gene;Acc:100004014])

HSP 1 Score: 90.1225 bits (222), Expect = 6.690e-20
Identity = 78/275 (28.36%), Postives = 122/275 (44.36%), Query Frame = 1
Query:   52 MKDVMKSHLINYSMTFSPCQNYLAISNNFNSIKILNLN-----DGTESLIKCSSSTTA---SIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDK-SPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEV 846
            M  V   H+  +S +FSPC  YLA  NN+  I + +L+     D +E   K   + TA    ++++ +  S L+   +  I AW W+++              ++  L I        +I +M IN  D  + +G  D NIH   I+D  +    +  K + + + CL+ K +   ++SG  DG VR W        L +       E  RP+ G  I+ +ATD   SDW+LCGG   LSLW++R+     V             PLS   R+ V
Sbjct:    1 MGPVELLHMSVFSQSFSPCGRYLAAGNNYGEIAVFSLSAALSPDASERSQKPILNFTAHDGPVFSLLSTESHLLSAGNGEISAWSWAELIKKSTKAAWTRKPNYETSLEIP-------EINAMIINPKDNNLIVGGGDNNIH---IMDMETGTFKSVLKGHTDYIHCLSFKEREGEILSGGEDGAVRIWGHIDVSFSLTVSFFHWGQECARPQFGKWISCLATD---SDWMLCGGGPSLSLWHLRSMSPTSV------------FPLSGCQREAV 250          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: thoc6 (THO complex 6 [Source:NCBI gene;Acc:100004014])

HSP 1 Score: 90.1225 bits (222), Expect = 6.690e-20
Identity = 78/275 (28.36%), Postives = 122/275 (44.36%), Query Frame = 1
Query:   52 MKDVMKSHLINYSMTFSPCQNYLAISNNFNSIKILNLN-----DGTESLIKCSSSTTA---SIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDK-SPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEV 846
            M  V   H+  +S +FSPC  YLA  NN+  I + +L+     D +E   K   + TA    ++++ +  S L+   +  I AW W+++              ++  L I        +I +M IN  D  + +G  D NIH   I+D  +    +  K + + + CL+ K +   ++SG  DG VR W        L +       E  RP+ G  I+ +ATD   SDW+LCGG   LSLW++R+     V             PLS   R+ V
Sbjct:    1 MGPVELLHMSVFSQSFSPCGRYLAAGNNYGEIAVFSLSAALSPDASERSQKPILNFTAHDGPVFSLLSTESHLLSAGNGEISAWSWAELIKKSTKAAWTRKPNYETSLEIP-------EINAMIINPKDNNLIVGGGDNNIH---IMDMETGTFKSVLKGHTDYIHCLSFKEREGEILSGGEDGAVRIWGHIDVSFSLTVSFFHWGQECARPQFGKWISCLATD---SDWMLCGGGPSLSLWHLRSMSPTSV------------FPLSGCQREAV 250          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: THOC6 (THO complex 6 [Source:NCBI gene;Acc:100498236])

HSP 1 Score: 101.293 bits (251), Expect = 1.186e-23
Identity = 89/342 (26.02%), Postives = 153/342 (44.74%), Query Frame = 1
Query:   73 HLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSS--------STTASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFT-CGWGAYVELYSDIGYRKKIFSL 1068
            H+  +S  FSPC  YL   NN   I + +L+    S  K  S        + +  IY++ +    L+ +    +  W W+DI    C+Q      L+   +P  +      +I SM +NE D  + +     NIH    +D  S       + + + + CL  + +    +SG  DGTVR WD R   +  +IE  K  E  RP+ G  I+ + TD   SDW++CGG  +LSLW++R+     V  T   P ++       +   ++++  G    V    ++G + ++I  +    V+ +     S ++A   N   T  G G  ++++++  YR   FSL
Sbjct:   17 HMTVFSQCFSPCGKYLVAGNNLGQIGVFSLSAALSSEAKELSKQPVAIFQAHSGPIYSLISTERHLISSGGNEVKGWNWNDIHKKGCTQ------LWTRCIPSRSNLES-PEINSMILNEKDNSLLLAGGTCNIH---SMDLESGTFTMALEGHEDYIHCLALREQQRECVSGGEDGTVRIWDLRNGAQTHKIEVYKYEECARPQYGKWISCLTTD---SDWMVCGGGPKLSLWHLRS-----VTPTTIFPLNES--QQQVMFYQDMILCAGQGPYVNHCQINGDIKAQIP-STPRCVYSL-----SVNEASQENKVLTAAGSGPKIDVFTNFRYRA--FSL 330          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: THOC6 (THO complex 6 [Source:NCBI gene;Acc:100498236])

HSP 1 Score: 101.293 bits (251), Expect = 1.377e-23
Identity = 89/342 (26.02%), Postives = 153/342 (44.74%), Query Frame = 1
Query:   73 HLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSS--------STTASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFT-CGWGAYVELYSDIGYRKKIFSL 1068
            H+  +S  FSPC  YL   NN   I + +L+    S  K  S        + +  IY++ +    L+ +    +  W W+DI    C+Q      L+   +P  +      +I SM +NE D  + +     NIH    +D  S       + + + + CL  + +    +SG  DGTVR WD R   +  +IE  K  E  RP+ G  I+ + TD   SDW++CGG  +LSLW++R+     V  T   P ++       +   ++++  G    V    ++G + ++I  +    V+ +     S ++A   N   T  G G  ++++++  YR   FSL
Sbjct:   15 HMTVFSQCFSPCGKYLVAGNNLGQIGVFSLSAALSSEAKELSKQPVAIFQAHSGPIYSLISTERHLISSGGNEVKGWNWNDIHKKGCTQ------LWTRCIPSRSNLES-PEINSMILNEKDNSLLLAGGTCNIH---SMDLESGTFTMALEGHEDYIHCLALREQQRECVSGGEDGTVRIWDLRNGAQTHKIEVYKYEECARPQYGKWISCLTTD---SDWMVCGGGPKLSLWHLRS-----VTPTTIFPLNES--QQQVMFYQDMILCAGQGPYVNHCQINGDIKAQIP-STPRCVYSL-----SVNEASQENKVLTAAGSGPKIDVFTNFRYRA--FSL 328          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: THOC6 (THO complex 6 [Source:NCBI gene;Acc:100498236])

HSP 1 Score: 101.293 bits (251), Expect = 1.832e-23
Identity = 89/342 (26.02%), Postives = 153/342 (44.74%), Query Frame = 1
Query:   73 HLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSS--------STTASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFT-CGWGAYVELYSDIGYRKKIFSL 1068
            H+  +S  FSPC  YL   NN   I + +L+    S  K  S        + +  IY++ +    L+ +    +  W W+DI    C+Q      L+   +P  +      +I SM +NE D  + +     NIH    +D  S       + + + + CL  + +    +SG  DGTVR WD R   +  +IE  K  E  RP+ G  I+ + TD   SDW++CGG  +LSLW++R+     V  T   P ++       +   ++++  G    V    ++G + ++I  +    V+ +     S ++A   N   T  G G  ++++++  YR   FSL
Sbjct:   36 HMTVFSQCFSPCGKYLVAGNNLGQIGVFSLSAALSSEAKELSKQPVAIFQAHSGPIYSLISTERHLISSGGNEVKGWNWNDIHKKGCTQ------LWTRCIPSRSNLES-PEINSMILNEKDNSLLLAGGTCNIH---SMDLESGTFTMALEGHEDYIHCLALREQQRECVSGGEDGTVRIWDLRNGAQTHKIEVYKYEECARPQYGKWISCLTTD---SDWMVCGGGPKLSLWHLRS-----VTPTTIFPLNES--QQQVMFYQDMILCAGQGPYVNHCQINGDIKAQIP-STPRCVYSL-----SVNEASQENKVLTAAGSGPKIDVFTNFRYRA--FSL 349          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: THOC6 (THO complex 6 [Source:NCBI gene;Acc:100498236])

HSP 1 Score: 95.5153 bits (236), Expect = 1.584e-21
Identity = 88/343 (25.66%), Postives = 153/343 (44.61%), Query Frame = 1
Query:   73 HLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSS--------STTASIYNIGNCGSLLVGTSDCYIYAWKWSDI-EINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFT-CGWGAYVELYSDIGYRKKIFSL 1068
            H+  +S  FSPC  YL   NN   I + +L+    S  K  S        + +  IY++ +    L+ +    +  W W+DI + N  +  +  D  F +        +   +I SM +NE D  + +     NIH    +D  S       + + + + CL  + +    +SG  DGTVR WD R   +  +IE  K  E  RP+ G  I+ + TD   SDW++CGG  +LSLW++R+     V  T   P ++       +   ++++  G    V    ++G + ++I  +    V+ +     S ++A   N   T  G G  ++++++  YR   FSL
Sbjct:   29 HMTVFSQCFSPCGKYLVAGNNLGQIGVFSLSAALSSEAKELSKQPVAIFQAHSGPIYSLISTERHLISSGGNEVKGWNWNDIHKKNQKALFQSADFFFLSF----RSNLESPEINSMILNEKDNSLLLAGGTCNIH---SMDLESGTFTMALEGHEDYIHCLALREQQRECVSGGEDGTVRIWDLRNGAQTHKIEVYKYEECARPQYGKWISCLTTD---SDWMVCGGGPKLSLWHLRS-----VTPTTIFPLNES--QQQVMFYQDMILCAGQGPYVNHCQINGDIKAQIP-STPRCVYSL-----SVNEASQENKVLTAAGSGPKIDVFTNFRYRA--FSL 346          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: THOC6 (THO complex 6 [Source:NCBI gene;Acc:100498236])

HSP 1 Score: 92.8189 bits (229), Expect = 9.912e-21
Identity = 87/342 (25.44%), Postives = 149/342 (43.57%), Query Frame = 1
Query:   73 HLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSS--------STTASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFT-CGWGAYVELYSDIGYRKKIFSL 1068
            H+  +S  FSPC  YL   NN   I + +L+    S  K  S        + +  IY++ +    L+ +    +  W W+DI      +   L+S                +I SM +NE D  + +     NIH    +D  S       + + + + CL  + +    +SG  DGTVR WD R   +  +IE  K  E  RP+ G  I+ + TD   SDW++CGG  +LSLW++R+     V  T   P ++       +   ++++  G    V    ++G + ++I  +    V+ +     S ++A   N   T  G G  ++++++  YR   FSL
Sbjct:    8 HMTVFSQCFSPCGKYLVAGNNLGQIGVFSLSAALSSEAKELSKQPVAIFQAHSGPIYSLISTERHLISSGGNEVKGWNWNDIH----KKVGNLESP---------------EINSMILNEKDNSLLLAGGTCNIH---SMDLESGTFTMALEGHEDYIHCLALREQQRECVSGGEDGTVRIWDLRNGAQTHKIEVYKYEECARPQYGKWISCLTTD---SDWMVCGGGPKLSLWHLRS-----VTPTTIFPLNES--QQQVMFYQDMILCAGQGPYVNHCQINGDIKAQIP-STPRCVYSL-----SVNEASQENKVLTAAGSGPKIDVFTNFRYRA--FSL 309          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Match: Thoc6 (THO complex 6 [Source:MGI Symbol;Acc:MGI:2677480])

HSP 1 Score: 105.145 bits (261), Expect = 4.066e-25
Identity = 83/348 (23.85%), Postives = 151/348 (43.39%), Query Frame = 1
Query:   52 MKDVMKSHLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSSTT--------ASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL 1068
             + + + H+  +S + SPC  +LA  NN+  I I +L+    S  K  S             +Y++ +    L+   D  +  W W++I    C +       ++  L +       +  + +   E  +I+  G  D  +H    +D  +       + + + + CL  + +   ++SG  DG VR WD R +KE   IE  K  E  RP  G  I  +ATD   SDW++CGG   L+LW++R+     V      P              +++++ G    V  W LSG+L +++  ++   +   L+++ +   A  C      G    V++++++GYR   FSL
Sbjct:   13 FQALQRLHMTIFSQSVSPCGKFLAAGNNYGQIAIFSLSAALSSEAKEESKKPVVVFHAHDGPVYSMVSTDRHLLSAGDGEVKGWLWAEILKKGCKELWRRQPPYRTSLEVPE-----INALLLVPKENSLILAGG--DCQLH---SMDLETGAFTRALRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRIAKEVQTIEVYKHEECSRPHNGRWIGCLATD---SDWMVCGGGPALTLWHLRSSTPTTVFPI-RAPQKH------VTFYQDLILSAGQGCCVNHWQLSGELKAQVPGSSPGLLSLSLNQQPA---APECKVLTASGNSCRVDVFTNLGYRA--FSL 335          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Match: Thoc6 (THO complex 6 [Source:MGI Symbol;Acc:MGI:2677480])

HSP 1 Score: 105.145 bits (261), Expect = 5.017e-25
Identity = 83/348 (23.85%), Postives = 151/348 (43.39%), Query Frame = 1
Query:   52 MKDVMKSHLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSSTT--------ASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL 1068
             + + + H+  +S + SPC  +LA  NN+  I I +L+    S  K  S             +Y++ +    L+   D  +  W W++I    C +       ++  L +       +  + +   E  +I+  G  D  +H    +D  +       + + + + CL  + +   ++SG  DG VR WD R +KE   IE  K  E  RP  G  I  +ATD   SDW++CGG   L+LW++R+     V      P              +++++ G    V  W LSG+L +++  ++   +   L+++ +   A  C      G    V++++++GYR   FSL
Sbjct:   17 FQALQRLHMTIFSQSVSPCGKFLAAGNNYGQIAIFSLSAALSSEAKEESKKPVVVFHAHDGPVYSMVSTDRHLLSAGDGEVKGWLWAEILKKGCKELWRRQPPYRTSLEVPE-----INALLLVPKENSLILAGG--DCQLH---SMDLETGAFTRALRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRIAKEVQTIEVYKHEECSRPHNGRWIGCLATD---SDWMVCGGGPALTLWHLRSSTPTTVFPI-RAPQKH------VTFYQDLILSAGQGCCVNHWQLSGELKAQVPGSSPGLLSLSLNQQPA---APECKVLTASGNSCRVDVFTNLGYRA--FSL 339          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Match: Thoc6 (THO complex 6 [Source:MGI Symbol;Acc:MGI:2677480])

HSP 1 Score: 105.145 bits (261), Expect = 5.017e-25
Identity = 83/348 (23.85%), Postives = 151/348 (43.39%), Query Frame = 1
Query:   52 MKDVMKSHLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSSTT--------ASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL 1068
             + + + H+  +S + SPC  +LA  NN+  I I +L+    S  K  S             +Y++ +    L+   D  +  W W++I    C +       ++  L +       +  + +   E  +I+  G  D  +H    +D  +       + + + + CL  + +   ++SG  DG VR WD R +KE   IE  K  E  RP  G  I  +ATD   SDW++CGG   L+LW++R+     V      P              +++++ G    V  W LSG+L +++  ++   +   L+++ +   A  C      G    V++++++GYR   FSL
Sbjct:   17 FQALQRLHMTIFSQSVSPCGKFLAAGNNYGQIAIFSLSAALSSEAKEESKKPVVVFHAHDGPVYSMVSTDRHLLSAGDGEVKGWLWAEILKKGCKELWRRQPPYRTSLEVPE-----INALLLVPKENSLILAGG--DCQLH---SMDLETGAFTRALRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRIAKEVQTIEVYKHEECSRPHNGRWIGCLATD---SDWMVCGGGPALTLWHLRSSTPTTVFPI-RAPQKH------VTFYQDLILSAGQGCCVNHWQLSGELKAQVPGSSPGLLSLSLNQQPA---APECKVLTASGNSCRVDVFTNLGYRA--FSL 339          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Match: Thoc6 (THO complex 6 [Source:MGI Symbol;Acc:MGI:2677480])

HSP 1 Score: 105.145 bits (261), Expect = 5.017e-25
Identity = 83/348 (23.85%), Postives = 151/348 (43.39%), Query Frame = 1
Query:   52 MKDVMKSHLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSSTT--------ASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL 1068
             + + + H+  +S + SPC  +LA  NN+  I I +L+    S  K  S             +Y++ +    L+   D  +  W W++I    C +       ++  L +       +  + +   E  +I+  G  D  +H    +D  +       + + + + CL  + +   ++SG  DG VR WD R +KE   IE  K  E  RP  G  I  +ATD   SDW++CGG   L+LW++R+     V      P              +++++ G    V  W LSG+L +++  ++   +   L+++ +   A  C      G    V++++++GYR   FSL
Sbjct:   17 FQALQRLHMTIFSQSVSPCGKFLAAGNNYGQIAIFSLSAALSSEAKEESKKPVVVFHAHDGPVYSMVSTDRHLLSAGDGEVKGWLWAEILKKGCKELWRRQPPYRTSLEVPE-----INALLLVPKENSLILAGG--DCQLH---SMDLETGAFTRALRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRIAKEVQTIEVYKHEECSRPHNGRWIGCLATD---SDWMVCGGGPALTLWHLRSSTPTTVFPI-RAPQKH------VTFYQDLILSAGQGCCVNHWQLSGELKAQVPGSSPGLLSLSLNQQPA---APECKVLTASGNSCRVDVFTNLGYRA--FSL 339          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5XJS5|THOC6_DANRE (THO complex subunit 6 homolog OS=Danio rerio OX=7955 GN=thoc6 PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 2.104e-24
Identity = 76/245 (31.02%), Postives = 120/245 (48.98%), Query Frame = 1
Query:   52 MKDVMKSHLINYSMTFSPCQNYLAISNNFNSIKILNLN-----DGTESLIKCSSSTTA---SIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRA 759
            M  V   H+  +S +FSPC  YLA  NN+  I + +L+     D +E   K   + TA    ++++ +  S L+   +  I AW W+++              ++  L I        +I +M IN  D  + +G  D NIH   I+D  +    +  K + + + CL+ K +   ++SG  DG VR WD R ++    IE  K  E  RP+ G  I+ +ATD   SDW+LCGG   LSLW++R+
Sbjct:    1 MGPVELLHMSVFSQSFSPCGRYLAAGNNYGEIAVFSLSAALSPDASERSQKPILNFTAHDGPVFSLLSTESHLLSAGNGEISAWSWAELIKKSTKAAWTRKPNYETSLEIP-------EINAMIINPKDNNLIVGGGDNNIH---IMDMETGTFKSVLKGHTDYIHCLSFKEREGEILSGGEDGAVRIWDSRTNRPVHCIEVFKYEECARPQFGKWISCLATD---SDWMLCGGGPSLSLWHLRS 232          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6AY87|THOC6_RAT (THO complex subunit 6 homolog OS=Rattus norvegicus OX=10116 GN=Thoc6 PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.285e-24
Identity = 83/348 (23.85%), Postives = 151/348 (43.39%), Query Frame = 1
Query:   52 MKDVMKSHLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSSTT--------ASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL 1068
             + + + H+  +S + SPC  +LA  NN+  I I +L+    S  K  S             +Y++ +    L+   D  +  W W++I    C +       ++  L +       +  + +   E  +I+  G  D  +H    +D  +       + + + + CL  + +   ++SG  DG VR WD R +KE   IE  K  E  RP  G  I  +ATD   SDW++CGG   L+LW++R+     V      P              +++++ G    V  W LSG+L +++  ++   +   L+++ +   A  C      G    V++++++GYR   FSL
Sbjct:   17 FQALQRLHMTIFSQSVSPCGKFLAAGNNYGQIAIFSLSAALSSEAKEESKKPMVTFHAHDGPVYSMVSTDRHLLSAGDGEVKGWLWAEILKKGCKELWRRQPPYRTSLEVPE-----INALLLVPKENSLILAGG--DCQLH---TMDLETGTFTRALRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRIAKEVQTIEVYKHEECSRPHNGRWIGCLATD---SDWMVCGGGPALTLWHLRSSTPTTVFPI-RAPQKH------VTFYQDLILSAGQGCCVNHWQLSGELKAQVPGSSPGLLSLSLNQQPA---APECKVLTASGNSCRVDVFTNLGYRA--FSL 339          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5U4D9|THOC6_MOUSE (THO complex subunit 6 homolog OS=Mus musculus OX=10090 GN=Thoc6 PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 3.509e-24
Identity = 83/348 (23.85%), Postives = 151/348 (43.39%), Query Frame = 1
Query:   52 MKDVMKSHLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSSTT--------ASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL 1068
             + + + H+  +S + SPC  +LA  NN+  I I +L+    S  K  S             +Y++ +    L+   D  +  W W++I    C +       ++  L +       +  + +   E  +I+  G  D  +H    +D  +       + + + + CL  + +   ++SG  DG VR WD R +KE   IE  K  E  RP  G  I  +ATD   SDW++CGG   L+LW++R+     V      P              +++++ G    V  W LSG+L +++  ++   +   L+++ +   A  C      G    V++++++GYR   FSL
Sbjct:   17 FQALQRLHMTIFSQSVSPCGKFLAAGNNYGQIAIFSLSAALSSEAKEESKKPVVVFHAHDGPVYSMVSTDRHLLSAGDGEVKGWLWAEILKKGCKELWRRQPPYRTSLEVPE-----INALLLVPKENSLILAGG--DCQLH---SMDLETGAFTRALRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRIAKEVQTIEVYKHEECSRPHNGRWIGCLATD---SDWMVCGGGPALTLWHLRSSTPTTVFPI-RAPQKH------VTFYQDLILSAGQGCCVNHWQLSGELKAQVPGSSPGLLSLSLNQQPA---APECKVLTASGNSCRVDVFTNLGYRA--FSL 339          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q86W42|THOC6_HUMAN (THO complex subunit 6 homolog OS=Homo sapiens OX=9606 GN=THOC6 PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.114e-23
Identity = 84/353 (23.80%), Postives = 157/353 (44.48%), Query Frame = 1
Query:   52 MKDVMKSHLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSSTT--------ASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILR-----DEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL 1068
             + + + H+  +S + SPC  +LA  NN+  I I +L+    S  K  S             +Y++ +    L+   D  + AW W+++    C +       ++  L +       +  + +   E  +I+  G  D  +H   + + G+   +   + + + + CL  + +   ++SG  DG VR WD R +KE   IE  K  E  RP  G  I  +ATD   SDW++CGG   L+LW++R+             T     P+ A  +      +++++ G    V  W LSG+L +++  ++   +   L+++ +   A  C      G    V++++++GYR   FSL
Sbjct:   17 FQALQRLHMTIFSQSVSPCGKFLAAGNNYGQIAIFSLSSALSSEAKEESKKPVVTFQAHDGPVYSMVSTDRHLLSAGDGEVKAWLWAEMLKKGCKELWRRQPPYRTSLEVPE-----INALLLVPKENSLILAGG--DCQLHTMDL-ETGTFTRV--LRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRTAKEVQTIEVYKHEECSRPHNGRWIGCLATD---SDWMVCGGGPALTLWHLRSS------------TPTTIFPIRAPQKHVTFYQDLILSAGQGRCVNQWQLSGELKAQVPGSSPGLLSLSLNQQPA---APECKVLTAAGNSCRVDVFTNLGYRA--FSL 339          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VTV1|THOC6_DROME (THO complex subunit 6 OS=Drosophila melanogaster OX=7227 GN=thoc6 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.143e-16
Identity = 72/306 (23.53%), Postives = 134/306 (43.79%), Query Frame = 1
Query:   49 KMKDVMKSHLINYSMTFSPCQNYLAISNNFNSI---KILNLNDGTES----LIKCSSSTTASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLTKGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKP-----TDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAAT 930
            K KD+ +++    +   S  + YL   N F  I   +I  L+ G+E     L      +   I  +      L+  +   IY  +W++ E ++ ++       ++  +P+  + V    + SM+++  + I+  GC DG I+   + ++G I+    Y+ + + V  +       + SG  DGTVR W  +Q +    +E  K+P + RP  G  I  +A +    DW+LCGG  + S++++R+     V     +       DDC            V+ GG  + V  + L+G L + I +  T
Sbjct:    2 KQKDLKRAYNNVLAQAISGSKQYLFAGNLFGDIFVLRIKELDKGSEEPPGKLKIFPQGSDVDINYLAFHRDFLIVGAVGLIYGLEWNEEEESLATKRS-----WEVKIPMQVDAVEVPDVNSMWLDSENSILFAGCGDGVIYQVSL-EDGRIQ--REYRGHTDYVHSVVGNANGQIFSGAEDGTVRVWSTKQQQHTSMLEPYKNPNLLRPDWGKWIGAVAVN---EDWLLCGGGPKASIFHLRSMESTCVFSFPGRVHLCDFVDDC------------VLIGGEHNHVQSYTLNGVLQANIPVEHT 284          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: H2ZE67 (WD_REPEATS_REGION domain-containing protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 6.813e-29
Identity = 90/338 (26.63%), Postives = 164/338 (48.52%), Query Frame = 1
Query:   73 HLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSS------STTASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLTKGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL 1068
            H   Y+  +S C  YLA  +N+  I + N+ +  E+    S+      + T +I+ +   G  L+      I  WKWSDI     S+   L    K +    NE   C+     Y N+ D  ++ G  +G  + + I    +++    +  + + +  L  G   +LI+   DGTV+ WD R +     I   K+ ++ RP+ G  I+ +A D ES +W++CGG AQ SLW++R++ +  V++T    +D  + P   + +D+ +I+ GN   +Y W+++G+  +EI   + N VF +  ++   S   N       G    + L++++GY  K+ S+
Sbjct:    8 HTTIYATAYSSCGTYLACGDNYGQIAVFNITEAVEAHSLKSTPYVVFQAHTGAIHALVTSGKYLISAGFGPINGWKWSDIRNKRPSKSFTL----KDLQTNENESYNCVN----YANK-DSSIYTGADNGITYKWDI---NTLKCKGRFSGHTDYIHDLDTGSN-TLITASEDGTVKLWDTRTATCTNTISPCKNKQLNRPEFGQWISSVALD-ESGEWLVCGGSAQPSLWHLRSKSMATVLET----SDKSYTPNKLMFQDDEIISAGNKSIIYRWNVNGEKKAEIP-CSINRVFSLSFKQLFGS-VSNSLPLIASGNSYKLSLFTNLGYEGKLLSI 325          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A2B4SRY0 (THO complex subunit 6-like OS=Stylophora pistillata OX=50429 GN=thoc6 PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 3.074e-28
Identity = 92/349 (26.36%), Postives = 168/349 (48.14%), Query Frame = 1
Query:   64 MKSHLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSST-----------TASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLR--IETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL 1068
            ++ H I +++ FSPC N+LA  NNF  I + ++   T +L   +SS            +  IY++ +    L+      I+ W+W +I      + E     +    P     +   +  ++   E +  +  GC D NI+L+ + ++G+ +   T   + + + CLT + K    +SG  DGTVR WD R +K  +   IE  K+ ++ RP LGS I  +  D ES DW++CGG   LS+W++R+     V+KT +          SA+L D+++++ G+   V+ W ++G   + +     N VF +   +KS  +          G+ A ++++++ GY+   F  
Sbjct:   36 LELHTIVFAVAFSPCGNFLAACNNFGQIAVFSI---TSALAPDASSDKKRPIIFFQGHSNPIYSLISTDKFLISGGSSEIHGWRWDEI----LDKTEAPSPAWTLQPPAARASLDIPETNALVFAEQEDTLFSGCGDNNIYLWDL-ESGTCK--NTLSGHWDYIQCLTLRTKHSQCVSGAEDGTVRLWDYR-TKGFMTDIIEPCKNEDIHRPHLGSWIGCVTVD-ESEDWLVCGGGPSLSVWHLRSMTCTSVLKTASSQQ-------SALLHDDLILSAGSEPTVFHWQINGDPKTHVP-CTPNSVFTMQINDKSPKN----KVLAVGGYSADIDVFTNFGYKALSFKF 360          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A3M6TAF6 (WD_REPEATS_REGION domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00010925 PE=4 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 8.951e-28
Identity = 88/348 (25.29%), Postives = 165/348 (47.41%), Query Frame = 1
Query:   64 MKSHLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSST-----------TASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECL-RIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL 1068
            ++ H I +++ FSPC N+LA  NNF  I + ++   T +L   +SS            +  IY++ +    L+      I+ W+W +I      + E     +    P     +   +  ++  +E +  +  GC D NI+++ + ++G+ +   T   +++ + CLT + K    +SG  DGTVR WD R        IE  K+ ++ RP LGS I  +A D E  DW++CGG   LS+W++R+     V+KT +          SA+  D+++++ G+   V+ W ++G   + +     N VF +   ++S  +          G  A ++++++ GY+   F  
Sbjct:   12 LELHTIVFAVAFSPCGNFLAACNNFGQIAVFSI---TSALAPDASSDKKRPVIFFQGHSNPIYSLISTDKFLISGGSSEIHGWRWDEI----LDKTEAPSPAWTLQPPAARASLDIPETNALVFSEQEDTLFSGCGDNNIYMWDL-ESGTCK--NTLSGHSDYIQCLTLRTKHGQCVSGAEDGTVRLWDYRTKGSMTDMIEPCKNEDIHRPHLGSWIGCVAVD-EGEDWLVCGGGPSLSVWHLRSMNCTSVLKTASSQQ-------SALFHDDLILSAGSEPTVFHWQINGDPKTHVP-CTPNSVFTMQINDQSPKN----KVLAVGGCSADIDVFTNFGYKALSFKF 336          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A7SWJ5 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g135342 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 6.283e-27
Identity = 83/341 (24.34%), Postives = 160/341 (46.92%), Query Frame = 1
Query:   73 HLINYSMTFSPCQNYLAISNNFNSIKILNLNDG--------TESLIKCSSSTTASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL 1068
            H   + + FSPC N+ A +NNF  I + +L+          +   +         IY++ +  + L+      I  W+W+D+   +      L+       P ++  +   +  ++  +E D ++  GC D NI+ + + + G+ +  +T   + + V CL  + +    +SG  DGTVRFWD R +    +I   +   ++RP+ G  I  +A D +S +W++CGG   LS+W++R+     V+ T            SA+  D+ +++ G+   V+ W ++G+L S++   + + VF  L   K+  D          G   +++ Y ++GY+   FSL
Sbjct:   14 HTTVFDVAFSPCGNFFASANNFGDISLFSLSAALVPDAPPESRKPLLTFKGHKGPIYSLLSTKTFLISGGSTEISGWRWTDLMEQLVIPAWTLN-------PPSSNPMDIGETNALAFSEQDNVLLTGCGDNNIYSWDL-EAGTCK--STMSGHTDYVQCLALRQQHNQCMSGAEDGTVRFWDLRTAGMVNKISPSQEKNLQRPRFGPWIGCVAVD-DSEEWMVCGGGPSLSVWHLRSLSCTSVLDTPASCQQ------SALFHDDKILSAGSEPTVFQWQVNGELKSQVPCTSAS-VF-ALRVNKTSPDK---QILLVAGDSVHIDAYINLGYKAFSFSL 332          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: L8YEC9 (THO complex subunit 6 like protein OS=Tupaia chinensis OX=246437 GN=TREES_T100012531 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.959e-25
Identity = 89/350 (25.43%), Postives = 157/350 (44.86%), Query Frame = 1
Query:   52 MKDVMKSHLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSSTT--------ASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVV--MKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL 1068
             + + + H+  +S + SPC  +LA  NN+  I I +L+    S  K  S             +Y + +    L+   D  + AW W++I    C +       ++  L +    V  L ++     E  +I+  G  D  +H    +D  +       + + + + CL  + +G  ++SG  DGTVR WD R +KE   IE  K  E  RP+ G  I  +ATD   SDW++CGG   L+LW++R+     V  M+   K               +++++ G    V  W LSG+L +++  ++   +   L+++ +   A  C      G    V++++++GYR   FSL
Sbjct:   42 FQALQRLHMTVFSQSVSPCGKFLAAGNNYGQIAIFSLSAALSSEAKEESKKPVVTFQAHDGPVYCMVSTDRHLLSAGDGEVKAWLWAEILKKGCKELWRRQPPYRTSLEVPE--VNALLLVP---KENSLILAGG--DCQLH---TMDLETGAFTRALRGHTDYIHCLALRERGPEVLSGGEDGTVRLWDLRAAKEVQTIEVYKHEECARPQNGRWIGCLATD---SDWMVCGGGPALTLWHLRSSTPTTVFPMRAPQK---------HVTFYQDLILSAGQGPCVNQWQLSGELRAQVPGSSPGLLSLSLNQQPA---APECKVLTAAGNSCRVDVFTNLGYR--AFSL 364          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: thoc6 (THO complex 6 [Source:NCBI gene;Acc:103041053])

HSP 1 Score: 108.612 bits (270), Expect = 1.616e-26
Identity = 83/297 (27.95%), Postives = 133/297 (44.78%), Query Frame = 1
Query:   52 MKDVMKSHLINYSMTFSPCQNYLAISNNFNSIKILNLN--------DGTESLIKCSSSTTASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEI 915
            M  V   H+  +S +FSPC  +LA  NN+  I I +L+        D ++  I   ++    ++ + +  + L+   +  I AW W ++              +K+ L I        +I +M IN  D  + +G  D NIH   I+D  +    +  + + + + CL  K +   ++SG  DG VR WD R  +    IE  K  E  RP+ G  I+ +ATD   SDW+LCGG   LSLW++R+     V      P   C     A+   +V+ A G    V    L G + ++I
Sbjct:    1 MGPVELLHMSVFSQSFSPCGRFLAAGNNYGEIAIFSLSAALSPDATDLSQKPILTFTAHEGPVFTLLSTDTHLLSAGNGEISAWSWVELTKRSTKAVWTRRPNYKSSLEIP-------EINAMIINPKDNSLIVGGGDNNIH---IMDMETGTFKSVLQGHTDYIHCLALKEREGEILSGGEDGAVRIWDSRTRQAVHCIEVFKYEECARPQFGKWISCLATD---SDWMLCGGGPSLSLWHLRSMSPTSVF-----PLAGC--QREAVFHQDVIFAVGEGPHVSHCLLGGSVKAQI 277          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: thoc6 (THO complex 6 [Source:NCBI gene;Acc:100004014])

HSP 1 Score: 107.457 bits (267), Expect = 6.835e-27
Identity = 83/335 (24.78%), Postives = 160/335 (47.76%), Query Frame = 1
Query:   73 HLINYSMTFSPCQNYLAISNNFNSIKILNLN-----DGTESLIKCSSSTTA---SIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLTKGKGYS-LISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYR 1050
            H+  +S +FSPC  YLA  N++  + + +L+     D TE   K   + TA    +Y++ +   LL+   +  + AW WSD+      +       +K  + +        +I ++ +NE D  +++GC D N++   + ++G+ +L    + + + V CL      S ++SG  DGTVR WD R       +E  K  E  R + G  I  +ATD   SDW++CGG   LSLW++R+     V   +           +A+   +++I+ G+   +    ++G++ + I + +T  V+ +    + + ++         G    +E+++++GYR
Sbjct:    8 HMTVFSQSFSPCGKYLAAGNSYGRVAVFSLSLALGLDATEESRKPIYTFTAHESPVYSLVSTDRLLISAGNGLVKAWNWSDLIKKTAKEVWSKQPPYKMGVDVP-------EINALLLNEKDNSLYLGCGDCNVYNMDL-ESGTCKLF--LEGHTDYVHCLALRDHVSEVLSGGEDGTVRHWDVRTGNLVQCVEIFKYQECARSEFGKWIGCLATD---SDWMICGGGPALSLWHLRSLTPTTVFPLNGSHH-------AAMFHQDLIISAGSGHSIDHCQVNGEVRARIPV-STPSVYSL----QVNHNSSENKVLSAAGSSHKLEVFTNLGYR 317          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO31919 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWJ5])

HSP 1 Score: 119.013 bits (297), Expect = 8.689e-31
Identity = 83/341 (24.34%), Postives = 160/341 (46.92%), Query Frame = 1
Query:   73 HLINYSMTFSPCQNYLAISNNFNSIKILNLNDG--------TESLIKCSSSTTASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLT-KGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL 1068
            H   + + FSPC N+ A +NNF  I + +L+          +   +         IY++ +  + L+      I  W+W+D+   +      L+       P ++  +   +  ++  +E D ++  GC D NI+ + + + G+ +  +T   + + V CL  + +    +SG  DGTVRFWD R +    +I   +   ++RP+ G  I  +A D +S +W++CGG   LS+W++R+     V+ T            SA+  D+ +++ G+   V+ W ++G+L S++   + + VF  L   K+  D          G   +++ Y ++GY+   FSL
Sbjct:   14 HTTVFDVAFSPCGNFFASANNFGDISLFSLSAALVPDAPPESRKPLLTFKGHKGPIYSLLSTKTFLISGGSTEISGWRWTDLMEQLVIPAWTLN-------PPSSNPMDIGETNALAFSEQDNVLLTGCGDNNIYSWDL-EAGTCK--STMSGHTDYVQCLALRQQHNQCMSGAEDGTVRFWDLRTAGMVNKISPSQEKNLQRPRFGPWIGCVAVD-DSEEWMVCGGGPSLSVWHLRSLSCTSVLDTPASCQQ------SALFHDDKILSAGSEPTVFQWQVNGELKSQVPCTSAS-VF-ALRVNKTSPDK---QILLVAGDSVHIDAYINLGYKAFSFSL 332          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: thoc6 (THO complex 6 [Source:NCBI gene;Acc:101174081])

HSP 1 Score: 75.8702 bits (185), Expect = 2.785e-15
Identity = 72/320 (22.50%), Postives = 127/320 (39.69%), Query Frame = 1
Query:   73 HLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSSTTASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLTKGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWIL--CGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVL--------HREKSDSDADNCNDFFT 1002
            H+  +S +FSPC  +LA  NN+  I +               +    ++++ +   +L+   +  + AW W+++                                    ++ D  + +G  D NIH+  + ++G  + +    ++    LC+ + +   L+SG  DG VR WD R  +    +E  K     RP+ G  I+ + TD   SDW+L  CGG   LSLW++R+     +  T   P   C     A    + ++A G    V    L G + ++I    T    + L        HR  +   + +C D FT
Sbjct:    3 HMSVFSQSFSPCGRFLAAGNNYGEIGLF--------------AHEGPVFSLLSADGVLLSAGNGEVSAWSWTEL------------------------------------SKKDNSLALGGGDNNIHVLDL-EHGVFKAVLHGHTDYVHCLCMRE-REAELLSGGEDGVVRMWDSRTGRCVHCLEVHKYEVCARPQHGKWISCLTTD---SDWMLQVCGGGPALSLWHLRS-----LSPTSVFPLSGC--QRHAAFHQDTILAVGEGQFVSHCLLGGAVKAQI--PCTPQSLNTLQINTGSTEHRVLTVGGSSSCIDVFT 258          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000022073.1 (SMESG000022073.1)

HSP 1 Score: 694.501 bits (1791), Expect = 0.000e+0
Identity = 339/339 (100.00%), Postives = 339/339 (100.00%), Query Frame = 1
Query:   52 MKDVMKSHLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSSTTASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLTKGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL 1068
            MKDVMKSHLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSSTTASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLTKGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL
Sbjct:    1 MKDVMKSHLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSSTTASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLTKGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL 339          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000022073.1 (SMESG000022073.1)

HSP 1 Score: 685.256 bits (1767), Expect = 0.000e+0
Identity = 335/335 (100.00%), Postives = 335/335 (100.00%), Query Frame = 1
Query:   64 MKSHLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSSTTASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLTKGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL 1068
            MKSHLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSSTTASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLTKGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL
Sbjct:    1 MKSHLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSSTTASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVLPINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTYKSNNEIVLCLTKGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVRRPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPTDDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVLHREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL 335          
The following BLAST results are available for this feature:
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
THOC62.319e-2423.80THO complex 6 [Source:HGNC Symbol;Acc:HGNC:28369][more]
THOC62.366e-2324.04THO complex 6 [Source:HGNC Symbol;Acc:HGNC:28369][more]
THOC62.366e-2324.04THO complex 6 [Source:HGNC Symbol;Acc:HGNC:28369][more]
THOC61.137e-2025.35THO complex 6 [Source:HGNC Symbol;Acc:HGNC:28369][more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
thoc61.140e-1723.53gene:FBgn0036263 transcript:FBtr0076019[more]
thoc61.140e-1723.53gene:FBgn0036263 transcript:FBtr0333384[more]
thoc61.140e-1723.53gene:FBgn0036263 transcript:FBtr0346911[more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
thoc62.170e-2529.93THO complex 6 [Source:NCBI gene;Acc:100004014][more]
thoc62.170e-2529.93THO complex 6 [Source:NCBI gene;Acc:100004014][more]
thoc62.170e-2529.93THO complex 6 [Source:NCBI gene;Acc:100004014][more]
thoc66.690e-2028.36THO complex 6 [Source:NCBI gene;Acc:100004014][more]
thoc66.690e-2028.36THO complex 6 [Source:NCBI gene;Acc:100004014][more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
THOC61.186e-2326.02THO complex 6 [Source:NCBI gene;Acc:100498236][more]
THOC61.377e-2326.02THO complex 6 [Source:NCBI gene;Acc:100498236][more]
THOC61.832e-2326.02THO complex 6 [Source:NCBI gene;Acc:100498236][more]
THOC61.584e-2125.66THO complex 6 [Source:NCBI gene;Acc:100498236][more]
THOC69.912e-2125.44THO complex 6 [Source:NCBI gene;Acc:100498236][more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Thoc64.066e-2523.85THO complex 6 [Source:MGI Symbol;Acc:MGI:2677480][more]
Thoc65.017e-2523.85THO complex 6 [Source:MGI Symbol;Acc:MGI:2677480][more]
Thoc65.017e-2523.85THO complex 6 [Source:MGI Symbol;Acc:MGI:2677480][more]
Thoc65.017e-2523.85THO complex 6 [Source:MGI Symbol;Acc:MGI:2677480][more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5XJS5|THOC6_DANRE2.104e-2431.02THO complex subunit 6 homolog OS=Danio rerio OX=79... [more]
sp|Q6AY87|THOC6_RAT2.285e-2423.85THO complex subunit 6 homolog OS=Rattus norvegicus... [more]
sp|Q5U4D9|THOC6_MOUSE3.509e-2423.85THO complex subunit 6 homolog OS=Mus musculus OX=1... [more]
sp|Q86W42|THOC6_HUMAN1.114e-2323.80THO complex subunit 6 homolog OS=Homo sapiens OX=9... [more]
sp|Q9VTV1|THOC6_DROME1.143e-1623.53THO complex subunit 6 OS=Drosophila melanogaster O... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2ZE676.813e-2926.63WD_REPEATS_REGION domain-containing protein OS=Cio... [more]
A0A2B4SRY03.074e-2826.36THO complex subunit 6-like OS=Stylophora pistillat... [more]
A0A3M6TAF68.951e-2825.29WD_REPEATS_REGION domain-containing protein OS=Poc... [more]
A7SWJ56.283e-2724.34Predicted protein OS=Nematostella vectensis OX=453... [more]
L8YEC91.959e-2525.43THO complex subunit 6 like protein OS=Tupaia chine... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
thoc61.616e-2627.95THO complex 6 [Source:NCBI gene;Acc:103041053][more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
thoc66.835e-2724.78THO complex 6 [Source:NCBI gene;Acc:100004014][more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO319198.689e-3124.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
thoc62.785e-1522.50THO complex 6 [Source:NCBI gene;Acc:101174081][more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000022073.10.000e+0100.00SMESG000022073.1[more]
SMESG000022073.10.000e+0100.00SMESG000022073.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004137 ID=SMED30004137|Name=WD_REPEATS_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1099bp
GTAGTTCAATAATTTAAATATAAATATTTGTTAATTGTTTTTGATTCCAA
AATGAAAGATGTAATGAAATCTCATTTGATAAATTATTCTATGACATTTT
CTCCATGTCAAAATTATCTTGCAATCTCTAATAACTTCAATTCAATCAAA
ATTTTGAATTTAAATGATGGTACTGAAAGTTTAATTAAGTGTAGTTCTAG
CACAACGGCTAGCATATACAATATTGGTAACTGTGGCTCTTTGCTTGTTG
GTACTAGTGACTGTTATATATATGCATGGAAATGGAGTGATATCGAGATT
AACATGTGTAGTCAATGTGAAGAACTAGATAGTTTATTTAAAGCAGTTCT
TCCAATTAATAATGAATTTGTAGGTTGTTTACAGATTATATCAATGTATA
TAAATGAAATTGATATGATAGTACATATTGGATGTTCTGATGGAAATATA
CATTTGTTTAGAATAATCGATAATGGATCTATAGAATTGATTACAACTTA
TAAATCTAATAATGAAATAGTTTTGTGTCTAACCAAAGGAAAAGGATATT
CATTGATATCGGGACATACCGATGGAACGGTGCGATTCTGGGATGGCCGA
CAATCGAAAGAATGCTTGAGAATCGAAACGGATAAAAGTCCCGAAGTTCG
CCGTCCAAAATTGGGCTCGAGTATCAACGTGATTGCGACAGATGTTGAAT
CATCCGATTGGATTCTGTGCGGCGGCCAAGCGCAATTGTCGCTGTGGAAC
GTGCGTGCTCAACGGGTTGGAGTTGTAATGAAAACCGACAATAAGCCAAC
CGATGATTGCTGGATTCCACTGAGTGCGATCTTGCGCGACGAAGTCGTCA
TTGCAGGCGGCAATTCCGACCGGGTTTATCTCTGGGATTTATCCGGTCAA
TTGAATTCCGAAATCAGTTTAGCAGCGACCAATCACGTGTTTGATGTGTT
GCATCGAGAGAAATCCGATTCAGATGCAGACAATTGCAATGATTTCTTCA
CCTGCGGTTGGGGCGCATACGTTGAGCTCTACAGCGACATCGGGTACAGG
AAAAAGATTTTCTCGTTGTAAAAATGTTTCACTTGTAATTAATAAATTG
back to top

protein sequence of SMED30004137-orf-1

>SMED30004137-orf-1 ID=SMED30004137-orf-1|Name=SMED30004137-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=340bp
MKDVMKSHLINYSMTFSPCQNYLAISNNFNSIKILNLNDGTESLIKCSSS
TTASIYNIGNCGSLLVGTSDCYIYAWKWSDIEINMCSQCEELDSLFKAVL
PINNEFVGCLQIISMYINEIDMIVHIGCSDGNIHLFRIIDNGSIELITTY
KSNNEIVLCLTKGKGYSLISGHTDGTVRFWDGRQSKECLRIETDKSPEVR
RPKLGSSINVIATDVESSDWILCGGQAQLSLWNVRAQRVGVVMKTDNKPT
DDCWIPLSAILRDEVVIAGGNSDRVYLWDLSGQLNSEISLAATNHVFDVL
HREKSDSDADNCNDFFTCGWGAYVELYSDIGYRKKIFSL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR042626THOC6
IPR036322WD40_repeat_dom_sf
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR001680WD40_repeat
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0000346transcription export complex
GO:0000347THO complex
GO:0000445THO complex part of transcription export complex
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0016604nuclear body
GO:0016607nuclear speck
Vocabulary: biological process
TermDefinition
GO:0006369termination of RNA polymerase II transcription
GO:0006397mRNA processing
GO:0006405RNA export from nucleus
GO:0006406mRNA export from nucleus
GO:0006810transport
GO:0006915apoptotic process
GO:0007275multicellular organism development
GO:0007417central nervous system development
GO:0008380RNA splicing
GO:0031124mRNA 3'-end processing
GO:0043066negative regulation of apoptotic process
GO:0046784viral mRNA export from host cell nucleus
GO:0051028mRNA transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 1..330
e-value: 1.1E-19
score: 72.3
IPR042626THO complex subunit 6PANTHERPTHR44411FAMILY NOT NAMEDcoord: 2..337
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 168..182
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 168..181
score: 8.537
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 12..326