DNA polymerase

Overview
NameDNA polymerase
Smed IDSMED30004136
Length (bp)4341
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA polymerase (SMED30004136) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA polymerase (SMED30004136) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA polymerase (SMED30004136) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA polymerase (SMED30004136) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of DNA polymerase vs. Ensembl Human
Match: POLA1 (DNA polymerase alpha 1, catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9173])

HSP 1 Score: 803.127 bits (2073), Expect = 0.000e+0
Identity = 559/1515 (36.90%), Postives = 822/1515 (54.26%), Query Frame = 2
Query:   53 RPRRQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQLDNFIEGDSE--YMESGKEIFDESDEEDIKIGPKRKKSMK--NANLKNPKKACLDFKSIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNRE--EIKAP--FLSKKKEEF-----KFDIHQPKVISSSKIKPNEPKEMPQKTVQEPIKFVKKQIVFNKGSSEKNKSPSTIENNETPEQHKIEDCIVLDDIDFDEPFETNPVVSAGFATDTKLEEHKPLWETEEIEDESSNDK---------------YDPFE-----------NIDKSSLKLI-----------YWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQA-------------QMTEVYSEV-KSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPP-FSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQL-----EIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPP------GILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKY--HHANQHNEADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSIDFKMELE----KPWLCGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMT---TGQFACPRCESGIMKPLLSSSLLNRQLGYYRF----------LLTGKENLSYKQK----ELLQMCSKY---VERVLERSDYMNVDFKSLMA 4282
            R RR++ SKK  + + L +LKKAK  G   K E+E    +Y+ V+EE Y KL + RQ D++I  D    Y+E G+EIFD+  E+D     ++ K  K  N + +N KK  +       ++ KS+F        + K ++ +    L   L   N E  +I  P   + KKK         F +H    + S KI     ++ P  T   P+   + +   +    E     ST E  E+         +  +D DFDEP E   V     A     +E +P    EE++ E+ + K               +D  +            +D S L L+           YW DAY D+   PGVVFLFGK   ES +  V+ C+ V  +ER +Y LP++                M +VY E  + I  K+ I   ++KPV K YAF+  DVP++++YL V+Y ++ P+LP DL G+TFS +FG NTS LE+F+++ ++KGPCWL     +  +   S CK+         + + K+ SPP   +++ ++KT+ N K++ NEI+A+   +H+   LD+A P   FQ++F +++ PKD + PY   + +  +   N K  V + A ER+L+   L K+H +DPDIIVGH + G++L +LLQR        W K GRLKRS  +PK+ G S   + ER AT GR++CDVE+SA+ELI+C+SY   +L+Q++L    K     +P+ ++  +++ S+ +  L++ T  ++   + +M EL VLPLAL+IT I GN++ RTL GG+SERNE+LLLHAF E  YIVPDK        +L     EID    +  K  ++K  YAGGLVL+PK G Y+ FILL+DFNSLYPSII E+NICFTT+ R          +A  +  D   + + + P      GILP EIRKLVE R  VKQL+   +L+ + +LQ+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT+ GREIL++TK++++        K+N    L++IYGDTDS+M+NT   N+   + V K+G  +K EVN+ YK ++++IDGV + +LLL KKKYA+L  V    S G  + KQELKGLDIVRRDWC L+ + G  ++  IL ++ S + +  +I   L  I +++ N  + + +F I KALT++P++Y + +  PHV VAL INS GG  ++ +A DTV Y+IC DG++ TA+QRAY+P+++      ++  L+ID  YYLA Q+HPVV R+ EPID IDA  +A  LGLDP+++  HH ++  E D          +  ++ DC+     C  C  +   D   +      +P L    N++   S     V ++ KL   I R I  YY     C+           C    R L +    TG   CP C    ++P  S   L  QL +YR+          L T  E    K++    ++LQ   K     E+ L RS Y  V+   L A
Sbjct:   20 RARREKKSKK-GRQEALERLKKAKA-GEKYKYEVEDFTGVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDADEKGKDGKARNKDKRNVKKLAV----TKPNNIKSMFIACAGKKTADKAVDLSKDGLLGDILQDLNTETPQITPPPVMILKKKRSIGASPNPFSVHTATAVPSGKIASPVSRKEPPLT---PVPLKRAEFAGDDVQVE-----STEEEQES-------GAMEFEDGDFDEPMEVEEVDLEPMAAKAWDKESEP---AEEVKQEADSGKGTVSYLGSFLPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLVKGADEEQVFHFYWLDAYEDQYNQPGVVFLFGKVWIESAETHVSCCVMVKNIERTLYFLPREMKIDLNTGKETGTPISMKDVYEEFDEKIATKYKIMKFKSKPVEKNYAFEIPDVPEKSEYLEVKYSAEMPQLPQDLKGETFSHVFGTNTSSLELFLMNRKIKGPCWLEVKSPQLLNQPVSWCKVEAMALKPDLVNVIKDVSPPPLVVMAFSMKTMQNAKNHQNEIIAMAALVHHSFALDKAAPKPPFQSHFCVVSKPKDCIFPYAFKEVIEKK---NVK--VEVAATERTLLGFFLAKVHKIDPDIIVGHNIYGFELEVLLQRINVCKAPHWSKIGRLKRS-NMPKLGGRSG--FGERNATCGRMICDVEISAKELIRCKSYHLSELVQQIL----KTERVVIPMENIQNMYSESSQLLYLLEHTWKDAKFILQIMCELNVLPLALQITNIAGNIMSRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKK-GRKKAAYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRV-------ASEAQKVTEDGEQEQIPELPDPSLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLILQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTYKGREILMHTKEMVQ--------KMN----LEVIYGDTDSIMINTNSTNL---EEVFKLGNKVKSEVNKLYKLLEIDIDGVFKSLLLLKKKKYAAL--VVEPTSDGNYVTKQELKGLDIVRRDWCDLAKDTGNFVIGQILSDQ-SRDTIVENIQKRLIEIGENVLNGSVPVSQFEINKALTKDPQDYPDKKSLPHVHVALWINSQGG--RKVKAGDTVSYVICQDGSNLTASQRAYAPEQL-----QKQDNLTIDTQYYLAQQIHPVVARICEPIDGIDAVLIATWLGLDPTQFRVHHYHKDEENDALLGGPAQLTDEEKYRDCERFKCPCPTCGTENIYDNVFDGSGTDMEPSLYRCSNIDCKASPLTFTVQLSNKLIMDIRRFIKKYYDGWLICE--------EPTCRNRTRHLPLQFSRTGPL-CPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFA 1456          
BLAST of DNA polymerase vs. Ensembl Human
Match: POLA1 (DNA polymerase alpha 1, catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9173])

HSP 1 Score: 803.127 bits (2073), Expect = 0.000e+0
Identity = 559/1515 (36.90%), Postives = 822/1515 (54.26%), Query Frame = 2
Query:   53 RPRRQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQLDNFIEGDSE--YMESGKEIFDESDEEDIKIGPKRKKSMK--NANLKNPKKACLDFKSIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNRE--EIKAP--FLSKKKEEF-----KFDIHQPKVISSSKIKPNEPKEMPQKTVQEPIKFVKKQIVFNKGSSEKNKSPSTIENNETPEQHKIEDCIVLDDIDFDEPFETNPVVSAGFATDTKLEEHKPLWETEEIEDESSNDK---------------YDPFE-----------NIDKSSLKLI-----------YWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQA-------------QMTEVYSEV-KSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPP-FSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQL-----EIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPP------GILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKY--HHANQHNEADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSIDFKMELE----KPWLCGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMT---TGQFACPRCESGIMKPLLSSSLLNRQLGYYRF----------LLTGKENLSYKQK----ELLQMCSKY---VERVLERSDYMNVDFKSLMA 4282
            R RR++ SKK  + + L +LKKAK  G   K E+E    +Y+ V+EE Y KL + RQ D++I  D    Y+E G+EIFD+  E+D     ++ K  K  N + +N KK  +       ++ KS+F        + K ++ +    L   L   N E  +I  P   + KKK         F +H    + S KI     ++ P  T   P+   + +   +    E     ST E  E+         +  +D DFDEP E   V     A     +E +P    EE++ E+ + K               +D  +            +D S L L+           YW DAY D+   PGVVFLFGK   ES +  V+ C+ V  +ER +Y LP++                M +VY E  + I  K+ I   ++KPV K YAF+  DVP++++YL V+Y ++ P+LP DL G+TFS +FG NTS LE+F+++ ++KGPCWL     +  +   S CK+         + + K+ SPP   +++ ++KT+ N K++ NEI+A+   +H+   LD+A P   FQ++F +++ PKD + PY   + +  +   N K  V + A ER+L+   L K+H +DPDIIVGH + G++L +LLQR        W K GRLKRS  +PK+ G S   + ER AT GR++CDVE+SA+ELI+C+SY   +L+Q++L    K     +P+ ++  +++ S+ +  L++ T  ++   + +M EL VLPLAL+IT I GN++ RTL GG+SERNE+LLLHAF E  YIVPDK        +L     EID    +  K  ++K  YAGGLVL+PK G Y+ FILL+DFNSLYPSII E+NICFTT+ R          +A  +  D   + + + P      GILP EIRKLVE R  VKQL+   +L+ + +LQ+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT+ GREIL++TK++++        K+N    L++IYGDTDS+M+NT   N+   + V K+G  +K EVN+ YK ++++IDGV + +LLL KKKYA+L  V    S G  + KQELKGLDIVRRDWC L+ + G  ++  IL ++ S + +  +I   L  I +++ N  + + +F I KALT++P++Y + +  PHV VAL INS GG  ++ +A DTV Y+IC DG++ TA+QRAY+P+++      ++  L+ID  YYLA Q+HPVV R+ EPID IDA  +A  LGLDP+++  HH ++  E D          +  ++ DC+     C  C  +   D   +      +P L    N++   S     V ++ KL   I R I  YY     C+           C    R L +    TG   CP C    ++P  S   L  QL +YR+          L T  E    K++    ++LQ   K     E+ L RS Y  V+   L A
Sbjct:   26 RARREKKSKK-GRQEALERLKKAKA-GEKYKYEVEDFTGVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDADEKGKDGKARNKDKRNVKKLAV----TKPNNIKSMFIACAGKKTADKAVDLSKDGLLGDILQDLNTETPQITPPPVMILKKKRSIGASPNPFSVHTATAVPSGKIASPVSRKEPPLT---PVPLKRAEFAGDDVQVE-----STEEEQES-------GAMEFEDGDFDEPMEVEEVDLEPMAAKAWDKESEP---AEEVKQEADSGKGTVSYLGSFLPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLVKGADEEQVFHFYWLDAYEDQYNQPGVVFLFGKVWIESAETHVSCCVMVKNIERTLYFLPREMKIDLNTGKETGTPISMKDVYEEFDEKIATKYKIMKFKSKPVEKNYAFEIPDVPEKSEYLEVKYSAEMPQLPQDLKGETFSHVFGTNTSSLELFLMNRKIKGPCWLEVKSPQLLNQPVSWCKVEAMALKPDLVNVIKDVSPPPLVVMAFSMKTMQNAKNHQNEIIAMAALVHHSFALDKAAPKPPFQSHFCVVSKPKDCIFPYAFKEVIEKK---NVK--VEVAATERTLLGFFLAKVHKIDPDIIVGHNIYGFELEVLLQRINVCKAPHWSKIGRLKRS-NMPKLGGRSG--FGERNATCGRMICDVEISAKELIRCKSYHLSELVQQIL----KTERVVIPMENIQNMYSESSQLLYLLEHTWKDAKFILQIMCELNVLPLALQITNIAGNIMSRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKK-GRKKAAYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRV-------ASEAQKVTEDGEQEQIPELPDPSLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLILQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTYKGREILMHTKEMVQ--------KMN----LEVIYGDTDSIMINTNSTNL---EEVFKLGNKVKSEVNKLYKLLEIDIDGVFKSLLLLKKKKYAAL--VVEPTSDGNYVTKQELKGLDIVRRDWCDLAKDTGNFVIGQILSDQ-SRDTIVENIQKRLIEIGENVLNGSVPVSQFEINKALTKDPQDYPDKKSLPHVHVALWINSQGG--RKVKAGDTVSYVICQDGSNLTASQRAYAPEQL-----QKQDNLTIDTQYYLAQQIHPVVARICEPIDGIDAVLIATWLGLDPTQFRVHHYHKDEENDALLGGPAQLTDEEKYRDCERFKCPCPTCGTENIYDNVFDGSGTDMEPSLYRCSNIDCKASPLTFTVQLSNKLIMDIRRFIKKYYDGWLICE--------EPTCRNRTRHLPLQFSRTGPL-CPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFA 1462          
BLAST of DNA polymerase vs. Ensembl Human
Match: POLA1 (DNA polymerase alpha 1, catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9173])

HSP 1 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 559/1515 (36.90%), Postives = 821/1515 (54.19%), Query Frame = 2
Query:   53 RPRRQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQLDNFIEGDSE--YMESGKEIFDESDEEDIKIGPKRKKSMK--NANLKNPKKACLDFKSIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNRE--EIKAP--FLSKKKEEF-----KFDIHQPKVISSSKIKPNEPKEMPQKTVQEPIKFVKKQIVFNKGSSEKNKSPSTIENNETPEQHKIEDCIVLDDIDFDEPFETNPVVSAGFATDTKLEEHKPLWETEEIEDESSNDK---------------YDPFE-----------NIDKSSLKLI-----------YWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQA-------------QMTEVYSEV-KSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPP-FSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQL-----EIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPP------GILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKY--HHANQHNEADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSIDFKMELE----KPWLCGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMT---TGQFACPRCESGIMKPLLSSSLLNRQLGYYRF----------LLTGKENLSYKQK----ELLQMCSKY---VERVLERSDYMNVDFKSLMA 4282
            R RR++ SKK  + + L +LKKAK  G   K E+E    +Y+ V+EE Y KL + RQ D++I  D    Y+E G+EIFD+  E+D     ++ K  K  N + +N KK  +       ++ KS+F        + K ++ +    L   L   N E  +I  P   + KKK         F +H    + S KI     ++ P  T   P+   + +   +    E     ST E  E+         +  +D DFDEP E   V     A     +E +P    EE++ E+ + K               +D  +            +D S L L+           YW DAY D+   PGVVFLFGK   ES +  V+ C+ V  +ER +Y LP++                M +VY E  + I  K+ I   ++KPV K YAF+  DVP++++YL V+Y ++ P+LP DL G+TFS +FG NTS LE+F+++ ++KGPCWL        +   S CK+         + + K+ SPP   +++ ++KT+ N K++ NEI+A+   +H+   LD+A P   FQ++F +++ PKD + PY   + +  +   N K  V + A ER+L+   L K+H +DPDIIVGH + G++L +LLQR        W K GRLKRS  +PK+ G S   + ER AT GR++CDVE+SA+ELI+C+SY   +L+Q++L    K     +P+ ++  +++ S+ +  L++ T  ++   + +M EL VLPLAL+IT I GN++ RTL GG+SERNE+LLLHAF E  YIVPDK        +L     EID    +  K  ++K  YAGGLVL+PK G Y+ FILL+DFNSLYPSII E+NICFTT+ R          +A  +  D   + + + P      GILP EIRKLVE R  VKQL+   +L+ + +LQ+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT+ GREIL++TK++++        K+N    L++IYGDTDS+M+NT   N+   + V K+G  +K EVN+ YK ++++IDGV + +LLL KKKYA+L  V    S G  + KQELKGLDIVRRDWC L+ + G  ++  IL ++ S + +  +I   L  I +++ N  + + +F I KALT++P++Y + +  PHV VAL INS GG  ++ +A DTV Y+IC DG++ TA+QRAY+P+++      ++  L+ID  YYLA Q+HPVV R+ EPID IDA  +A  LGLDP+++  HH ++  E D          +  ++ DC+     C  C  +   D   +      +P L    N++   S     V ++ KL   I R I  YY     C+           C    R L +    TG   CP C    ++P  S   L  QL +YR+          L T  E    K++    ++LQ   K     E+ L RS Y  V+   L A
Sbjct:   20 RARREKKSKK-GRQEALERLKKAKA-GEKYKYEVEDFTGVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDADEKGKDGKARNKDKRNVKKLAV----TKPNNIKSMFIACAGKKTADKAVDLSKDGLLGDILQDLNTETPQITPPPVMILKKKRSIGASPNPFSVHTATAVPSGKIASPVSRKEPPLT---PVPLKRAEFAGDDVQVE-----STEEEQES-------GAMEFEDGDFDEPMEVEEVDLEPMAAKAWDKESEP---AEEVKQEADSGKGTVSYLGSFLPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLVKGADEEQVFHFYWLDAYEDQYNQPGVVFLFGKVWIESAETHVSCCVMVKNIERTLYFLPREMKIDLNTGKETGTPISMKDVYEEFDEKIATKYKIMKFKSKPVEKNYAFEIPDVPEKSEYLEVKYSAEMPQLPQDLKGETFSHVFGTNTSSLELFLMNRKIKGPCWLEVKS-PPLNQPVSWCKVEAMALKPDLVNVIKDVSPPPLVVMAFSMKTMQNAKNHQNEIIAMAALVHHSFALDKAAPKPPFQSHFCVVSKPKDCIFPYAFKEVIEKK---NVK--VEVAATERTLLGFFLAKVHKIDPDIIVGHNIYGFELEVLLQRINVCKAPHWSKIGRLKRS-NMPKLGGRSG--FGERNATCGRMICDVEISAKELIRCKSYHLSELVQQIL----KTERVVIPMENIQNMYSESSQLLYLLEHTWKDAKFILQIMCELNVLPLALQITNIAGNIMSRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKK-GRKKAAYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRV-------ASEAQKVTEDGEQEQIPELPDPSLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLILQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTYKGREILMHTKEMVQ--------KMN----LEVIYGDTDSIMINTNSTNL---EEVFKLGNKVKSEVNKLYKLLEIDIDGVFKSLLLLKKKKYAAL--VVEPTSDGNYVTKQELKGLDIVRRDWCDLAKDTGNFVIGQILSDQ-SRDTIVENIQKRLIEIGENVLNGSVPVSQFEINKALTKDPQDYPDKKSLPHVHVALWINSQGG--RKVKAGDTVSYVICQDGSNLTASQRAYAPEQL-----QKQDNLTIDTQYYLAQQIHPVVARICEPIDGIDAVLIATWLGLDPTQFRVHHYHKDEENDALLGGPAQLTDEEKYRDCERFKCPCPTCGTENIYDNVFDGSGTDMEPSLYRCSNIDCKASPLTFTVQLSNKLIMDIRRFIKKYYDGWLICE--------EPTCRNRTRHLPLQFSRTGPL-CPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFA 1455          
BLAST of DNA polymerase vs. Ensembl Human
Match: POLD1 (DNA polymerase delta 1, catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9175])

HSP 1 Score: 187.578 bits (475), Expect = 1.964e-47
Identity = 187/659 (28.38%), Postives = 312/659 (47.34%), Query Frame = 2
Query: 1721 NERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGR-------LKRSIALPKITGHSNTSWIERMATAGRLLCDV-EVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDR---CKYLSVGDTDQAMHILM--DLSHKSVAKPPGILPIEIRKLVEARNAVK-QLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKG-IQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAG-GSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPI 3649
             E  L+      +  +DPD+I G+ +  + L  L+ R Q L + T+   GR       ++ S    K TG  +T  +   +  GR+  D+ +V  RE  K RSY    +    L E+ +    S+ + DL    + +   ++L    L ++ + + L+  L VL  A+E+  + G  +   LS G+  +    LL     +  ++P                   +GG+       Y G  V+EP KG Y+  I  +DF+SLYPSI++ +N+C+TT+ R    + L + + DQ +      +    SV K  G+LP  +  L+ AR   K +L    +  + ++L  D RQ ALK++ANS+YG  G    +    +++  VT  GR+++  TK+++E   +K + +   + +  ++YGDTDSVM   G+ +V +    M +G+   + V+  +   I+L  + V    LL++KK+YA L   SR  +  ++    + KGL+ VRRD C L       ++T  L   L   D   ++ +    ISD + N +I + + +ITK LTR   +Y+  Q   HV++A R+     GS       D V Y+I +      A  ++  P  VL      E  L ID  YYL  QL   + R+ EPI
Sbjct:  373 KEEDLLQAWSTFIRIMDPDVITGYNIQNFDLPYLISRAQTLKVQTFPFLGRVAGLCSNIRDSSFQSKQTGRRDTKVV---SMVGRVQMDMLQVLLREY-KLRSYTLNAVSFHFLGEQKEDVQHSI-ITDLQNGNDQTR--RRLAVYCLKDAYLPLRLLERLMVLVNAVEMARVTGVPLSYLLSRGQQVKVVSQLLRQAMHEGLLMP---------------VVKSEGGE------DYTGATVIEPLKGYYDVPIATLDFSSLYPSIMMAHNLCYTTLLRPGTAQKLGLTE-DQFIRTPTGDEFVKTSVRK--GLLPQILENLLSARKRAKAELAKETDPLRRQVL--DGRQLALKVSANSVYGFTGAQVGKLPCLEISQSVTGFGRQMIEKTKQLVE---SKYTVENGYSTSAKVVYGDTDSVMCRFGVSSVAE---AMALGREAADWVSGHFPSPIRLEFEKVYFPYLLISKKRYAGLLFSSRPDAHDRM----DCKGLEAVRRDNCPLVAN----LVTASLRRLLIDRDPEGAVAHAQDVISDLLCN-RIDISQLVITKELTRAASDYAGKQA--HVELAERMRKRDPGSAPSL--GDRVPYVIISAAKGVAAYMKSEDPLFVL------EHSLPIDTQYYLEQQLAKPLLRIFEPI 973          
BLAST of DNA polymerase vs. Ensembl Human
Match: POLD1 (DNA polymerase delta 1, catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9175])

HSP 1 Score: 187.578 bits (475), Expect = 1.964e-47
Identity = 187/659 (28.38%), Postives = 312/659 (47.34%), Query Frame = 2
Query: 1721 NERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGR-------LKRSIALPKITGHSNTSWIERMATAGRLLCDV-EVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDR---CKYLSVGDTDQAMHILM--DLSHKSVAKPPGILPIEIRKLVEARNAVK-QLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKG-IQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAG-GSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPI 3649
             E  L+      +  +DPD+I G+ +  + L  L+ R Q L + T+   GR       ++ S    K TG  +T  +   +  GR+  D+ +V  RE  K RSY    +    L E+ +    S+ + DL    + +   ++L    L ++ + + L+  L VL  A+E+  + G  +   LS G+  +    LL     +  ++P                   +GG+       Y G  V+EP KG Y+  I  +DF+SLYPSI++ +N+C+TT+ R    + L + + DQ +      +    SV K  G+LP  +  L+ AR   K +L    +  + ++L  D RQ ALK++ANS+YG  G    +    +++  VT  GR+++  TK+++E   +K + +   + +  ++YGDTDSVM   G+ +V +    M +G+   + V+  +   I+L  + V    LL++KK+YA L   SR  +  ++    + KGL+ VRRD C L       ++T  L   L   D   ++ +    ISD + N +I + + +ITK LTR   +Y+  Q   HV++A R+     GS       D V Y+I +      A  ++  P  VL      E  L ID  YYL  QL   + R+ EPI
Sbjct:  373 KEEDLLQAWSTFIRIMDPDVITGYNIQNFDLPYLISRAQTLKVQTFPFLGRVAGLCSNIRDSSFQSKQTGRRDTKVV---SMVGRVQMDMLQVLLREY-KLRSYTLNAVSFHFLGEQKEDVQHSI-ITDLQNGNDQTR--RRLAVYCLKDAYLPLRLLERLMVLVNAVEMARVTGVPLSYLLSRGQQVKVVSQLLRQAMHEGLLMP---------------VVKSEGGE------DYTGATVIEPLKGYYDVPIATLDFSSLYPSIMMAHNLCYTTLLRPGTAQKLGLTE-DQFIRTPTGDEFVKTSVRK--GLLPQILENLLSARKRAKAELAKETDPLRRQVL--DGRQLALKVSANSVYGFTGAQVGKLPCLEISQSVTGFGRQMIEKTKQLVE---SKYTVENGYSTSAKVVYGDTDSVMCRFGVSSVAE---AMALGREAADWVSGHFPSPIRLEFEKVYFPYLLISKKRYAGLLFSSRPDAHDRM----DCKGLEAVRRDNCPLVAN----LVTASLRRLLIDRDPEGAVAHAQDVISDLLCN-RIDISQLVITKELTRAASDYAGKQA--HVELAERMRKRDPGSAPSL--GDRVPYVIISAAKGVAAYMKSEDPLFVL------EHSLPIDTQYYLEQQLAKPLLRIFEPI 973          
BLAST of DNA polymerase vs. Ensembl Celegans
Match: pola-1 (DNA polymerase [Source:UniProtKB/TrEMBL;Acc:C7IVS4])

HSP 1 Score: 555.444 bits (1430), Expect = 1.019e-172
Identity = 402/1167 (34.45%), Postives = 617/1167 (52.87%), Query Frame = 2
Query:  941 IYWFDAYHD-KKIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPK-------DQAQMTEVYSEVKSILA-KHGIESLRTKPVTKKY----AFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXS-----PPFSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQN--NFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEML-PEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNP-NLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKYHHANQHNEADNTYSKQESTDEANRFIDCKPLPIYC--RKCQH----KTSIDFKMELEKPWL----CGNCNVELLYSHADAV---NVNKKLKEIIDRIIHIYYSCIS-TCQCGYICRGMVNICNEEARKLLMTTGQFACPRCESGIMKPLLSSSLLNRQLGYYRFLL---TGKENLSYKQKEL--------------LQMCSKYVERVLERSDYMNVDFKSLMA 4282
            +YW DAY D  K  G V+LFGK +  S   +    I V  + R++Y +P+       +++ + E++ E+  +L  K      + K V K+     +F +     ++  + V Y ++  +LPSDL G TFS  F  + + LE  +++ +  GP W+          + S CK  FE+   K   I+  +S     P   +L+LN+ T +N++ + NEI  I    + +   D A PS   ++     ++T P    +PYD+ ++L +E  + +  SV   ANE++L++  L  ++  +PD+IVGH L    + +L+ R + L +  W +  RLKRSI + KI GHS +   E   TAGR++ D +++A EL+K RS++  +L Q++L  E+ + + + +P      L+  S  +  LI+ + ++ L+++ ++  L  LPL ++I+ I G +  RT+ GG++ERNEYLLLHAF +   I PDK      +   +  + +++G +    K  Y+GGLVLEPKKGLYE  ILL+DFNSLYPSII EYNIC+TT++  K     D+D+       LS        G+LP EIRKLVE R  VK L+ +  N +K+K  Q DIRQ ALK+TANSMYGCLGF  SRF A  LAALVT  GREIL+++K ++E             +   ++YGDTDS+M+NT   N        K+G  IK+ VN+ ++ ++L++DGV +R+LLL KKKYA+L +    K   K     ELKGLDIVRRDW +L+ E G  ++  IL+  L+ +++  SI + L+ I   + +  + L  F I+K LTRNPE Y++ + Q H  VA R+N +G      R  D VEY+IC DGT   ATQRAY   E+      E   L ID  YYLA Q+HPVV RL+EPI+  DA  +AE+LGLD + Y  A     +     +  +  + N  + C+ + + C    C H    + + D   +   P L    C  C          AV    V++++ E + R     + C   TC+     + M   C E             C RC +G+++   +S  L  Q  ++R +L        LS  QK+               + +  +  E+ LE++ Y  VD   + A
Sbjct:  328 MYWIDAYEDVHKANGTVYLFGKVK-TSGNAWETCSIVVKNICRKVYFMPRTKNLSTGEESSLAELHKEIGDVLRNKFNTHEFKCKMVEKELIRDESFGY-GCGTKSPLMEVLYPAEKGKLPSDLKGDTFSNTFNTSVTPLERLLIEKKFMGPGWIELYNYSDPKAKTSNCKYEFEVDMEKMRNIKYLESSDAPPPTIKLLALNVVTTLNDRKD-NEICMISMLFNPKC--DLAHPSGDSKDLKPKCLVTKPPGGSLPYDIQKRLETEKLSKFVKSV---ANEKALLTLFLAMINEDEPDMIVGHDL-SATIALLVSRLEKLKLPNWSRISRLKRSINIGKI-GHSKSGQWE--LTAGRMMLDSKLAAMELVKSRSFDLTELSQQILGAERREIYANEIP-----QLYVDSKDLISLINWSWNDLLLSLRIVVRLNALPLYIQISQIVGGIASRTMMGGRAERNEYLLLHAFEKADLIAPDK---YNSSESKKKKEESQEGDEKKSGKAQYSGGLVLEPKKGLYETLILLLDFNSLYPSIIQEYNICYTTLEYSK-----DSDE------QLSVPQSTDIEGVLPREIRKLVECRRDVKSLMKSERNEAKKK--QMDIRQMALKLTANSMYGCLGFQYSRFYAKPLAALVTAKGREILMHSKDLVE------------KMGYSVVYGDTDSIMINT---NSVDLVAAKKLGNEIKKAVNKCHRLLELDLDGVFKRMLLLKKKKYAALTINPDTKVEAK-----ELKGLDIVRRDWSQLAKETGTAVVDKILDASLTRDEMVSSIDDLLREIRAKLDSGTVPLEMFQISKQLTRNPEQYADVKAQCHAAVAQRLNKSGKF--NLRHNDIVEYVICEDGTDNPATQRAYHRTEM-----AENSALKIDLLYYLAQQIHPVVSRLVEPIEETDAVRIAENLGLDSTNYRRAAAAQASQRAAEEDCAWHQENYDL-CEGIHVICPLDGCGHSNVIRETFDCVTDASSPRLLFSGCAQCQGSWDLQEHQAVIGNQVDRQMSEFVARHHLAAFKCDEPTCEFKTRVQTM-KWCRE----------GLECIRCSTGVLRREYTSKQLFDQQMFFRTILDVDAAVRKLSDAQKKAAKVRVEYNGCKIDSMMLADRINEKYLEKNAYNRVDLSYIFA 1422          
BLAST of DNA polymerase vs. Ensembl Celegans
Match: pola-1 (DNA polymerase [Source:UniProtKB/TrEMBL;Acc:C7IVS4])

HSP 1 Score: 553.903 bits (1426), Expect = 7.866e-172
Identity = 403/1156 (34.86%), Postives = 613/1156 (53.03%), Query Frame = 2
Query:  941 IYWFDAYHD-KKIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPK-------DQAQMTEVYSEVKSILA-KHGIESLRTKPVTKKY----AFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXS-----PPFSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQN--NFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEML-PEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNP-NLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKYHHANQHNEADNTYSKQESTDEANRFIDCKPLPIYC--RKCQH----KTSIDFKMELEKPWL----CGNCNVELLYSHADAV---NVNKKLKEIIDRIIHIYYSCIS-TCQCGYICRGMVNICNEEARKLLMTTGQFACPRCESGIMKPLLSSSLLNRQLGYYRFLL---TGKENLSYKQKE--LLQMCSKYVERVLERSDYMNVDFKSLMAK 4285
            +YW DAY D  K  G V+LFGK +  S   +    I V  + R++Y +P+       +++ + E++ E+  +L  K      + K V K+     +F +     ++  + V Y ++  +LPSDL G TFS  F  + + LE  +++ +  GP W+          + S CK  FE+   K   I+  +S     P   +L+LN+ T +N++ + NEI  I    + +   D A PS   ++     ++T P    +PYD+ ++L +E  + +  SV   ANE++L++  L  ++  +PD+IVGH L    + +L+ R + L +  W +  RLKRSI + KI GHS +   E   TAGR++ D +++A EL+K RS++  +L Q++L  E+ + + + +P      L+  S  +  LI+ + ++ L+++ ++  L  LPL ++I+ I G +  RT+ GG++ERNEYLLLHAF +   I PDK      +   +  + +++G +    K  Y+GGLVLEPKKGLYE  ILL+DFNSLYPSII EYNIC+TT++  K     D+D+       LS        G+LP EIRKLVE R  VK L+ +  N +K+K  Q DIRQ ALK+TANSMYGCLGF  SRF A  LAALVT  GREIL+++K ++E             +   ++YGDTDS+M+NT   N        K+G  IK+ VN+ ++ ++L++DGV +R+LLL KKKYA+L +    K   K     ELKGLDIVRRDW +L+ E G  ++  IL+  L+ +++  SI + L+ I   + +  + L  F I+K LTRNPE Y++ + Q H  VA R+N +G      R  D VEY+IC DGT   ATQRAY   E+      E   L ID  YYLA Q+HPVV RL+EPI+  DA  +AE+LGLD + Y  A     +     +  +  + N  + C+ + + C    C H    + + D   +   P L    C  C          AV    V++++ E + R     + C   TC+     + M   C E             C RC +G+++   +S  L  Q  ++R +L        LS  QK   L     K  E+ LE   +     K+  AK
Sbjct:  328 MYWIDAYEDVHKANGTVYLFGKVK-TSGNAWETCSIVVKNICRKVYFMPRTKNLSTGEESSLAELHKEIGDVLRNKFNTHEFKCKMVEKELIRDESFGY-GCGTKSPLMEVLYPAEKGKLPSDLKGDTFSNTFNTSVTPLERLLIEKKFMGPGWIELYNYSDPKAKTSNCKYEFEVDMEKMRNIKYLESSDAPPPTIKLLALNVVTTLNDRKD-NEICMISMLFNPKC--DLAHPSGDSKDLKPKCLVTKPPGGSLPYDIQKRLETEKLSKFVKSV---ANEKALLTLFLAMINEDEPDMIVGHDL-SATIALLVSRLEKLKLPNWSRISRLKRSINIGKI-GHSKSGQWE--LTAGRMMLDSKLAAMELVKSRSFDLTELSQQILGAERREIYANEIP-----QLYVDSKDLISLINWSWNDLLLSLRIVVRLNALPLYIQISQIVGGIASRTMMGGRAERNEYLLLHAFEKADLIAPDK---YNSSESKKKKEESQEGDEKKSGKAQYSGGLVLEPKKGLYETLILLLDFNSLYPSIIQEYNICYTTLEYSK-----DSDE------QLSVPQSTDIEGVLPREIRKLVECRRDVKSLMKSERNEAKKK--QMDIRQMALKLTANSMYGCLGFQYSRFYAKPLAALVTAKGREILMHSKDLVE------------KMGYSVVYGDTDSIMINT---NSVDLVAAKKLGNEIKKAVNKCHRLLELDLDGVFKRMLLLKKKKYAALTINPDTKVEAK-----ELKGLDIVRRDWSQLAKETGTAVVDKILDASLTRDEMVSSIDDLLREIRAKLDSGTVPLEMFQISKQLTRNPEQYADVKAQCHAAVAQRLNKSGKF--NLRHNDIVEYVICEDGTDNPATQRAYHRTEM-----AENSALKIDLLYYLAQQIHPVVSRLVEPIEETDAVRIAENLGLDSTNYRRAAAAQASQRAAEEDCAWHQENYDL-CEGIHVICPLDGCGHSNVIRETFDCVTDASSPRLLFSGCAQCQGSWDLQEHQAVIGNQVDRQMSEFVARHHLAAFKCDEPTCEFKTRVQTM-KWCRE----------GLECIRCSTGVLRREYTSKQLFDQQMFFRTILDVDAAVRKLSDAQKSSCLRNFIGKKWEKSLENGKFRRNSAKNQAAK 1411          
BLAST of DNA polymerase vs. Ensembl Celegans
Match: F10C2.4 (DNA polymerase delta catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:P90829])

HSP 1 Score: 184.111 bits (466), Expect = 9.301e-47
Identity = 178/651 (27.34%), Postives = 307/651 (47.16%), Query Frame = 2
Query: 1721 NERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATA----GRLLCDV-EVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYK-GIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRIN--SAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPI 3649
            NE+ L+      +  +DPDII G+ ++ + L  +L R + L++      GR K   ++ +    S+     R+  +    GR++ DV +V  R+  K RSY    +  + L E+ K  V    + DL          ++L    L ++ + + L+ +L  +   +E+  + G  +   L+ G+  +   ++L    +  + +P           +E +  + +G         Y G  V++P +G Y   I  +DF SLYPSI++ +N+C+TT+   K     + +  +         + +K  G+LP  +  ++ AR   K  + N    + K + ++ RQ ALKI+ANS+YG  G +  +    +++  VT  GR+++  TK  +E    K +          +IYGDTDSVMV  G+  V Q    M+IG    +EV++ +   I+L  + V    LL+NKK+YA L     D        K + KGL+ VRRD C L      ++L + LE+ L   D   ++    ++ISD + N KI +   II+K LT++ + Y   Q   HV++A R+    AG +    R  D V Y+      +  A +RA  P  VL ++      + +D  +YL +QL   + R+ EPI
Sbjct:  343 NEKVLLEKWAEFVREVDPDIITGYNILNFDLPYILDRAKVLSLPQVSHLGRQKEKGSVVRDAAISSKQMGSRVNKSIDIHGRIIFDVLQVVLRDY-KLRSYTLNSVSYQFLSEQ-KEDVEHNIIPDLQR--GDEQTRRRLAQYCLKDAYLPLRLLDKLMSIINYIEMARVTGVPMNFLLTKGQQIKILSMMLRRCKQNNFFLP----------VIEANSGDGEG---------YEGATVIDPIRGFYNEPIATLDFASLYPSIMIAHNLCYTTL--LKSPQGVENEDYIRTPSGQYFATKSKRRGLLPEILEDILAARKRAKNDMKNEK-DEFKRMVYNGRQLALKISANSVYGFTGATVGKLPCLEISQSVTAFGRKMIDMTKLEVERIYKKGALDGKCPADAKVIYGDTDSVMVKFGVETVAQ---AMEIGLDAAKEVSKIFTPPIKLEFEKVYSPYLLINKKRYAGLYFTKPDVHD-----KMDCKGLETVRRDNCPLV----AKVLGVCLEKLLIERDQQSALDFAKRTISDLLCN-KIDISLLIISKELTKSGDKYQAKQA--HVELAARMKKRDAGSAP---RLGDRVPYVFVAAAKNVPAYERAEDPTFVLQNN------IPLDTKHYLTNQLAKPLARIFEPI 943          
BLAST of DNA polymerase vs. Ensembl Celegans
Match: rev-3 (DNA polymerase [Source:UniProtKB/TrEMBL;Acc:A0A0K3AX87])

HSP 1 Score: 102.449 bits (254), Expect = 1.663e-21
Identity = 130/542 (23.99%), Postives = 223/542 (41.14%), Query Frame = 2
Query: 1769 DPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATA-----GRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLI-----DLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTI----------------------DRCKYLSVGDTDQAMHILMDLSHKSVAKPP------------GILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQH--DIRQKALKITANSMYGCLGFSQS-RFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEV-NRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEE 3250
            D D+++G+  I    G   +R + L         R+    AL  I  + +   ++          GRLL  V    R  +  R+Y+    +  +L +K       +P+ D   L     G +  I        L  S +NI L+ E+       E+  + G       + G   R E +LL   +   ++ P     L +N     +Q                  L+LEP+  +Y + ++++DF SLYPS+++ YN C++TI                         KY    D      I+  +++K V   P            G++P+ +R+++ AR  VK  +     +K K L+   D RQ ALK+ AN  YG    + S R    +LA  +   GRE L  + ++++ G              ++IYGDTDS+ V     +V   +   +IG+ I ++V N     + L ++ V +  +L  KK+YA   +   +   G L    + KG++ VRRD C +  EV ++ L +I  +
Sbjct:  598 DVDVMIGYETIRLSWGFFFRRIKLLG-------SRISMDRAL--IDAYEDHIEVDDQEITVAPPKGRLLVSVWKVVRSDLALRNYDLGSAVANVLRKK-------IPMLDNAALMRRIKGERSAIRNDVHLHLLKLSSLNISLLTEMNWFLKNAEMARVYGIQFHEVWTRGSQLRVESMLLRLAHRMNFVAP-SITHLQRNMMGSPEQLQ----------------LILEPQSKVYFDPVIVLDFQSLYPSMVIAYNYCYSTILGKIGNLVQMNDESRNREEIVLGAIKYHPSKD-----DIVKLVAYKEVCASPLASMFVKKSKREGVMPLLLREILAARIMVKSAMKR---TKNKKLKRILDARQLALKLVANVSYGYTAANWSGRMPCAELADAILGKGRETLERSIEMVQRGDYG---------GAEVIYGDTDSMFVLVRGASV---EEAFEIGRRIVDDVTNSNPDPVVLKLEKVYKGCVLETKKRYAGW-MYEHENDEGSL----DAKGIETVRRDTCPIVAEVLEKSLGLIFSQ 1081          
BLAST of DNA polymerase vs. Ensembl Celegans
Match: rev-3 (DNA polymerase [Source:UniProtKB/TrEMBL;Acc:A0A0K3AX87])

HSP 1 Score: 100.523 bits (249), Expect = 5.404e-21
Identity = 130/542 (23.99%), Postives = 223/542 (41.14%), Query Frame = 2
Query: 1769 DPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATA-----GRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLI-----DLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTI----------------------DRCKYLSVGDTDQAMHILMDLSHKSVAKPP------------GILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQH--DIRQKALKITANSMYGCLGFSQS-RFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEV-NRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEE 3250
            D D+++G+  I    G   +R + L         R+    AL  I  + +   ++          GRLL  V    R  +  R+Y+    +  +L +K       +P+ D   L     G +  I        L  S +NI L+ E+       E+  + G       + G   R E +LL   +   ++ P     L +N     +Q                  L+LEP+  +Y + ++++DF SLYPS+++ YN C++TI                         KY    D      I+  +++K V   P            G++P+ +R+++ AR  VK  +     +K K L+   D RQ ALK+ AN  YG    + S R    +LA  +   GRE L  + ++++ G              ++IYGDTDS+ V     +V   +   +IG+ I ++V N     + L ++ V +  +L  KK+YA   +   +   G L    + KG++ VRRD C +  EV ++ L +I  +
Sbjct:  314 DVDVMIGYETIRLSWGFFFRRIKLLG-------SRISMDRAL--IDAYEDHIEVDDQEITVAPPKGRLLVSVWKVVRSDLALRNYDLGSAVANVLRKK-------IPMLDNAALMRRIKGERSAIRNDVHLHLLKLSSLNISLLTEMNWFLKNAEMARVYGIQFHEVWTRGSQLRVESMLLRLAHRMNFVAP-SITHLQRNMMGSPEQLQ----------------LILEPQSKVYFDPVIVLDFQSLYPSMVIAYNYCYSTILGKIGNLVQMNDESRNREEIVLGAIKYHPSKD-----DIVKLVAYKEVCASPLASMFVKKSKREGVMPLLLREILAARIMVKSAMKR---TKNKKLKRILDARQLALKLVANVSYGYTAANWSGRMPCAELADAILGKGRETLERSIEMVQRGDYG---------GAEVIYGDTDSMFVLVRGASV---EEAFEIGRRIVDDVTNSNPDPVVLKLEKVYKGCVLETKKRYAGW-MYEHENDEGSL----DAKGIETVRRDTCPIVAEVLEKSLGLIFSQ 797          
BLAST of DNA polymerase vs. Ensembl Fly
Match: DNApol-alpha180 (gene:FBgn0259113 transcript:FBtr0084115)

HSP 1 Score: 676.781 bits (1745), Expect = 0.000e+0
Identity = 443/1177 (37.64%), Postives = 653/1177 (55.48%), Query Frame = 2
Query:  932 LKLIYWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLP-------------KDQAQMTEVYSEVKSILAKH-GIESLRTKPVTKKYAFQFI--DVPDETDYLMVQYDSK--FPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPPFSILSL-----NIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEAN-ERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQ--SNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKYHHANQHNEADNTYSKQ-----ESTDEANRFIDCKPLPIYCRKCQHKTSIDFKMELEKPWLCGNCNVELLYSHADA----------VNVNKKLKEIIDRIIHIYYSCISTC---QCGYICRGMVNICNEEARKLLMTTGQFACPRCESGIMKPLLSSSLLNRQLGYYRFLLT-GKENLSYKQ------KELLQMCSKYVERVLERSDYMNVDFKSLMAKFSRQIKI 4306
            L+  YW +AY D  K+PG VFLFG+T D  +     VC+RV  + R +Y+LP             K +  + ++Y E  S +A    +E  R++ VTK +A   I  +VP   DYL V YD K   P L +D    + + IFGA T+ LE F+LD ++KGPCWL  +G + S    S C     +   K +++ ++K  P     L     N++T MN K++ NEI  I    HN  ++DR  P   F  +   LT P     P DLN ++A      YK++ + + + ER+L+S  L +   +D D+IV    +  QL ++  +  AL I  W + GRL+ S +  K         +E     GR++CDV+ SA E I+ RSY+ + L +++L  K ++    V   DL  ++     I +LI LT+ ++   + LM EL ++PLAL+IT ICGN + RTL GG+SERNE+LLLHAF+EK YIVPDK     ++   + D   S       +K+K  YAGGLVLEP +GLYE ++LLMDFNSLYPSII EYNICFTT+ +       D D+ +  L D   +     PGILP+++++LVE+R  VK+L+  P+LS E  +Q+ IRQ ALK+TANSMYGCLGF+ SRF A  LAALVT  GREIL NT+++++        K+N     D++YGDTDS+M+NT   N+  YD V KIG  IK+ VN+ YK ++L+IDGV   +LLL KKKYA++  +S+D S G L  +QE KGLDIVRRDW +L++ VGK +L  +L E+   E L  ++H  L+ I   +    + L  F+ITK LTR P+ Y+N    PHVQVALR+N      ++Y+  D V+Y+IC DGT+  A QRAY   E+ +S   E++KL +D NYYL HQ+HPVV R++E ++  DAS +AE LG+DP+K+    Q  + +NT   +     ++T +  R   C+P    C  C+ +          +P    N ++ +L   A +           +V  +L+  + + +  +Y     C    C +         N     L   + +  C +C SG +    +   L  QL Y RF+   GK+ L  K       ++  Q+  + V++ L+ S Y+ +    L A+   Q+ +
Sbjct:  362 LRFWYW-EAYEDPVKMPGEVFLFGRTADGKS-----VCLRVQNINRVLYLLPRQFLLDPISKEPTKQKVTVADIYKEFDSEVANQLKLEFFRSRKVTKSFAHHAIGIEVPQSCDYLEVHYDGKKPLPNLSADKKYNSIAHIFGATTNALERFLLDRKIKGPCWLQVTGFKVSPTPMSWCNTEVTLTEPKNVELVQDKGKPAPPPPLTLLSLNVRTSMNPKTSRNEICMISMLTHNRFHIDRPAPQPAFNRHMCALTRPAVVSWPLDLNFEMA-----KYKSTTVHKHDSERALLSWFLAQYQKIDADLIVTFDSMDCQLNVITDQIVALKIPQWSRMGRLRLSQSFGK-------RLLEHFV--GRMVCDVKRSAEECIRARSYDLQTLCKQVLKLK-ESERMEVNADDLLEMYEKGESITKLISLTMQDNSYLLRLMCELNIMPLALQITNICGNTMTRTLQGGRSERNEFLLLHAFHEKNYIVPDKKPVSKRSGAGDTDATLSGADATMQTKKKAAYAGGLVLEPMRGLYEKYVLLMDFNSLYPSIIQEYNICFTTVQQ-----PVDADE-LPTLPDSKTE-----PGILPLQLKRLVESRKEVKKLMAAPDLSPELQMQYHIRQMALKLTANSMYGCLGFAHSRFFAQHLAALVTHKGREILTNTQQLVQ--------KMN----YDVVYGDTDSLMINT---NITDYDQVYKIGHNIKQSVNKLYKQLELDIDGVFGCLLLLKKKKYAAIK-LSKD-SKGNLRREQEHKGLDIVRRDWSQLAVMVGKAVLDEVLSEKPLEEKLD-AVHAQLEKIKTQIAEGVVPLPLFVITKQLTRTPQEYANSASLPHVQVALRMNRERN--RRYKKGDMVDYVICLDGTTNAAMQRAYHLDELKTS---EDKKLQLDTNYYLGHQIHPVVTRMVEVLEGTDASRIAECLGMDPTKFRQNAQRTQRENTEQSEGESLLKTTLQLYRL--CEPFRFQCVTCKTE---QLMASAYRPG-PSNSHIAVLQQCAKSECQTAPIQYLASVRNQLQLSMRQYVQRFYKNWLVCDHPDCNF---------NTRTHSLRKKSHRPLCQKCRSGSLLRQYTERDLYNQLCYLRFMFDLGKQTLQQKPTLTPELEQAYQLLYETVDQQLQSSSYVIISLSKLFARSLAQMSL 1468          
BLAST of DNA polymerase vs. Ensembl Fly
Match: DNApol-delta (gene:FBgn0263600 transcript:FBtr0075522)

HSP 1 Score: 182.57 bits (462), Expect = 4.079e-46
Identity = 181/672 (26.93%), Postives = 295/672 (43.90%), Query Frame = 2
Query: 1700 NSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLK--RSIALPKITGHSNTSWIERMAT--AGRLLCDVEVSARELIKCRSYE----QRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPP------------GILPIEIRKLVEARNAVKQLLN-NPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRY-KGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPI 3649
            + VL    E  ++      +  +DPDI+ G+ +  +    LL R   L +  +   GR+K  RS+   ++         E       GR+  D+        K RSY         +QE   +   + ++ +  GD  T        ++L    L ++ + + L+ +L  +   +E+  + G  +   L+ G+  +    LL     K +I+P   +            S+EQ          Y G  V+EPK+G Y + I  +DF SLYPSI++ +N+C+TT      L +G T + +    +L    V + P            G+LP  +  L+ AR   K  L    +  K K+L  D RQ ALKI+ANS+YG  G    +    +++  VT +GR ++  TK  +E    + +   N  V   +IYGDTDSVMVN G+  +   +  M++G+   E V+ ++   I+L  + V    LL+NKK+YA L     D        K + KG++ VRRD   L   +    L  +L E      +A     Y+K +  D+   +I +   +ITK L +   +Y+  Q    +   ++    G + K     D V Y+IC    +  A Q+A  P  VL +S      + ID  YYL  QL   + R+ EPI
Sbjct:  350 SQVLCHDKETQMLDKWSAFVREVDPDILTGYNINNFDFPYLLNRAAHLKVRNFEYLGRIKNIRSVIKEQMLQSKQMGRRENQYVNFEGRVPFDLLFVLLRDYKLRSYTLNAVSYHFLQEQKEDVHHSIITDLQNGDEQTR-------RRLAMYCLKDAYLPLRLLEKLMAIVNYMEMARVTGVPLESLLTRGQQIKVLSQLLRKAKTKGFIMPSYTS----------QGSDEQ----------YEGATVIEPKRGYYADPISTLDFASLYPSIMMAHNLCYTT------LVLGGTREKLRQQENLQDDQVERTPANNYFVKSEVRRGLLPEILESLLAARKRAKNDLKVETDPFKRKVL--DGRQLALKISANSVYGFTGAQVGKLPCLEISGSVTAYGRTMIEMTKNEVESHYTQANGYENNAV---VIYGDTDSVMVNFGVKTL---ERSMELGREAAELVSSKFVHPIKLEFEKVYYPYLLINKKRYAGLYFTRPDTYD-----KMDCKGIETVRRDNSPLVANLMNSCLQKLLIERDPDGAVA-----YVKQVIADLLCNRIDISHLVITKELAKT--DYAAKQAHVELAAKMKKRDPGTAPK---LGDRVPYVICAAAKNTPAYQKAEDPLYVLENS------VPIDATYYLEQQLSKPLLRIFEPI 959          
BLAST of DNA polymerase vs. Ensembl Fly
Match: DNApol-zeta (gene:FBgn0002891 transcript:FBtr0088831)

HSP 1 Score: 95.9005 bits (237), Expect = 2.257e-19
Identity = 89/334 (26.65%), Postives = 155/334 (46.41%), Query Frame = 2
Query: 2393 RKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTT-IDRCKYLSVGD-----------TDQAMHILMDLSHKSVAKPP------------GILPIEIRKLVEARNAVKQ--LLNNPNLSKEKLLQHDIRQKALKITANSMYG--CLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNR-RYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSIS 3307
            R P Y   L++EP+   Y + ++++DF SLYPS+I+ YN CF+T + R ++L               + Q +  L  L H  V   P            GILP  + ++++ R  VKQ   L+  + + +++L    RQ  LK+ AN  YG     FS  R  + ++   V   GRE L    K++E+         N    + ++YGDTDS+ V     N  +     +IG+ I + V     + ++L ++ V +  +L  KK+Y      + D+         E KG++ VRRD C    ++ +++L ++ E +   +  A+    + K +S
Sbjct: 1582 RAPEYLA-LIMEPQSRFYADPLIVLDFQSLYPSMIIAYNYCFSTCLGRVEHLGGSSPFEFGASQLRVSRQMLQKL--LEHDLVTVSPCGVVFVKREVREGILPRMLTEILDTRQMVKQSMKLHKDSSALQRILHS--RQLGLKLMANVTYGYTAANFS-GRMPSVEVGDSVVSKGRETLERAIKLVEN---------NEEWKVRVVYGDTDSMFVLVPGRNRAE---AFRIGEEIAKAVTEMNPQPVKLKLEKVYQPCMLQTKKRYVGYMYETADQEQPVY----EAKGIETVRRDGCPAVAKMLEKVLRILFETQDVSKIKAYVCRQFTKLLS 1893          
BLAST of DNA polymerase vs. Ensembl Zebrafish
Match: pola1 (polymerase (DNA directed), alpha 1 [Source:ZFIN;Acc:ZDB-GENE-030114-9])

HSP 1 Score: 848.195 bits (2190), Expect = 0.000e+0
Identity = 564/1517 (37.18%), Postives = 828/1517 (54.58%), Query Frame = 2
Query:   41 DTYG----RPRRQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQ--LDNFIEGDSEYMESGKEIFDESDEEDIKIGPKRKKSMKNANL-KNPKKACLDFKSIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNREEIKAPFLSKKKEEFKFDIHQPKVISSSK------------IKPNEPKEMPQKTVQEPIKFVKKQIVFN-----KGSSEKNKSPSTIENNETPEQHKIEDCIVLDDIDFDEPF----------------ETNPVVSAGFATDT----------------KLEEHKPLWETEEIEDESSNDKYDPFENIDKSSLKLIYWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQ------------AQMTEVYSEVKSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXS-PPFSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQG-GKFSK--RKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKYHHANQH--NEADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSIDFKMELEKPWL------CGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFA--CPRCESGIMKPLLSSSLLNRQLGYYRFL----------LTGKENLSYKQKELLQMCSKY------VERVLERSDYMNVDFKSLMAKF 4288
            DT G    R RR++  +K+ +   L +LK+AK+ G  +K E+E    IYD V+EE Y K+  +RQ       +  + Y+E G+EIFDE  ++D  +GPK K++ K  +  KN KK+ +       +S KS+F                   +   +LS   ++++    L     E    +  P +I+  K            +KP  PKE+P+  V +P   V +    +       S E +K+ +  +  +   +   E+ I  D++DFDEP                 ET P+V     T+                 K+EE KP+    E++ +SS  +    E  D   +   YW DA+ D+   PGVVFLFGK   ES +  V+ C+ V  +ER +Y+LP++               M +VY E   I  K  I   ++KPVTK YAF+  D+P +++YL V+Y ++ P LPSDL G TFS +FG NTS LE F+L+ +++GPCWL  +  + S+   S CK+    +    I + K+ S PP  ++S+++KTV N K++ NEIV+I   +H+   LD+APP   FQ +F +++ P D V PYD    +  + G      V I   ER+L+   L K+H +DPD++VGH + G+ L +LLQR     +  W K GRL+R+  +PK+ G S   + E+ AT GRL+CD+E+SA+ELI+C+SY   +L+ ++L    KA    VP  ++   ++ S  +  L++LT  ++ + + +M EL VLPLAL+IT I GN++ RTL GG+SERNEYLLLHAF+E+ +IVPDK         L  D+  + G GK +K  +K  YAGGLVL+PK G Y+ FILL+DFNSLYPSII E+NICFTT++R    +   T++    + +L  +S+    GILP EIRKLVE R  VKQL+  P+L+ +  LQ+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT  GREIL++TK++++             + L++IYGDTDS+M+NT   N+   + V K+G  +K EVN+ YK ++++IDGV + +LLL KKKYA+L V    +  GK   KQELKGLDIVRRDWC L+ E G  ++  IL ++ + + +  +I  +L  I + + N  I L  F I K+LT+ P++Y + +  PHV VAL INS GG  K+ +A DTV Y+IC DG++  A+QRAY+ +++      ++  L++D  YYL+ Q+HPVV R+ EPI+ IDA  +A  LGLDPS +    Q   +EAD+         +  R+ DC+     C  C  +   D   E     L      C  C+V    S  D  V +  KL+  I R I  YYS    C+           C    R+L +   +    CP C    +KP  S   L  QL +YR++          LTG + L +K KE  +    Y       + +L  S Y  V+   L   F
Sbjct:   20 DTCGIAASRSRREKK-EKVGRKSALEQLKRAKK-GEKVKYEVEEFTSIYDEVDEEQYSKIVRERQDDDWIIDDDGTGYVEDGREIFDEELDDD-ALGPKSKQAAKGGDSKKNVKKSSVS----KPNSIKSMF----------MNSNVKKPAEKHVDLS---QDDLLGDILQDLHSEKSVVLTPPPIITLKKKKTLGSPMNPFSVKPQMPKELPEVHVSKPRPVVTRVPPADPSPRSAASVEPSKA-TAAQIKKPKIEEPEEEAIEFDEMDFDEPMEAENLEEEPVKEKAEPETKPIVKVEPKTEPQDKMLISGLVGGMGWEKMEEGKPIETPVEVQVDSS--QLPLVEGPDGDMVFRFYWLDAFEDQYNQPGVVFLFGKVWIESAEAHVSCCVAVKNIERTMYLLPREHKVNLATGEKGVAVGMMDVYKEFNEISEKFKIMKFKSKPVTKNYAFEIPDIPSQSEYLEVKYSAEIPSLPSDLKGTTFSHVFGTNTSSLEHFLLNRKIRGPCWLDVTTPQLSNQPISWCKVEAVAQKSDLISVVKDLSPPPLVVMSISLKTVQNPKTHQNEIVSIAALVHHTFPLDKAPPRPPFQTHFCVVSKPNDCVFPYDFKDAVRKKNGI-----VEIAGTERALLGFFLAKMHKIDPDVLVGHDIFGFDLEVLLQRINVCKVPHWSKIGRLRRA-NMPKLGGRS--GFAEKSATCGRLVCDIEISAKELIRCKSYNLTELVSQIL----KAERPVVPPENIRNFYSDSTHLLYLLELTWMDAKLILQIMCELNVLPLALQITNIAGNVMSRTLMGGRSERNEYLLLHAFHERDFIVPDKQFFKKAQQDLGEDEEGDSGKGKSNKTRKKAAYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVERGATNTRKKTEEDEDEIPELPDQSLEM--GILPKEIRKLVERRRQVKQLMKEPDLNPDLYLQYDIRQKALKLTANSMYGCLGFSFSRFYAKPLAALVTHKGREILMHTKEMVQ------------RMNLEVIYGDTDSIMINTNSTNL---EEVFKLGNKVKSEVNKLYKLLEIDIDGVFKSLLLLKKKKYAALMV--EPQGDGKYTTKQELKGLDIVRRDWCDLAKECGNYVIGQILSDQ-NRDTIIENIQKHLIEIGEKVANGNIPLNMFEIHKSLTKEPQDYPDKKSLPHVHVALWINSQGG--KKVKAGDTVSYVICQDGSNLAASQRAYTLEQL-----QKQPGLNLDTQYYLSQQVHPVVGRICEPIEGIDAVLIATWLGLDPSHFRAQQQQREDEADDFLGAPAQLTDEERYRDCERFTFTCPDCGTENIYDNVFEGTGSTLQLSLKSC--CHVPCGGSPMDHQVQIGNKLQLDIRRHIRRYYSGWLLCE--------DQACRNRIRRLPIAFSRSGPICPACLRSTLKPEYSEKALYNQLSFYRYIFDWEYAINKVLTGDDKLKFKSKEWKEEMEVYKKLKGVTDNILATSGYSEVNLAKLFQAF 1464          
BLAST of DNA polymerase vs. Ensembl Zebrafish
Match: pola1 (polymerase (DNA directed), alpha 1 [Source:ZFIN;Acc:ZDB-GENE-030114-9])

HSP 1 Score: 838.18 bits (2164), Expect = 0.000e+0
Identity = 560/1500 (37.33%), Postives = 824/1500 (54.93%), Query Frame = 2
Query:   53 RPRRQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQLDNFIEG--DSEYMESGKEIFDESDEEDIKIGPKRKKSMKNANLK-NPKKACLDFKSIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNREEIKAPFLSKKKEEFKFDIHQPKVISSSKIK----PNEP----KEMPQKTVQEPIKFVKKQIVFNKGSSEKNKSPSTIENNETPEQHKIEDCIVLDDIDFDEPFE----------------TNPVVSAGFATDT----------------KLEEHKPLWETEEIEDESSNDKYDPFENIDKSSLKLIYWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQ------------AQMTEVYSEVKSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPP-FSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQG-GKFSK--RKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKYHHANQH--NEADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSIDFKMELEKPWL------CGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFA--CPRCESGIMKPLLSSSLLNRQLGYYRFL----------LTGKENLSYKQKELLQMCSKY------VERVLERSDYMNVDFKSLMAKF 4288
            R RR++  +K+ +   L +LK+AK+ G  +K E+E    IYD V+EE Y K+  +RQ D++I     + Y+E G+EIFDE  ++D  +GPK K++ K  + K N KK+ +       +S KS+F                   +   +LS   ++++    L     E    +  P +I+  K K    P  P     +MP+  +  P      +   +  S E +K+ +  +  +   +   E+ I  D++DFDEP E                T P+V     T+                 K+EE KP+    E++ +SS  +    E  D   +   YW DA+ D+   PGVVFLFGK   ES +  V+ C+ V  +ER +Y+LP++               M +VY E   I  K  I   ++KPVTK YAF+  D+P +++YL V+Y ++ P LPSDL G TFS +FG NTS LE F+L+ +++GPCWL  +  + S+   S CK+    +    I + K+ SPP   ++S+++KTV N K++ NEIV+I   +H+   LD+APP   FQ +F +++ P D V PYD    +  + G      V I   ER+L+   L K+H +DPD++VGH + G+ L +LLQR     +  W K GRL+R+  +PK+ G S   + E+ AT GRL+CD+E+SA+ELI+C+SY   +L+ ++L    KA    VP  ++   ++ S  +  L++LT  ++ + + +M EL VLPLAL+IT I GN++ RTL GG+SERNEYLLLHAF+E+ +IVPDK         L  D+  + G GK +K  +K  YAGGLVL+PK G Y+ FILL+DFNSLYPSII E+NICFTT++R    +   T++    + +L  +S+    GILP EIRKLVE R  VKQL+  P+L+ +  LQ+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT  GREIL++TK++++             + L++IYGDTDS+M+NT   N+   + V K+G  +K EVN+ YK ++++IDGV + +LLL KKKYA+L V    +  GK   KQELKGLDIVRRDWC L+ E G  ++  IL ++ + + +  +I  +L  I + + N  I L  F I K+LT+ P++Y + +  PHV VAL INS GG  K+ +A DTV Y+IC DG++  A+QRAY+ +++      ++  L++D  YYL+ Q+HPVV R+ EPI+ IDA  +A  LGLDPS +    Q   +EAD+         +  R+ DC+     C  C  +   D   E     L      C  C+V    S  D  V +  KL+  I R I  YYS    C+           C    R+L +   +    CP C    +KP  S   L  QL +YR++          LTG + L +K KE  +    Y       + +L  S Y  V+   L   F
Sbjct:   28 RSRREKK-EKVGRKSALEQLKRAKK-GEKVKYEVEEFTSIYDEVDEEQYSKIVRERQDDDWIIDDDGTGYVEDGREIFDEELDDD-ALGPKSKQAAKGGDSKKNVKKSSVS----KPNSIKSMF----------MNSNVKKPAEKHVDLS---QDDLLGDILQDLHSEKSVVLTPPPIITLKKKKTLGSPMNPFSVKPQMPKVKIPIPPADPSPR---SAASVEPSKA-TAAQIKKPKIEEPEEEAIEFDEMDFDEPMEAENLEEEPVKEKAEPETKPIVKVEPKTEPQDKMLISGLVGGMGWEKMEEGKPIETPVEVQVDSS--QLPLVEGPDGDMVFRFYWLDAFEDQYNQPGVVFLFGKVWIESAEAHVSCCVAVKNIERTMYLLPREHKVNLATGEKGVAVGMMDVYKEFNEISEKFKIMKFKSKPVTKNYAFEIPDIPSQSEYLEVKYSAEIPSLPSDLKGTTFSHVFGTNTSSLEHFLLNRKIRGPCWLDVTTPQLSNQPISWCKVEAVAQKSDLISVVKDLSPPPLVVMSISLKTVQNPKTHQNEIVSIAALVHHTFPLDKAPPRPPFQTHFCVVSKPNDCVFPYDFKDAVRKKNGI-----VEIAGTERALLGFFLAKMHKIDPDVLVGHDIFGFDLEVLLQRINVCKVPHWSKIGRLRRA-NMPKLGGRSG--FAEKSATCGRLVCDIEISAKELIRCKSYNLTELVSQIL----KAERPVVPPENIRNFYSDSTHLLYLLELTWMDAKLILQIMCELNVLPLALQITNIAGNVMSRTLMGGRSERNEYLLLHAFHERDFIVPDKQFFKKAQQDLGEDEEGDSGKGKSNKTRKKAAYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVERGATNTRKKTEEDEDEIPELPDQSLEM--GILPKEIRKLVERRRQVKQLMKEPDLNPDLYLQYDIRQKALKLTANSMYGCLGFSFSRFYAKPLAALVTHKGREILMHTKEMVQ------------RMNLEVIYGDTDSIMINTNSTNL---EEVFKLGNKVKSEVNKLYKLLEIDIDGVFKSLLLLKKKKYAALMV--EPQGDGKYTTKQELKGLDIVRRDWCDLAKECGNYVIGQILSDQ-NRDTIIENIQKHLIEIGEKVANGNIPLNMFEIHKSLTKEPQDYPDKKSLPHVHVALWINSQGG--KKVKAGDTVSYVICQDGSNLAASQRAYTLEQL-----QKQPGLNLDTQYYLSQQVHPVVGRICEPIEGIDAVLIATWLGLDPSHFRAQQQQREDEADDFLGAPAQLTDEERYRDCERFTFTCPDCGTENIYDNVFEGTGSTLQLSLKSC--CHVPCGGSPMDHQVQIGNKLQLDIRRHIRRYYSGWLLCE--------DQACRNRIRRLPIAFSRSGPICPACLRSTLKPEYSEKALYNQLSFYRYIFDWEYAINKVLTGDDKLKFKSKEWKEEMEVYKKLKGVTDNILATSGYSEVNLAKLFQAF 1452          
BLAST of DNA polymerase vs. Ensembl Zebrafish
Match: pola1 (polymerase (DNA directed), alpha 1 [Source:ZFIN;Acc:ZDB-GENE-030114-9])

HSP 1 Score: 300.056 bits (767), Expect = 1.819e-86
Identity = 181/505 (35.84%), Postives = 273/505 (54.06%), Query Frame = 2
Query:  761 LDDIDFDEPFE----------------TNPVVSAGFATDT----------------KLEEHKPLWETEEIEDESSNDKYDPFENIDKSSLKLIYWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQ------------AQMTEVYSEVKSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXS-PPFSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEML--------PEKFKAFVSSVPVGDLCTLFNSSAG 2113
             D++DFDEP E                T P+V     T+                 K+EE KP+    E++ +SS  +    E  D   +   YW DA+ D+   PGVVFLFGK   ES +  V+ C+ V  +ER +Y+LP++               M +VY E   I  K  I   ++KPVTK YAF+  D+P +++YL V+Y ++ P LPSDL G TFS +FG NTS LE F+L+ +++GPCWL  +  + S+   S CK+    +    I + K+ S PP  ++S+++KTV N K++ NEIV+I   +H+   LD+APP   FQ +F       +   P   N ++AS  G++ K   L    ER+L+   L K+H +DPD++VGH + G+ L +LLQR     +  W K GRL+R+  +PK+ G S   + E+ AT GRL+CD+E+SA+ELI+C+SY   +L+ ++L        PE  + F   +P   + + F SS G
Sbjct:  238 FDEMDFDEPMEAENLEEEPVKEKAEPETKPIVKVEPKTEPQDKMLISGLVGGMGWEKMEEGKPIETPVEVQVDSS--QLPLVEGPDGDMVFRFYWLDAFEDQYNQPGVVFLFGKVWIESAEAHVSCCVAVKNIERTMYLLPREHKVNLATGEKGVAVGMMDVYKEFNEISEKFKIMKFKSKPVTKNYAFEIPDIPSQSEYLEVKYSAEIPSLPSDLKGTTFSHVFGTNTSSLEHFLLNRKIRGPCWLDVTTPQLSNQPISWCKVEAVAQKSDLISVVKDLSPPPLVVMSISLKTVQNPKTHQNEIVSIAALVHHTFPLDKAPPRPPFQTHFC------ESDTPIKNNFQIASA-GSSLKIRTLF--YERALLGFFLAKMHKIDPDVLVGHDIFGFDLEVLLQRINVCKVPHWSKIGRLRRA-NMPKLGGRSG--FAEKSATCGRLVCDIEISAKELIRCKSYNLTELVSQILKAERPVVPPENIRNFYRLIP--HIYSTFWSSPG 726          

HSP 2 Score: 56.9954 bits (136), Expect = 1.832e-7
Identity = 48/136 (35.29%), Postives = 76/136 (55.88%), Query Frame = 2
Query:   29 MSEDDTYG----RPRRQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQ--LDNFIEGDSEYMESGKEIFDESDEEDIKIGPKRKKSMKNANL-KNPKKACLDFKSIHSDSQKSLF 412
            +   DT G    R RR++  +K+ +   L +LK+AK+ G  +K E+E    IYD V+EE Y K+  +RQ       +  + Y+E G+EIFDE  ++D  +GPK K++ K  +  KN KK+ +       +S KS+F
Sbjct:    2 LDASDTCGIAASRSRREKK-EKVGRKSALEQLKRAKK-GEKVKYEVEEFTSIYDEVDEEQYSKIVRERQDDDWIIDDDGTGYVEDGREIFDEELDDD-ALGPKSKQAAKGGDSKKNVKKSSVS----KPNSIKSMF 130          
BLAST of DNA polymerase vs. Ensembl Zebrafish
Match: pold1 (polymerase (DNA directed), delta 1, catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-060429-1])

HSP 1 Score: 184.882 bits (468), Expect = 1.014e-46
Identity = 187/665 (28.12%), Postives = 306/665 (46.02%), Query Frame = 2
Query: 1700 NSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGR-------LKRSIALPKITGHSNTSWIERMATAGRLLCDV-EVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTI---DRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVK-QLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRY-KGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVA--LRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPI 3649
            + +L    E+ ++      +  +DPDII G+ +  + L  LL R   L +N +   GR       LK S    K  G      I      GR+  D+ +V  R+  K RSY    +    L E+ +    S+ + DL     +    ++L    L ++ + + L+ +L  +   +E+  + G  +   LS G+  +    LL    ++  ++P                   +GG+       Y G  V+EP+KG Y   I  +DF+SLYPSI++ +N+C+TT+    + + L +G  D       DL  KS  +  G+LP  +  L+ AR   K +L    +  K+++L  D RQ ALKI+ANS+YG  G    +    +++  VT  GR+++  TK+++E   ++ +          +IYGDTDSVMV  G+  V +    M  G+   E V+  +   I+L  + V    LL+NKK+YA L   S  +   K+    + KG++ VRRD C L       ++   L+  L   D   ++ +  + ISD + N +I + + +ITK LTR  + Y+  Q   HV++A  +R   AG +       D V Y+I        A  ++  P  VL      E  + ID  YYL  QL   + R+ EPI
Sbjct:  370 SQILCFTQEKLMLQSWAEFMRTVDPDIITGYNIQNFDLPYLLNRAATLKVNMFPYLGRVWGCKSVLKDSSFQSKQMGRRENKTIN---MEGRVQFDLLQVLLRDY-KLRSYTLNAVSFHFLQEQKEDVQHSI-ITDLQN--GNEQTRRRLAVYCLKDAYLPLRLLQKLMCVINYMEMARVTGVPLTYLLSRGQQIKVVSQLLRQAMKQDLVMP---------------VVKTEGGE------DYTGATVIEPEKGYYSVPIATLDFSSLYPSIMMAHNLCYTTLLQKSQIEKLGLGPDDFIKTPTGDLFVKSSVR-KGLLPEILENLLSARKRAKAELKKETDPFKKQVL--DGRQLALKISANSVYGFTGAQVGKLPCLEISQSVTGFGRQMIEQTKQLVE---SRYTLDNGYQADAKVIYGDTDSVMVKLGVATVQE---AMNQGKEAAEWVSSHFVPPIKLEFEKVYYPYLLINKKRYAGLYFSSSAEHHDKM----DCKGIETVRRDNCPLV----ANLINTCLQNILIDRDPDGAVTHAKEVISDLLCN-RIDISQLVITKELTRTAQEYAGKQA--HVELAERMRKRDAGSAPN---LGDRVPYVIIKAAKGVAAYMKSEDPIYVL------ENNIPIDTQYYLEQQLSKPLLRIFEPI 977          
BLAST of DNA polymerase vs. Ensembl Zebrafish
Match: rev3l (REV3 like, DNA directed polymerase zeta catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-050302-55])

HSP 1 Score: 108.612 bits (270), Expect = 5.444e-23
Identity = 149/678 (21.98%), Postives = 275/678 (40.56%), Query Frame = 2
Query: 1706 VLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRL----KRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYI--VPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTT-IDRCKYLSVGDTDQ----AMHILMDLSHK---SVAKPP------------GILPIEIRKLVEARNAVKQLL----NNPNLSKEKLLQHDIRQKALKITANSMYG--CLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVN-RRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLI 3640
            V    +E+ L   + N +   DPDI+VG+ +  +  G LLQR   L +N   +  R+    +++  +P+   +   +  E +   GR++ ++    +      +Y   ++   +L +++  +        L   F++     +++D  +      + L+ +  ++    E+  + G      L+ G   R E ++L       YI   P       Q +   I                    LV+EP+   Y N ++++DF SLYPSI++ YN C++T +   + L   D  +    ++ +  DL ++    +   P            G+LP  + ++++ R  VKQ +    N+  LS  +LL  D RQ  LK+ AN  +G     FS  R    ++   +    RE L    K++ D                ++YGDTDS+ V        Q     KIG  I E V     K I+L  + V    +L  KK+Y      S D+ +       + KG++ VRRD C    ++ +R L ++ E      D++  +  Y++     +   K S+      K   R   +Y      P +++  R+ +    + + R  + V Y+I          Q    P EVL     ++  L ++  YY+  Q+ P + R+ 
Sbjct: 2208 VTYTCDEKELFEEVSNIIRKYDPDILVGYEVQMHSWGYLLQRASTLGVNLCQQLSRVPGDSQQNHFIPEKDEYGAETMTE-IHITGRIILNIWRIMKTEAALNNYTFENVAFHLLHQRYPLYSHRT----LSDWFDTHLHRWKVMDHYVSRVCGTVQLLQQQDIIGRTSELARVFGIQFYHVLTRGSQYRVESMMLRVAKPMNYIPVTPSTQQRAQQRAAQCIP-------------------LVMEPESRFYSNSVIVLDFQSLYPSIVIAYNYCYSTCLGHIENLGTYDEFKFGCASLRVPPDLLYQLRNDITVSPNGVAFVKSSVRRGVLPRMLEEILKTRIMVKQSMKAYRNDKALS--RLL--DARQLGLKLIANVTFGYTSANFS-GRMPCVEVGDSIVHKARETLERAIKMVND---------TKKWGARVVYGDTDSMFVLLKGATKEQ---AFKIGNEIAEAVTATNPKPIKLKFEKVYLPCILQTKKRYVGYMYESVDQENPVF----DAKGIETVRRDGCPGVSKILERSLKLLFES----RDIS-QVKQYVQRQCVKVVEGKASMQDLTFAKEY-RGSGSYRPGACVPALELTRRMMAFDRRL-EPRVGERVPYVIVYGSPGVPLIQLVRRPLEVL-----QDPSLRLNATYYITKQILPPLARIF 2828          
BLAST of DNA polymerase vs. Ensembl Xenopus
Match: POLA1 (polymerase (DNA directed), alpha 1, catalytic subunit [Source:NCBI gene;Acc:100379926])

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 553/1533 (36.07%), Postives = 830/1533 (54.14%), Query Frame = 2
Query:   29 MSEDDTYGRPR-RQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQLDNFIEG--DSEYMESGKEIFDESDEEDI--------KIGPKRKKSMKNANLKNPKKACLDFKSIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNREEIKAPFLSKKKEEFKFDIHQPKVISSSKIKPNEPKEMPQKTVQEPIKFVKKQIVFNKGSSEKNKS---PSTIENNETPE-----------QHKIEDC--IVLDDIDFDEPFETNPVVSAGFATDT----------------KLEEHKPLWETEEIEDESSNDKYDPFEN------IDKSSLKLI-----------YWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQ-------------AQMTEVYSEV-KSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPP-FSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKA-------AALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPED-LAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKY---HHANQHNEADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSID-----FKMELEKPWLCGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFA--CPRCESGIMKPLLSSSLLNRQLGYYRFL----------LTGKENLSYKQKELLQMCSKY------VERVLERSDYMNVDFKSLMAKFS 4291
            MSE  ++   R R+  ++K  + + L +LK+AK  G  +K E+E +  IY+ V+EE Y K+   RQ D++I     + Y+E G+EIFD+  E++         K  PK K ++K +++  P      F  + S  +++    +  S          +L      ++ P       P ++ KK++       P       + P  PK +P   V++P    K   + +   S  + S   P  I+N    +           Q K ED   +  DD DFDEP E + + S    + T                K+EE    + T    +ES  D+ D  E+      +D S L L+           YW DAY D+   PGVV+LFGK   E+ + +V+ C+ V  +ER +Y+LP++                M  VY E  +S+  K+ I   ++K V K YAF+  DVP  ++YL V+Y +  P+LP DL G+TFS +FG NTS LE+F+L  ++KGP WL     + SS   S CK+   +     + + K+ +PP   +LSL++KTV N K++ NEIVA+   +H++   D+APP   FQ +F +L+ P D + PYD  + +  +  AN    + I   ER+L+   L K+H +DPDIIVGH + G+ L +LLQR  +  +  W K GRL+RS+ +PK+ G S   + ER A  GR++CD E+SA+ELI+C+SY   +L+ ++L    K     +P  ++   ++ SA +  +++ T  ++   + +M EL VLPLAL+IT I GN++ RTL GG+SERNEYLLLHAF E  +IVPDK          +  +  ++ DQ+  + G+   +K  YAGGLVLEPK G Y+ FILL+DFNSLYPSII EYNICFTT+ R    S    DQ    + +L H  +    GILP EIRKLVE R  VKQL+  P+L+ +  LQ+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT  GREIL++TK++++        K+N    L++IYGDTDS+M+NT   N+   + V K+G  +K EVN+ YK ++++IDG+ + +LLL KKKYA+L V       GK + KQELKGLDIVRRDWC+L+ E G  +++ IL ++  P D +  +I   L  I +++ N  + + ++ I KALT++P++Y + +  PHV VA+ INS GG  ++ +A DT+ Y+IC DG++ +A+QRAY+P+++      ++  LSID  YYL+ Q+HPVV R+ EPID ID++ +A  LGLDPS++    H  Q  E D          +  ++ DC+    +C KC  +   D       +++E P L      E   S  D  + V  KL   I R I  YYS    C+           C    R++ ++  +    C  C    ++       L  QL +YRF+          ++ +E    K+K   +  + Y      V++VL +S Y  V+   L    S
Sbjct:    1 MSESGSFAASRSRREKTEKSGRKEALERLKRAKA-GEKVKYEVEEISSIYEEVDEEQYSKIVRDRQDDDWIVDDDGTGYVEDGREIFDDDLEDNALADSGKRAKGAPKDKSNVKKSSVSKPNNIKSMF--MASAVKRTTDKTVDLSKDDLLGDLLQDLKSQALPITPP-------PVITLKKKKLAGSPLNP-----FSVPPAAPKVLP---VKKPPALAKLGHLSSAAPSNNSASSFVPREIKNEPNSDLISSAPLNVKTQVKEEDTSMVEFDDGDFDEPMEEDNLESPSVVSSTIKKEEPKIKCVKEDSVKMEESS--FMTSAALNESCWDQIDEVESMTTEVQVDSSRLPLVTGADGSQVFKFYWLDAYEDQYSQPGVVYLFGKVWIETAEAYVSCCVSVKNIERTVYLLPRENRVQLSTGKDTGVPVSMMNVYQEFNESVAEKYKIMKFKSKKVEKDYAFEIPDVPASSEYLEVRYSADSPQLPQDLKGETFSHVFGTNTSSLELFLLSRKIKGPSWLEIKSPQLSSQPMSWCKVEAVVMRPDQVNVVKDLAPPPVVVLSLSMKTVQNAKTHQNEIVAMAALVHHKFPFDKAPPQPPFQTHFCVLSKPNDCIFPYDFKEAVKRK-NAN----IEIALTERTLLGFFLAKIHKIDPDIIVGHDIYGFDLEVLLQRISSCKVPFWSKIGRLRRSV-MPKLGGRSG--FAERNAACGRIICDTEISAKELIRCKSYHLSELVHQIL----KTERVLMPPENIRNAYSDSAHLLYMLENTWTDAKFILQIMCELNVLPLALQITNIAGNVLSRTLMGGRSERNEYLLLHAFTENNFIVPDKPVFKKIQQTTVEDDDNMDTDQNKNKKGR---KKAAYAGGLVLEPKVGFYDKFILLLDFNSLYPSIIQEYNICFTTVQREAPTSQKGEDQEE--IPELPHSDLEM--GILPREIRKLVERRRHVKQLMKQPDLNPDLYLQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTHQGREILLHTKEMVQ--------KMN----LEVIYGDTDSIMINTNCNNL---EEVFKLGNRVKSEVNKSYKLLEIDIDGIFKSLLLLKKKKYAALTV--EPTGDGKYVTKQELKGLDIVRRDWCELAKEAGNYVISQILSDQ--PRDNIVENIQKKLTEIGENVTNGTVPISQYEINKALTKDPQDYPDKKSLPHVHVAMWINSQGG--RKVKAGDTISYVICQDGSNLSASQRAYAPEQL-----QKQENLSIDTQYYLSQQVHPVVARICEPIDGIDSALIAMWLGLDPSQFRAHRHHQQDEENDALLGGPSQLTDEEKYRDCERFKFFCPKCGTENIYDNVFDGSGLQIE-PGLKRCSKPECDASPLDYVIQVQNKLLLDIRRYIKKYYSGWLVCE--------EKTCQNRTRRVPLSFSRNGPICQACTKATLRSEYPEKALYTQLCFYRFIFDWDYALEKVVSEQERGHLKKKHFQESENLYKKLKSTVDQVLSQSGYSEVNLSKLFQTLS 1459          
BLAST of DNA polymerase vs. Ensembl Xenopus
Match: POLA1 (polymerase (DNA directed), alpha 1, catalytic subunit [Source:NCBI gene;Acc:100379926])

HSP 1 Score: 811.601 bits (2095), Expect = 0.000e+0
Identity = 538/1484 (36.25%), Postives = 814/1484 (54.85%), Query Frame = 2
Query:   50 GRPRRQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQLDNFIEGDSEYMESGKEIFDESDEEDIKIGPKRKKSMKNANLKNPKKACLDFKSIH-SDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNREEIKAPFLSKKKEEFKFDIHQPKVISSSKIKPNEPKEMPQKTVQEPIKFVKKQ----IVFNKGSSEKNKSPSTIENNETPEQHKIEDCIVLDDIDFDEPFETNPVVSAGFATDTKLEEHKPLWETEEIEDESSNDKYDPFEN------IDKSSLKLI-----------YWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQ----------AQMTEVYSEV-KSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPP-FSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAA--ALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDR----CKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPED-LAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKY---HHANQHNEADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSID-----FKMELEKPWLCGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFA--CPRCESGIMKPLLSSSLLNRQLGYYRFL----------LTGKENLSYKQKELLQMCSKY------VERVLERSDYMNVDFKSLMAKFS 4291
             R RR++ ++K  + + L +LK+AK  G  +K E+E +  IY+ V+EE Y K+   RQ D++I  D   + +GK           K  PK K ++K +++  P     + KS+  + + K     LP                      TP       P ++ KK++       P       + P  PK          ++F  ++    ++FNK S+   +  S +E                DD DFDEP E + + S    + T +++ +P  +T    +ES  D+ D  E+      +D S L L+           YW DAY D+   PGVV+LFGK   E+ + +V+ C+ V  +ER +Y+LP++             M  VY E  +S+  K+ I   ++K V K YAF+  DVP  ++YL V+Y +  P+LP DL G+TFS +FG NTS LE+F+L  ++KGP WL     + SS   S CK+   +     + + K+ +PP   +LSL++KTV N K++ NEIVA+   +H++   D+APP   FQ +F +L+ P D + PYD  + +  +  AN    + I   ER+L+   L K+H +DPDIIVGH + G+ L +LLQR  +  +  W K GRL+RS+ +PK+ G S   + ER A  GR++CD E+SA+ELI+C+SY   +L+ ++L    K     +P  ++   ++ SA +  +++ T  ++   + +M EL VLPLAL+IT I GN++ RTL GG+SERNEYLLLHAF E  +IVPDK     + Q +  +   +++   K  ++K  YAGGLVLEPK G Y+ FILL+DFNSLYPSII EYNICFTT+ R     + +S+G+  + +    +L H  +    GILP EIRKLVE R  VKQL+  P+L+ +  LQ+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT  GREIL++TK++++        K+N    L++IYGDTDS+M+NT   N+   + V K+G  +K EVN+ YK ++++IDG+ + +LLL KKKYA+L V       GK + KQELKGLDIVRRDWC+L+ E G  +++ IL ++  P D +  +I   L  I +++ N  + + ++ I KALT++P++Y + +  PHV VA+ INS GG  ++ +A DT+ Y+IC DG++ +A+QRAY+P+++      ++  LSID  YYL+ Q+HPVV R+ EPID ID++ +A  LGLDPS++    H  Q  E D          +  ++ DC+    +C KC  +   D       +++E P L      E   S  D  + V  KL   I R I  YYS    C+           C    R++ ++  +    C  C    ++       L  QL +YRF+          ++ +E    K+K   +  + Y      V++VL +S Y  V+   L    S
Sbjct:   15 SRSRREK-TEKSGRKEALERLKRAKA-GEKVKYEVEEISSIYEEVDEEQYSKIVRDRQDDDWIVDDVLLL-TGKRA---------KGAPKDKSNVKKSSVSKPN----NIKSMFMASAVKRTTDALPI---------------------TP------PPVITLKKKKLAGSPLNP-----FSVPPAAPK----------VRFCSRKLFGFVIFNK-SALLEEDTSMVE---------------FDDGDFDEPMEEDNLESPSVVSST-IKKEEPKIKTSAALNESCWDQIDEVESMTTEVQVDSSRLPLVTGADGSQVFKFYWLDAYEDQYSQPGVVYLFGKVWIETAEAYVSCCVSVKNIERTVYLLPRENLSTGKDTGVPVSMMNVYQEFNESVAEKYKIMKFKSKKVEKDYAFEIPDVPASSEYLEVRYSADSPQLPQDLKGETFSHVFGTNTSSLELFLLSRKIKGPSWLEIKSPQLSSQPMSWCKVEAVVMRPDQVNVVKDLAPPPVVVLSLSMKTVQNAKTHQNEIVAMAALVHHKFPFDKAPPQPPFQTHFCVLSKPNDCIFPYDFKEAVKRK-NAN----IEIALTERTLLGFFLAKIHKIDPDIIVGHDIYGFDLEVLLQRISSCKVPFWSKIGRLRRSV-MPKLGGRSG--FAERNAACGRIICDTEISAKELIRCKSYHLSELVHQIL----KTERVLMPPENIRNAYSDSAHLLYMLENTWTDAKFILQIMCELNVLPLALQITNIAGNVLSRTLMGGRSERNEYLLLHAFTENNFIVPDKPVFKKIQQTTDDDNMDTDQNKNKKGRKKAAYAGGLVLEPKVGFYDKFILLLDFNSLYPSIIQEYNICFTTVQREAPTSQKVSLGEDQEEIP---ELPHSDLEM--GILPREIRKLVERRRHVKQLMKQPDLNPDLYLQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTHQGREILLHTKEMVQ--------KMN----LEVIYGDTDSIMINTNCNNL---EEVFKLGNRVKSEVNKSYKLLEIDIDGIFKSLLLLKKKKYAALTV--EPTGDGKYVTKQELKGLDIVRRDWCELAKEAGNYVISQILSDQ--PRDNIVENIQKKLTEIGENVTNGTVPISQYEINKALTKDPQDYPDKKSLPHVHVAMWINSQGG--RKVKAGDTISYVICQDGSNLSASQRAYAPEQL-----QKQENLSIDTQYYLSQQVHPVVARICEPIDGIDSALIAMWLGLDPSQFRAHRHHQQDEENDALLGGPSQLTDEEKYRDCERFKFFCPKCGTENIYDNVFDGSGLQIE-PGLKRCSKPECDASPLDYVIQVQNKLLLDIRRYIKKYYSGWLVCE--------EKTCQNRTRRVPLSFSRNGPICQACTKATLRSEYPEKALYTQLCFYRFIFDWDYALEKVVSEQERGHLKKKHFQESENLYKKLKSTVDQVLSQSGYSEVNLSKLFQTLS 1371          
BLAST of DNA polymerase vs. Ensembl Xenopus
Match: POLA1 (polymerase (DNA directed), alpha 1, catalytic subunit [Source:NCBI gene;Acc:100379926])

HSP 1 Score: 795.423 bits (2053), Expect = 0.000e+0
Identity = 480/1231 (38.99%), Postives = 707/1231 (57.43%), Query Frame = 2
Query:  755 IVLDDIDFDEPFETNPVVSAGFATDT----------------KLEEHKPLW-ETEEIEDESSNDKYDPFENIDKSSLKLIYWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQ-------------AQMTEVYSEV-KSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPP-FSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAA--ALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPED-LAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKY---HHANQHNEADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSID-----FKMELEKPWLCGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFA--CPRCESGIMKPLLSSSLLNRQLGYYRFLLTGKENLS----YKQKE-LLQMCSKYVERVLERSDYMNVDFKSLMAKFS 4291
            +  DD DFDEP E + + S    + T                K+EE   ++ E+   E +  + +       D S +   YW DAY D+   PGVV+LFGK   E+ + +V+ C+ V  +ER +Y+LP++                M  VY E  +S+  K+ I   ++K V K YAF+  DVP  ++YL V+Y +  P+LP DL G+TFS +FG NTS LE+F+L  ++KGP WL     + SS   S CK+   +     + + K+ +PP   +LSL++KTV N K++ NEIVA+   +H++   D+APP   FQ +F +L+ P D + PYD  + +  +  AN    + I   ER+L+   L K+H +DPDIIVGH + G+ L +LLQR  +  +  W K GRL+RS+ +PK+ G S   + ER A  GR++CD E+SA+ELI+C+SY   +L+ ++L    K     +P  ++   ++ SA +  +++ T  ++   + +M EL VLPLAL+IT I GN++ RTL GG+SERNEYLLLHAF E  +IVPDK     + Q +  +   +++   K  ++K  YAGGLVLEPK G Y+ FILL+DFNSLYPSII EYNICFTT+ R    S    DQ    + +L H  +    GILP EIRKLVE R  VKQL+  P+L+ +  LQ+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT  GREIL++TK++++        K+N    L++IYGDTDS+M+NT   N+   + V K+G  +K EVN+ YK ++++IDG+ + +LLL KKKYA+L V       GK + KQELKGLDIVRRDWC+L+ E G  +++ IL ++  P D +  +I   L  I +++ N  + + ++ I KALT++P++Y + +  PHV VA+ INS GG  ++ +A DT+ Y+IC DG++ +A+QRAY+P+++      ++  LSID  YYL+ Q+HPVV R+ EPID ID++ +A  LGLDPS++    H  Q  E D          +  ++ DC+    +C KC  +   D       +++E P L      E   S  D  + V  KL   I R I  YYS    C+           C    R++ ++  +    C  C    ++       L  QL +YRF+      L     +++ E L +     V++VL +S Y  V+   L    S
Sbjct:  190 VEFDDGDFDEPMEEDNLESPSVVSSTIKKEEPKIKCVKEDSVKMEESSFMYVESMTTEVQVDSSRLPLVTGADGSQVFKFYWLDAYEDQYSQPGVVYLFGKVWIETAEAYVSCCVSVKNIERTVYLLPRENRVQLSTGKDTGVPVSMMNVYQEFNESVAEKYKIMKFKSKKVEKDYAFEIPDVPASSEYLEVRYSADSPQLPQDLKGETFSHVFGTNTSSLELFLLSRKIKGPSWLEIKSPQLSSQPMSWCKVEAVVMRPDQVNVVKDLAPPPVVVLSLSMKTVQNAKTHQNEIVAMAALVHHKFPFDKAPPQPPFQTHFCVLSKPNDCIFPYDFKEAVKRK-NAN----IEIALTERTLLGFFLAKIHKIDPDIIVGHDIYGFDLEVLLQRISSCKVPFWSKIGRLRRSV-MPKLGGRSG--FAERNAACGRIICDTEISAKELIRCKSYHLSELVHQIL----KTERVLMPPENIRNAYSDSAHLLYMLENTWTDAKFILQIMCELNVLPLALQITNIAGNVLSRTLMGGRSERNEYLLLHAFTENNFIVPDKPVFKKIQQTTDDDNMDTDQNKNKKGRKKAAYAGGLVLEPKVGFYDKFILLLDFNSLYPSIIQEYNICFTTVQREAPTSQKGEDQEE--IPELPHSDLEM--GILPREIRKLVERRRHVKQLMKQPDLNPDLYLQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTHQGREILLHTKEMVQ--------KMN----LEVIYGDTDSIMINTNCNNL---EEVFKLGNRVKSEVNKSYKLLEIDIDGIFKSLLLLKKKKYAALTV--EPTGDGKYVTKQELKGLDIVRRDWCELAKEAGNYVISQILSDQ--PRDNIVENIQKKLTEIGENVTNGTVPISQYEINKALTKDPQDYPDKKSLPHVHVAMWINSQGG--RKVKAGDTISYVICQDGSNLSASQRAYAPEQL-----QKQENLSIDTQYYLSQQVHPVVARICEPIDGIDSALIAMWLGLDPSQFRAHRHHQQDEENDALLGGPSQLTDEEKYRDCERFKFFCPKCGTENIYDNVFDGSGLQIE-PGLKRCSKPECDASPLDYVIQVQNKLLLDIRRYIKKYYSGWLVCE--------EKTCQNRTRRVPLSFSRNGPICQACTKATLRSEYPEKALYTQLCFYRFIFDWDYALEKVKHFQESENLYKKLKSTVDQVLSQSGYSEVNLSKLFQTLS 1369          
BLAST of DNA polymerase vs. Ensembl Xenopus
Match: POLA1 (polymerase (DNA directed), alpha 1, catalytic subunit [Source:NCBI gene;Acc:100379926])

HSP 1 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 486/1254 (38.76%), Postives = 711/1254 (56.70%), Query Frame = 2
Query:  755 IVLDDIDFDEPFETNPVVSAGFATDT----------------KLEEHKPLWETEEIEDESSNDKYDPFEN------IDKSSLKLI-----------YWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQ----------AQMTEVYSEV-KSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPP-FSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAA--ALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPED-LAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKY---HHANQHNEADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSID-----FKMELEKPWLCGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFA--CPRCESGIMKPLLSSSLLNRQLGYYRFLLTG---------------KENLSYKQKELLQMCSKYVERVLERSDYMNVDFKSLMAKFS 4291
            +  DD DFDEP E + + S    + T                K+EE    + T    +ES  D+ D  E+      +D S L L+           YW DAY D+   PGVV+LFGK   E+ + +V+ C+ V  +ER +Y+LP++             M  VY E  +S+  K+ I   ++K V K YAF+  DVP  ++YL V+Y +  P+LP DL G+TFS +FG NTS LE+F+L  ++KGP WL     + SS   S CK+   +     + + K+ +PP   +LSL++KTV N K++ NEIVA+   +H++   D+APP   FQ +F +L+ P D + PYD  + +  +  AN    + I   ER+L+   L K+H +DPDIIVGH + G+ L +LLQR  +  +  W K GRL+RS+ +PK+ G S   + ER A  GR++CD E+SA+ELI+C+SY   +L+ ++L    K     +P  ++   ++ SA +  +++ T  ++   + +M EL VLPLAL+IT I GN++ RTL GG+SERNEYLLLHAF E  +IVPDK     + Q +  +   +++   K  ++K  YAGGLVLEPK G Y+ FILL+DFNSLYPSII EYNICFTT+ R    S    DQ    + +L H  +    GILP EIRKLVE R  VKQL+  P+L+ +  LQ+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT  GREIL++TK++++        K+N    L++IYGDTDS+M+NT   N+   + V K+G  +K EVN+ YK ++++IDG+ + +LLL KKKYA+L V       GK + KQELKGLDIVRRDWC+L+ E G  +++ IL ++  P D +  +I   L  I +++ N  + + ++ I KALT++P++Y + +  PHV VA+ INS GG  ++ +A DT+ Y+IC DG++ +A+QRAY+P+++      ++  LSID  YYL+ Q+HPVV R+ EPID ID++ +A  LGLDPS++    H  Q  E D          +  ++ DC+    +C KC  +   D       +++E P L      E   S  D  + V  KL   I R I  YYS    C+           C    R++ ++  +    C  C    ++       L  QL +YRF+                  K   + ++K  L      V++VL +S Y  V+   L    S
Sbjct:  196 VEFDDGDFDEPMEEDNLESPSVVSSTIKKEEPKIKCVKEDSVKMEESS--FMTSAALNESCWDQIDEVESMTTEVQVDSSRLPLVTGADGSQVFKFYWLDAYEDQYSQPGVVYLFGKVWIETAEAYVSCCVSVKNIERTVYLLPRENLSTGKDTGVPVSMMNVYQEFNESVAEKYKIMKFKSKVVEKDYAFEIPDVPASSEYLEVRYSADSPQLPQDLKGETFSHVFGTNTSSLELFLLSRKIKGPSWLEIKSPQLSSQPMSWCKVEAVVMRPDQVNVVKDLAPPPVVVLSLSMKTVQNAKTHQNEIVAMAALVHHKFPFDKAPPQPPFQTHFCVLSKPNDCIFPYDFKEAVKRK-NAN----IEIALTERTLLGFFLAKIHKIDPDIIVGHDIYGFDLEVLLQRISSCKVPFWSKIGRLRRSV-MPKLGGRSG--FAERNAACGRIICDTEISAKELIRCKSYHLSELVHQIL----KTERVLMPPENIRNAYSDSAHLLYMLENTWTDAKFILQIMCELNVLPLALQITNIAGNVLSRTLMGGRSERNEYLLLHAFTENNFIVPDKPVFKKIQQTTDDDNMDTDQNKNKKGRKKAAYAGGLVLEPKVGFYDKFILLLDFNSLYPSIIQEYNICFTTVQREAPTSQKGEDQEE--IPELPHSDLEM--GILPREIRKLVERRRHVKQLMKQPDLNPDLYLQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTHQGREILLHTKEMVQ--------KMN----LEVIYGDTDSIMINTNCNNL---EEVFKLGNRVKSEVNKSYKLLEIDIDGIFKSLLLLKKKKYAALTV--EPTGDGKYVTKQELKGLDIVRRDWCELAKEAGNYVISQILSDQ--PRDNIVENIQKKLTEIGENVTNGTVPISQYEINKALTKDPQDYPDKKSLPHVHVAMWINSQGG--RKVKAGDTISYVICQDGSNLSASQRAYAPEQL-----QKQENLSIDTQYYLSQQVHPVVARICEPIDGIDSALIAMWLGLDPSQFRAHRHHQQDEENDALLGGPSQLTDEEKYRDCERFKFFCPKCGTENIYDNVFDGSGLQIE-PGLKRCSKPECDASPLDYVIQVQNKLLLDIRRYIKKYYSGWLVCE--------EKTCQNRTRRVPLSFSRNGPICQACTKATLRSEYPEKALYTQLCFYRFIFDWDYALEKVVSEQEREKKHFFTKRKKIFLFKLKSTVDQVLSQSGYSEVNLSKLFQTLS 1396          

HSP 2 Score: 51.9878 bits (123), Expect = 9.016e-6
Identity = 38/126 (30.16%), Postives = 68/126 (53.97%), Query Frame = 2
Query:   14 IY*FEMSEDDTYGRPR-RQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQ--LDNFIEGDSEYMESGKEIFDESDEED--------IKIGPKRKKSMKNANLKNP 355
            ++  +MSE  ++   R R+  ++K  + + L +LK+AK  G  +K E+E +  IY+ V+EE Y K+   RQ       +  + Y+E G+EIFD+  E++         K  PK K ++K +++  P
Sbjct:   17 VFTLDMSESGSFAASRSRREKTEKSGRKEALERLKRAKA-GEKVKYEVEEISSIYEEVDEEQYSKIVRDRQDDDWIVDDDGTGYVEDGREIFDDDLEDNALADSGKRAKGAPKDKSNVKKSSVSKP 141          
BLAST of DNA polymerase vs. Ensembl Xenopus
Match: POLA1 (polymerase (DNA directed), alpha 1, catalytic subunit [Source:NCBI gene;Acc:100379926])

HSP 1 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 486/1254 (38.76%), Postives = 711/1254 (56.70%), Query Frame = 2
Query:  755 IVLDDIDFDEPFETNPVVSAGFATDT----------------KLEEHKPLWETEEIEDESSNDKYDPFEN------IDKSSLKLI-----------YWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQ----------AQMTEVYSEV-KSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPP-FSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAA--ALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPED-LAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKY---HHANQHNEADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSID-----FKMELEKPWLCGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFA--CPRCESGIMKPLLSSSLLNRQLGYYRFLLTG---------------KENLSYKQKELLQMCSKYVERVLERSDYMNVDFKSLMAKFS 4291
            +  DD DFDEP E + + S    + T                K+EE    + T    +ES  D+ D  E+      +D S L L+           YW DAY D+   PGVV+LFGK   E+ + +V+ C+ V  +ER +Y+LP++             M  VY E  +S+  K+ I   ++K V K YAF+  DVP  ++YL V+Y +  P+LP DL G+TFS +FG NTS LE+F+L  ++KGP WL     + SS   S CK+   +     + + K+ +PP   +LSL++KTV N K++ NEIVA+   +H++   D+APP   FQ +F +L+ P D + PYD  + +  +  AN    + I   ER+L+   L K+H +DPDIIVGH + G+ L +LLQR  +  +  W K GRL+RS+ +PK+ G S   + ER A  GR++CD E+SA+ELI+C+SY   +L+ ++L    K     +P  ++   ++ SA +  +++ T  ++   + +M EL VLPLAL+IT I GN++ RTL GG+SERNEYLLLHAF E  +IVPDK     + Q +  +   +++   K  ++K  YAGGLVLEPK G Y+ FILL+DFNSLYPSII EYNICFTT+ R    S    DQ    + +L H  +    GILP EIRKLVE R  VKQL+  P+L+ +  LQ+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT  GREIL++TK++++        K+N    L++IYGDTDS+M+NT   N+   + V K+G  +K EVN+ YK ++++IDG+ + +LLL KKKYA+L V       GK + KQELKGLDIVRRDWC+L+ E G  +++ IL ++  P D +  +I   L  I +++ N  + + ++ I KALT++P++Y + +  PHV VA+ INS GG  ++ +A DT+ Y+IC DG++ +A+QRAY+P+++      ++  LSID  YYL+ Q+HPVV R+ EPID ID++ +A  LGLDPS++    H  Q  E D          +  ++ DC+    +C KC  +   D       +++E P L      E   S  D  + V  KL   I R I  YYS    C+           C    R++ ++  +    C  C    ++       L  QL +YRF+                  K   + ++K  L      V++VL +S Y  V+   L    S
Sbjct:  184 VEFDDGDFDEPMEEDNLESPSVVSSTIKKEEPKIKCVKEDSVKMEESS--FMTSAALNESCWDQIDEVESMTTEVQVDSSRLPLVTGADGSQVFKFYWLDAYEDQYSQPGVVYLFGKVWIETAEAYVSCCVSVKNIERTVYLLPRENLSTGKDTGVPVSMMNVYQEFNESVAEKYKIMKFKSKVVEKDYAFEIPDVPASSEYLEVRYSADSPQLPQDLKGETFSHVFGTNTSSLELFLLSRKIKGPSWLEIKSPQLSSQPMSWCKVEAVVMRPDQVNVVKDLAPPPVVVLSLSMKTVQNAKTHQNEIVAMAALVHHKFPFDKAPPQPPFQTHFCVLSKPNDCIFPYDFKEAVKRK-NAN----IEIALTERTLLGFFLAKIHKIDPDIIVGHDIYGFDLEVLLQRISSCKVPFWSKIGRLRRSV-MPKLGGRSG--FAERNAACGRIICDTEISAKELIRCKSYHLSELVHQIL----KTERVLMPPENIRNAYSDSAHLLYMLENTWTDAKFILQIMCELNVLPLALQITNIAGNVLSRTLMGGRSERNEYLLLHAFTENNFIVPDKPVFKKIQQTTDDDNMDTDQNKNKKGRKKAAYAGGLVLEPKVGFYDKFILLLDFNSLYPSIIQEYNICFTTVQREAPTSQKGEDQEE--IPELPHSDLEM--GILPREIRKLVERRRHVKQLMKQPDLNPDLYLQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTHQGREILLHTKEMVQ--------KMN----LEVIYGDTDSIMINTNCNNL---EEVFKLGNRVKSEVNKSYKLLEIDIDGIFKSLLLLKKKKYAALTV--EPTGDGKYVTKQELKGLDIVRRDWCELAKEAGNYVISQILSDQ--PRDNIVENIQKKLTEIGENVTNGTVPISQYEINKALTKDPQDYPDKKSLPHVHVAMWINSQGG--RKVKAGDTISYVICQDGSNLSASQRAYAPEQL-----QKQENLSIDTQYYLSQQVHPVVARICEPIDGIDSALIAMWLGLDPSQFRAHRHHQQDEENDALLGGPSQLTDEEKYRDCERFKFFCPKCGTENIYDNVFDGSGLQIE-PGLKRCSKPECDASPLDYVIQVQNKLLLDIRRYIKKYYSGWLVCE--------EKTCQNRTRRVPLSFSRNGPICQACTKATLRSEYPEKALYTQLCFYRFIFDWDYALEKVVSEQEREKKHFFTKRKKIFLFKLKSTVDQVLSQSGYSEVNLSKLFQTLS 1384          
BLAST of DNA polymerase vs. Ensembl Mouse
Match: Pola1 (polymerase (DNA directed), alpha 1 [Source:MGI Symbol;Acc:MGI:99660])

HSP 1 Score: 791.956 bits (2044), Expect = 0.000e+0
Identity = 551/1514 (36.39%), Postives = 809/1514 (53.43%), Query Frame = 2
Query:   53 RPRRQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQLDNFIEGDSE--YMESGKEIFDESDE----------EDIKIGPKRKKSMKNANLKNPKKACLDFKSIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNREEIKAPFLSKKKEEFK------FDIHQPKVISSSKIKPNEPKEMPQKTVQEPIKFVKKQIVFNKGSSEKNKSPSTIENNETPEQHKIEDCIVLDDIDFDEPFETNPVVSAGFATDTKLEEHKPLWETEEIEDE--------------------SSNDKYDPFE-NIDKSSLKLI-----------YWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQ-------------AQMTEVYSEVKS-ILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPP-FSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQL-----EIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPP------GILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKY--HHANQHNEADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSIDFKMELE----KPWLCGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFACPRCESGIMKPLLSSSLLNRQLGYYRFLLTGK---ENLSYKQKELL-------------QMCSKYVERVLERSDYMNVDFKSLMAKFS 4291
            R RR++ SKK  + + L +LKKAK  G   K E+E +  +Y+ V+EE Y KL + RQ D++I  D    Y+E G+EIFD+  E           D K   K +K +K  ++  P      F  I S  +K+    +  S          +L+   A+++ P       P L  KK+         F +H PK I S K  P  P  +  + +  PI   + ++               +   E PE  +    +  +D DFDE  +T  V        T  +E +P+   E   D                       +D+  P E  +D S+L L+           YW DAY D    PGVVFLFGK   ES K  V+ C+ V  +ER +Y LP++                M +VY E  S I AK+ I   ++K V K YAF+  DVP++++YL V+Y ++ P+LP +L G+TFS +FG NTS LE+F+++ ++KGPCWL     +  +   S CK          + + K+ SPP   ++S ++KT+ N +++ +EI+A+   +H+   LD+APP   FQ +F +++ PKD + P D  + ++ +   N K  V I A ER+LI   L K+H +DPDI+VGH +  ++L +LLQR     +  W K GRL+RS  +PK+   S + + ER AT GR++CDVE+SA+ELI C+SY   +L+Q++L  K +  V  +P  ++  +++ S+ +  L++    ++   + +M EL VLPLAL+IT I GN++ RTL GG+SERNE+LLLHAF E  YIVPDK        +L     EID    +  K  ++K TYAGGLVL+PK G Y+ FILL+DFNSLYPSII E+NICFTT+ R        T +      D   + + + P      GILP EIRKLVE R  VKQL+   +L+ + +LQ+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT+ GREIL++TK +++        K+N    L++IYGDTDS+M+NT   N+   + V K+G  +K EVN+ YK ++++ID V + +LLL KKKYA+L  V    S G  I KQELKGLDIVRRDWC L+ + G  ++  IL ++ S + +  +I   L  I +++ N  + + +F I KALT++P++Y + +  PHV VAL INS GG  ++ +A DTV Y+IC DG++ TATQRAY+P+++          L+ID  YYLA Q+HPVV R+ EPID IDA  +A  LGLD +++  H  ++  E D          +  ++ DC+     C  C  +   D   E      +P L    NV+   S     V ++ KL   I R I  YY     C+    C  +  +       L  +     CP C   +++P  S   L  QL +YR++       E L+  +K+ L             +      E+ L  S Y  V+   L A ++
Sbjct:   26 RARREKKSKK-GRQEALERLKKAKA-GEKYKYEVEDLTSVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDTCGKGSDGKAHRKDRKDVKKPSVTKPNNIKAMF--IASAGKKTTDKAVDLSKDDLLGDILQDLNTETAQITPP-------PVLIPKKKRSTGALLNPFSVHTPKAIPSGK--PASPV-LRNEPLLTPIPLKRAELA------------GELAQPECPEDEQELGVMEFEDGDFDESMDTEKVDEKPVTAKTWDQETEPVERVEHEADPERGTTSYLENFLPDVSCWDIDQDDESIPQEVQVDSSNLPLVKGADDEQVFQFYWLDAYEDPYNQPGVVFLFGKVWIESVKTHVSCCVMVKNIERTLYFLPREMKFDLNTGKETAIPVTMKDVYEEFDSKISAKYKIMKFKSKIVEKNYAFEIPDVPEKSEYLEVRYSAEVPQLPQNLKGETFSHVFGTNTSSLELFLMNRKIKGPCWLEVKNPQLLNQPISWCKFEVMALKPDLVNVIKDVSPPPLVVMSFSMKTMQNVQNHQHEIIAMAALVHHSFALDKAPPEPPFQTHFCVVSKPKDCIFPCDFKEVISKK---NMK--VEIAATERTLIGFFLAKVHKIDPDILVGHNICSFELEVLLQRINECKVPYWSKIGRLRRS-NMPKLG--SRSGFGERNATCGRMICDVEISAKELIHCKSYHLSELVQQIL--KTERIV--IPTENIRNMYSESSYLLYLLEHIWKDARFILQIMCELNVLPLALQITNIAGNIMSRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKK-GRKKATYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRV-------TSEVQKATEDEEQEQIPELPDPNLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLVLQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTYKGREILMHTKDMVQ--------KMN----LEVIYGDTDSIMINTNSTNL---EEVFKLGNKVKSEVNKLYKLLEIDIDAVFKSLLLLKKKKYAAL--VVEPTSDGNYITKQELKGLDIVRRDWCDLAKDTGNFVIGQILSDQ-SRDTIVENIQKRLIEIGENVLNGSVPVSQFEINKALTKDPQDYPDRKSLPHVHVALWINSQGG--RKVKAGDTVSYVICQDGSNLTATQRAYAPEQLQKLDN-----LAIDTQYYLAQQIHPVVARICEPIDGIDAVLIALWLGLDSTQFRVHQYHKDEENDALLGGPAQLTDEEKYKDCEKFKCLCPSCGTENIYDNVFEGSGLDMEPSLYRCSNVDCKVSPLTFMVQLSNKLIMDIRRCIKKYYDGWLICEEPTCCSRLRRL------PLHFSRNGPLCPVCMKAVLRPEYSDKSLYTQLCFYRYIFDADCALEKLTEHEKDKLKKQFFPLRVLQDYRKVKNIAEQFLSWSGYSEVNLSKLFANYA 1462          
BLAST of DNA polymerase vs. Ensembl Mouse
Match: Pold1 (polymerase (DNA directed), delta 1, catalytic subunit [Source:MGI Symbol;Acc:MGI:97741])

HSP 1 Score: 176.792 bits (447), Expect = 3.271e-44
Identity = 181/657 (27.55%), Postives = 306/657 (46.58%), Query Frame = 2
Query: 1721 NERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGR-------LKRSIALPKITGHSNTSWIERMATAGRLLCDV-EVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDR---CKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVK-QLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKG-IQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAG-GSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPI 3649
             E  L+    + +  +DPD+I G+ +  + L  L+ R QAL ++ +   GR       ++ S    +  G  ++  I   +  GR+  D+ +V  RE  K RSY    +    L E+ +    S+ + DL     +    ++L    L ++ + + L+  L VL   +E+  + G  +   L+ G+  +    LL     +  ++P           ++ + S +           Y G  V+EP KG Y+  I  +DF+SLYPSI++ +N+C+TT+ R    + L +   +       D   KS  +  G+LP  +  L+ AR   K +L    +  + ++L  D RQ ALK++ANS+YG  G    +    +++  VT  GR+++  TK+++E   +K + +   +    ++YGDTDSVM   G+ +V +    M +G+     V+  +   I+L  + V    LL++KK+YA L   SR  +  K+    + KGL+ VRRD C L       ++T  L   L   D   ++ +    ISD + N +I + + +ITK LTR   +Y+  Q   HV++A R+     GS       D V Y+I        A  ++  P  VL      E  L ID  YYL  QL   + R+ EPI
Sbjct:  371 REEDLLQAWADFILAMDPDVITGYNIQNFDLPYLISRAQALKVDRFPFLGRVTGLRSNIRDSSFQSRQVGRRDSKVI---SMVGRVQMDMLQVLLREH-KLRSYTLNAVSFHFLGEQKEDVQHSI-ITDLQN--GNEQTRRRLAVYCLKDAFLPLRLLERLMVLVNNVEMARVTGVPLGYLLTRGQQVKVVSQLLRQAMRQGLLMP----------VVKTEGSED-----------YTGATVIEPLKGYYDVPIATLDFSSLYPSIMMAHNLCYTTLLRPGAAQKLGLKPDEFIKTPTGDEFVKSSVR-KGLLPQILENLLSARKRAKAELAQETDPLRRQVL--DGRQLALKVSANSVYGFTGAQVGKLPCLEISQSVTGFGRQMIEKTKQLVE---SKYTVENGYDANAKVVYGDTDSVMCRFGVSSVAE---AMSLGREAANWVSSHFPSPIRLEFEKVYFPYLLISKKRYAGLLFSSRSDAHDKM----DCKGLEAVRRDNCPLVAN----LVTSSLRRILVDRDPDGAVAHAKDVISDLLCN-RIDISQLVITKELTRAAADYAGKQA--HVELAERMRKRDPGSAPSL--GDRVPYVIIGAAKGVAAYMKSEDPLFVL------EHSLPIDTQYYLEQQLAKPLLRIFEPI 971          
BLAST of DNA polymerase vs. Ensembl Mouse
Match: Pold1 (polymerase (DNA directed), delta 1, catalytic subunit [Source:MGI Symbol;Acc:MGI:97741])

HSP 1 Score: 155.606 bits (392), Expect = 8.981e-38
Identity = 158/582 (27.15%), Postives = 277/582 (47.59%), Query Frame = 2
Query: 1721 NERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGR-------LKRSIALPKITGHSNTSWIERMATAGRLLCDV-EVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDR---CKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVK-QLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKG-IQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALR 3427
             E  L+    + +  +DPD+I G+ +  + L  L+ R QAL ++ +   GR       ++ S    +  G  ++  I   +  GR+  D+ +V  RE  K RSY    +    L E+ +    S+ + DL     +    ++L    L ++ + + L+  L VL   +E+  + G  +   L+ G+  +    LL     +  ++P           ++ + S +           Y G  V+EP KG Y+  I  +DF+SLYPSI++ +N+C+TT+ R    + L +   +       D   KS  +  G+LP  +  L+ AR   K +L    +  + ++L  D RQ ALK++ANS+YG  G    +    +++  VT  GR+++  TK+++E   +K + +   +    ++YGDTDSVM   G+ +V +    M +G+     V+  +   I+L  + V    LL++KK+YA L   SR  +  K+    + KGL+ VRRD C L       ++T  L   L   D   ++ +    ISD + N +I + + +ITK LTR   +Y+  Q   HV++A R
Sbjct:  371 REEDLLQAWADFILAMDPDVITGYNIQNFDLPYLISRAQALKVDRFPFLGRVTGLRSNIRDSSFQSRQVGRRDSKVI---SMVGRVQMDMLQVLLREH-KLRSYTLNAVSFHFLGEQKEDVQHSI-ITDLQN--GNEQTRRRLAVYCLKDAFLPLRLLERLMVLVNNVEMARVTGVPLGYLLTRGQQVKVVSQLLRQAMRQGLLMP----------VVKTEGSED-----------YTGATVIEPLKGYYDVPIATLDFSSLYPSIMMAHNLCYTTLLRPGAAQKLGLKPDEFIKTPTGDEFVKSSVR-KGLLPQILENLLSARKRAKAELAQETDPLRRQVL--DGRQLALKVSANSVYGFTGAQVGKLPCLEISQSVTGFGRQMIEKTKQLVE---SKYTVENGYDANAKVVYGDTDSVMCRFGVSSVAE---AMSLGREAANWVSSHFPSPIRLEFEKVYFPYLLISKKRYAGLLFSSRSDAHDKM----DCKGLEAVRRDNCPLVAN----LVTSSLRRILVDRDPDGAVAHAKDVISDLLCN-RIDISQLVITKELTRAAADYAGKQA--HVELAER 904          
BLAST of DNA polymerase vs. Ensembl Mouse
Match: Rev3l (REV3 like, DNA directed polymerase zeta catalytic subunit [Source:MGI Symbol;Acc:MGI:1337131])

HSP 1 Score: 124.79 bits (312), Expect = 6.714e-28
Identity = 150/673 (22.29%), Postives = 272/673 (40.42%), Query Frame = 2
Query: 1706 VLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMAT---AGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIK--QLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTT-------IDRCKYLSVGDTDQAM--HILMDLSHKSVAKP-----------PGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYG--CLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVN-RRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLI 3640
            V   A+E++L   + N +   DPDI++G+ +  +  G LLQR  AL+++      R+       +     +    + M+     GR+  ++    R  +   +Y   ++   +L ++F  F   V    L   F++   +   +++D  +     N+ ++ +L ++    E+  + G      L+ G   R E ++L       YI      ++ Q SQ+   Q                  L++EP+   Y N +L++DF SLYPSI++ YN CF+T       + +      G T   +   +L  + H     P            G+LP  + ++++ R  VKQ + +    +      + RQ  LK+ AN  +G     FS  R    ++   +    RE L    K++ D                ++YGDTDS+ V        Q     KIGQ I E V     + ++L  + V    +L  KK+Y      + D+         + KG++ VRRD C    ++ +R L ++ E      D++  I  Y++     +   K S+  FI  K   R   +Y      P +++  ++  A     + R  + V Y+I          Q    P EVL     ++  L ++  YY+  Q+ P + R+ 
Sbjct: 2368 VTYAADEKALFQEITNIIKRYDPDILLGYEIQMHSWGYLLQRAAALSVDLCQMISRVPDDKIENRFAAERDDYGSDTMSEINIVGRITLNLWRIMRNEVALTNYTFENVSFHVLHQRFPLFTFRV----LSDWFDNKTDLYRWKMVDHYVSRVRGNLQMLEQLDLIGKTSEMARLFGIQFLHVLTRGSQYRVESMMLRIAKPMNYI--PVTPSIQQRSQMRAPQ---------------CVPLIMEPESRFYSNSVLVLDFQSLYPSIVIAYNYCFSTCLGHVENLGKYDEFKFGCTSLRVPPDLLYQIRHDVTVSPNGVAFVKPSVRKGVLPRMLEEILKTRLMVKQSMKSYKQDRALSRMLNARQLGLKLIANVTFGYTAANFS-GRMPCIEVGDSIVHKARETLERAIKLVND---------TKKWGARVVYGDTDSMFVLLKGATKEQ---SFKIGQEIAEAVTATNPRPVKLKFEKVYLPCVLQTKKRYVGYMYETLDQKEPVF----DAKGIETVRRDSCPAVSKILERSLKLLFET----RDISL-IKQYVQRQCMKLVEGKASIQDFIFAKEY-RGSFSYRPGACVPALELTRKM-LAYDRRSEPRVGERVPYVIIYGTPGLPLIQLIRRPAEVL-----QDPTLRLNATYYITKQILPPLARIF 2990          
BLAST of DNA polymerase vs. Ensembl Mouse
Match: Rev3l (REV3 like, DNA directed polymerase zeta catalytic subunit [Source:MGI Symbol;Acc:MGI:1337131])

HSP 1 Score: 124.79 bits (312), Expect = 6.714e-28
Identity = 150/673 (22.29%), Postives = 272/673 (40.42%), Query Frame = 2
Query: 1706 VLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMAT---AGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIK--QLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTT-------IDRCKYLSVGDTDQAM--HILMDLSHKSVAKP-----------PGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYG--CLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVN-RRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLI 3640
            V   A+E++L   + N +   DPDI++G+ +  +  G LLQR  AL+++      R+       +     +    + M+     GR+  ++    R  +   +Y   ++   +L ++F  F   V    L   F++   +   +++D  +     N+ ++ +L ++    E+  + G      L+ G   R E ++L       YI      ++ Q SQ+   Q                  L++EP+   Y N +L++DF SLYPSI++ YN CF+T       + +      G T   +   +L  + H     P            G+LP  + ++++ R  VKQ + +    +      + RQ  LK+ AN  +G     FS  R    ++   +    RE L    K++ D                ++YGDTDS+ V        Q     KIGQ I E V     + ++L  + V    +L  KK+Y      + D+         + KG++ VRRD C    ++ +R L ++ E      D++  I  Y++     +   K S+  FI  K   R   +Y      P +++  ++  A     + R  + V Y+I          Q    P EVL     ++  L ++  YY+  Q+ P + R+ 
Sbjct: 2368 VTYAADEKALFQEITNIIKRYDPDILLGYEIQMHSWGYLLQRAAALSVDLCQMISRVPDDKIENRFAAERDDYGSDTMSEINIVGRITLNLWRIMRNEVALTNYTFENVSFHVLHQRFPLFTFRV----LSDWFDNKTDLYRWKMVDHYVSRVRGNLQMLEQLDLIGKTSEMARLFGIQFLHVLTRGSQYRVESMMLRIAKPMNYI--PVTPSIQQRSQMRAPQ---------------CVPLIMEPESRFYSNSVLVLDFQSLYPSIVIAYNYCFSTCLGHVENLGKYDEFKFGCTSLRVPPDLLYQIRHDVTVSPNGVAFVKPSVRKGVLPRMLEEILKTRLMVKQSMKSYKQDRALSRMLNARQLGLKLIANVTFGYTAANFS-GRMPCIEVGDSIVHKARETLERAIKLVND---------TKKWGARVVYGDTDSMFVLLKGATKEQ---SFKIGQEIAEAVTATNPRPVKLKFEKVYLPCVLQTKKRYVGYMYETLDQKEPVF----DAKGIETVRRDSCPAVSKILERSLKLLFET----RDISL-IKQYVQRQCMKLVEGKASIQDFIFAKEY-RGSFSYRPGACVPALELTRKM-LAYDRRSEPRVGERVPYVIIYGTPGLPLIQLIRRPAEVL-----QDPTLRLNATYYITKQILPPLARIF 2990          
BLAST of DNA polymerase vs. UniProt/SwissProt
Match: sp|Q9DE46|DPOLA_XENLA (DNA polymerase alpha catalytic subunit OS=Xenopus laevis OX=8355 GN=pola1 PE=1 SV=1)

HSP 1 Score: 824.313 bits (2128), Expect = 0.000e+0
Identity = 558/1522 (36.66%), Postives = 825/1522 (54.20%), Query Frame = 2
Query:   29 MSEDDTYGRPR-RQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQLDNFIEG--DSEYMESGKEIFDESDEEDI--------KIGPKRKKSMKNANLKNPKKACLDFKSIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNREEIKAPFLSKKKEE--------FKFDIHQPKVISSSK------IKPNEPKEMPQKTVQEPIKFVKKQIVFNKGSSEKNKSPSTIENNETPEQHKIEDC--IVLDDIDFDEPFETN----PVVSAGFATDTK---------LEEHKPLWETEEIEDESSNDKYDPFE------NIDKSSLKLI-----------YWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQ-------------AQMTEVYSEVKSILA-KHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPP-FSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALP-QNSQLEI--DQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPED-LAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKY---HHANQHNEADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSID-----FKMELEKPWLCGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFA--CPRCESGIMKPLLSSSLLNRQLGYYRFL---------LTGKENLSYKQKELLQ-------MCSKYVERVLERSDYMNVDFKSLM 4279
            MS+  ++   R R+  ++K  + + L +LK+AK  G  +K E+E V  IY+ V+E  Y KL   RQ D++I     + Y+E G+EIFD+  E++         K  PK K ++K +++  P      F  + S  +K+    +  S          +L      ++ P       P ++ KK++        F      PKV+ +S        KP  P    + +V   IK   K  + +         P  +E      Q K ED   +  DD DFDEP E +    PV S+   T  +         ++E K  + T    +ES  D+ D  E       +D S L L+           YW DAY D+   PGVV+LFGK   ES   +V+ C+ V  +ER +Y+LP++                M  VY E    +A K+ I   ++K V K YAF+  DVP  ++YL V+Y +  P+LP DL G+TFS +FG NTS LE+F+L  ++KGP WL     + SS   S CK+   +     + + K+ +PP   +LSL++KTV N K++ NEIVAI   +H+   LD+APP   FQ +F +L+   D + PYD N+ +  +  AN    + I   ER+L+   L K+H +DPD+IVGH + G+ L +LLQR  +  +  W K GRL+RS+ +PK+ G S   + ER A  GR++CD+E+SA+ELI+C+SY   +L+ ++L    KA    +P  ++   +N S  +  +++ T  ++   + +M EL VLPLAL+IT I GN++ RTL GG+SERNEYLLLHAF E  +IVPDK      Q + +E   D   +Q    S++K  YAGGLVLEPK G Y+ FILL+DFNSLYPSII EYNICFTT+ R    +    DQ    + +L H  +    GILP EIRKLVE R  VKQL+  P+L+ +  LQ+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT  GREIL++TK++++        K+N    L++IYGDTDS+M+NT   N+   + V K+G  +K E+N+ YK ++++IDG+ + +LLL KKKYA+L V       GK + KQELKGLDIVRRDWC+L+ + G  +++ IL ++  P D +  +I   L  I +++ N  + + ++ I KALT++P++Y + +  PHV VAL INS GG  ++ +A DT+ Y+IC DG++ +A+QRAY+ +++      ++  LSID  YYL+ Q+HPVV R+ EPID ID++ +A  LGLDPS++    H  Q  E D          +  ++ DC+    +C KC  +   D       +++E P L      E   S  D  + V+ KL   I R I  YYS    C+           C    R+L ++  +    C  C    ++       L  QL +YRF+         +  ++   + +K+L Q            V++VL RS Y  V+   L 
Sbjct:    1 MSDSGSFAASRSRREKTEKSGRKEALERLKRAKA-GEKVKYEVEQVSSIYEEVDEAEYSKLVRDRQDDDWIVDDDGTGYVEDGREIFDDDLEDNALADSGKGAKGAPKDKTNVKKSSVSKPNNIKSMF--MASAVKKTTDKAVDLSKDDLLGDLLQDLKSQAVPITPP-------PVITLKKKKLAGSPLNPFSVPPTAPKVLPTSVKRLPAVTKPGHPAAQSKASVPRQIKKEPKAELISSAVG-----PLKVE-----AQVKEEDSGMVEFDDGDFDEPMEEDVEITPVDSSTIKTQAQSIKCVKEENIKEEKSSFITSATLNESCWDQIDEAEPMTTEIQVDSSHLPLVTGADGSQVFRFYWLDAYEDQYSQPGVVYLFGKVWIESADAYVSCCVSVKNIERTVYLLPRENRVQLSTGKDTGAPVSMMHVYQEFNEAVAEKYKIMKFKSKKVDKDYAFEIPDVPASSEYLEVRYSADSPQLPQDLKGETFSHVFGTNTSSLELFLLSRKIKGPSWLEIKSPQLSSQPMSWCKVEAVVTRPDQVSVVKDLAPPPVVVLSLSMKTVQNAKTHQNEIVAIAALVHHTFPLDKAPPQPPFQTHFCVLSKLNDCIFPYDYNEAVKQK-NAN----IEIALTERTLLGFFLAKIHKIDPDVIVGHDIYGFDLEVLLQRINSCKVPFWSKIGRLRRSV-MPKLGGRSG--FAERNAACGRIICDIEISAKELIRCKSYHLSELVHQIL----KAERVVIPPENIRNAYNDSVHLLYMLENTWIDAKFILQIMCELNVLPLALQITNIAGNVMSRTLMGGRSERNEYLLLHAFTENNFIVPDKPVFKKMQQTTVEDNDDMGTDQNKNKSRKKAAYAGGLVLEPKVGFYDKFILLLDFNSLYPSIIQEYNICFTTVHREAPSTQKGEDQDE--IPELPHSDLEM--GILPREIRKLVERRRHVKQLMKQPDLNPDLYLQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTHQGREILLHTKEMVQ--------KMN----LEVIYGDTDSIMINTNCNNL---EEVFKLGNRVKSEINKSYKLLEIDIDGIFKSLLLLKKKKYAALTV--EPTGDGKYVTKQELKGLDIVRRDWCELAKQAGNYVISQILSDQ--PRDSIVENIQKKLTEIGENVTNGTVPITQYEINKALTKDPQDYPDKKSLPHVHVALWINSQGG--RKVKAGDTISYVICQDGSNLSASQRAYAQEQL-----QKQENLSIDTQYYLSQQVHPVVARICEPIDGIDSALIAMWLGLDPSQFRAHRHYQQDEENDALLGGPSQLTDEEKYRDCERFKFFCPKCGTENIYDNVFDGSGLQIE-PGLKRCSKPECDASPLDYVIQVHNKLLLDIRRYIKKYYSGWLVCE--------EKTCQNRTRRLPLSFSRNGPICQACSKATLRSEYPEKALYTQLCFYRFIFDWDYALEKVVSEQERGHLKKKLFQESENQYKKLKSTVDQVLSRSGYSEVNLSKLF 1451          
BLAST of DNA polymerase vs. UniProt/SwissProt
Match: sp|P09884|DPOLA_HUMAN (DNA polymerase alpha catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=2)

HSP 1 Score: 803.127 bits (2073), Expect = 0.000e+0
Identity = 559/1515 (36.90%), Postives = 822/1515 (54.26%), Query Frame = 2
Query:   53 RPRRQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQLDNFIEGDSE--YMESGKEIFDESDEEDIKIGPKRKKSMK--NANLKNPKKACLDFKSIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNRE--EIKAP--FLSKKKEEF-----KFDIHQPKVISSSKIKPNEPKEMPQKTVQEPIKFVKKQIVFNKGSSEKNKSPSTIENNETPEQHKIEDCIVLDDIDFDEPFETNPVVSAGFATDTKLEEHKPLWETEEIEDESSNDK---------------YDPFE-----------NIDKSSLKLI-----------YWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQA-------------QMTEVYSEV-KSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPP-FSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQL-----EIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPP------GILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKY--HHANQHNEADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSIDFKMELE----KPWLCGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMT---TGQFACPRCESGIMKPLLSSSLLNRQLGYYRF----------LLTGKENLSYKQK----ELLQMCSKY---VERVLERSDYMNVDFKSLMA 4282
            R RR++ SKK  + + L +LKKAK  G   K E+E    +Y+ V+EE Y KL + RQ D++I  D    Y+E G+EIFD+  E+D     ++ K  K  N + +N KK  +       ++ KS+F        + K ++ +    L   L   N E  +I  P   + KKK         F +H    + S KI     ++ P  T   P+   + +   +    E     ST E  E+         +  +D DFDEP E   V     A     +E +P    EE++ E+ + K               +D  +            +D S L L+           YW DAY D+   PGVVFLFGK   ES +  V+ C+ V  +ER +Y LP++                M +VY E  + I  K+ I   ++KPV K YAF+  DVP++++YL V+Y ++ P+LP DL G+TFS +FG NTS LE+F+++ ++KGPCWL     +  +   S CK+         + + K+ SPP   +++ ++KT+ N K++ NEI+A+   +H+   LD+A P   FQ++F +++ PKD + PY   + +  +   N K  V + A ER+L+   L K+H +DPDIIVGH + G++L +LLQR        W K GRLKRS  +PK+ G S   + ER AT GR++CDVE+SA+ELI+C+SY   +L+Q++L    K     +P+ ++  +++ S+ +  L++ T  ++   + +M EL VLPLAL+IT I GN++ RTL GG+SERNE+LLLHAF E  YIVPDK        +L     EID    +  K  ++K  YAGGLVL+PK G Y+ FILL+DFNSLYPSII E+NICFTT+ R          +A  +  D   + + + P      GILP EIRKLVE R  VKQL+   +L+ + +LQ+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT+ GREIL++TK++++        K+N    L++IYGDTDS+M+NT   N+   + V K+G  +K EVN+ YK ++++IDGV + +LLL KKKYA+L  V    S G  + KQELKGLDIVRRDWC L+ + G  ++  IL ++ S + +  +I   L  I +++ N  + + +F I KALT++P++Y + +  PHV VAL INS GG  ++ +A DTV Y+IC DG++ TA+QRAY+P+++      ++  L+ID  YYLA Q+HPVV R+ EPID IDA  +A  LGLDP+++  HH ++  E D          +  ++ DC+     C  C  +   D   +      +P L    N++   S     V ++ KL   I R I  YY     C+           C    R L +    TG   CP C    ++P  S   L  QL +YR+          L T  E    K++    ++LQ   K     E+ L RS Y  V+   L A
Sbjct:   20 RARREKKSKK-GRQEALERLKKAKA-GEKYKYEVEDFTGVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDADEKGKDGKARNKDKRNVKKLAV----TKPNNIKSMFIACAGKKTADKAVDLSKDGLLGDILQDLNTETPQITPPPVMILKKKRSIGASPNPFSVHTATAVPSGKIASPVSRKEPPLT---PVPLKRAEFAGDDVQVE-----STEEEQES-------GAMEFEDGDFDEPMEVEEVDLEPMAAKAWDKESEP---AEEVKQEADSGKGTVSYLGSFLPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLVKGADEEQVFHFYWLDAYEDQYNQPGVVFLFGKVWIESAETHVSCCVMVKNIERTLYFLPREMKIDLNTGKETGTPISMKDVYEEFDEKIATKYKIMKFKSKPVEKNYAFEIPDVPEKSEYLEVKYSAEMPQLPQDLKGETFSHVFGTNTSSLELFLMNRKIKGPCWLEVKSPQLLNQPVSWCKVEAMALKPDLVNVIKDVSPPPLVVMAFSMKTMQNAKNHQNEIIAMAALVHHSFALDKAAPKPPFQSHFCVVSKPKDCIFPYAFKEVIEKK---NVK--VEVAATERTLLGFFLAKVHKIDPDIIVGHNIYGFELEVLLQRINVCKAPHWSKIGRLKRS-NMPKLGGRSG--FGERNATCGRMICDVEISAKELIRCKSYHLSELVQQIL----KTERVVIPMENIQNMYSESSQLLYLLEHTWKDAKFILQIMCELNVLPLALQITNIAGNIMSRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKK-GRKKAAYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRV-------ASEAQKVTEDGEQEQIPELPDPSLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLILQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTYKGREILMHTKEMVQ--------KMN----LEVIYGDTDSIMINTNSTNL---EEVFKLGNKVKSEVNKLYKLLEIDIDGVFKSLLLLKKKKYAAL--VVEPTSDGNYVTKQELKGLDIVRRDWCDLAKDTGNFVIGQILSDQ-SRDTIVENIQKRLIEIGENVLNGSVPVSQFEINKALTKDPQDYPDKKSLPHVHVALWINSQGG--RKVKAGDTVSYVICQDGSNLTASQRAYAPEQL-----QKQDNLTIDTQYYLAQQIHPVVARICEPIDGIDAVLIATWLGLDPTQFRVHHYHKDEENDALLGGPAQLTDEEKYRDCERFKCPCPTCGTENIYDNVFDGSGTDMEPSLYRCSNIDCKASPLTFTVQLSNKLIMDIRRFIKKYYDGWLICE--------EPTCRNRTRHLPLQFSRTGPL-CPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFA 1456          
BLAST of DNA polymerase vs. UniProt/SwissProt
Match: sp|P33609|DPOLA_MOUSE (DNA polymerase alpha catalytic subunit OS=Mus musculus OX=10090 GN=Pola1 PE=1 SV=2)

HSP 1 Score: 791.956 bits (2044), Expect = 0.000e+0
Identity = 551/1514 (36.39%), Postives = 809/1514 (53.43%), Query Frame = 2
Query:   53 RPRRQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQLDNFIEGDSE--YMESGKEIFDESDE----------EDIKIGPKRKKSMKNANLKNPKKACLDFKSIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNREEIKAPFLSKKKEEFK------FDIHQPKVISSSKIKPNEPKEMPQKTVQEPIKFVKKQIVFNKGSSEKNKSPSTIENNETPEQHKIEDCIVLDDIDFDEPFETNPVVSAGFATDTKLEEHKPLWETEEIEDE--------------------SSNDKYDPFE-NIDKSSLKLI-----------YWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQ-------------AQMTEVYSEVKS-ILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPP-FSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQL-----EIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPP------GILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKY--HHANQHNEADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSIDFKMELE----KPWLCGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFACPRCESGIMKPLLSSSLLNRQLGYYRFLLTGK---ENLSYKQKELL-------------QMCSKYVERVLERSDYMNVDFKSLMAKFS 4291
            R RR++ SKK  + + L +LKKAK  G   K E+E +  +Y+ V+EE Y KL + RQ D++I  D    Y+E G+EIFD+  E           D K   K +K +K  ++  P      F  I S  +K+    +  S          +L+   A+++ P       P L  KK+         F +H PK I S K  P  P  +  + +  PI   + ++               +   E PE  +    +  +D DFDE  +T  V        T  +E +P+   E   D                       +D+  P E  +D S+L L+           YW DAY D    PGVVFLFGK   ES K  V+ C+ V  +ER +Y LP++                M +VY E  S I AK+ I   ++K V K YAF+  DVP++++YL V+Y ++ P+LP +L G+TFS +FG NTS LE+F+++ ++KGPCWL     +  +   S CK          + + K+ SPP   ++S ++KT+ N +++ +EI+A+   +H+   LD+APP   FQ +F +++ PKD + P D  + ++ +   N K  V I A ER+LI   L K+H +DPDI+VGH +  ++L +LLQR     +  W K GRL+RS  +PK+   S + + ER AT GR++CDVE+SA+ELI C+SY   +L+Q++L  K +  V  +P  ++  +++ S+ +  L++    ++   + +M EL VLPLAL+IT I GN++ RTL GG+SERNE+LLLHAF E  YIVPDK        +L     EID    +  K  ++K TYAGGLVL+PK G Y+ FILL+DFNSLYPSII E+NICFTT+ R        T +      D   + + + P      GILP EIRKLVE R  VKQL+   +L+ + +LQ+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT+ GREIL++TK +++        K+N    L++IYGDTDS+M+NT   N+   + V K+G  +K EVN+ YK ++++ID V + +LLL KKKYA+L  V    S G  I KQELKGLDIVRRDWC L+ + G  ++  IL ++ S + +  +I   L  I +++ N  + + +F I KALT++P++Y + +  PHV VAL INS GG  ++ +A DTV Y+IC DG++ TATQRAY+P+++          L+ID  YYLA Q+HPVV R+ EPID IDA  +A  LGLD +++  H  ++  E D          +  ++ DC+     C  C  +   D   E      +P L    NV+   S     V ++ KL   I R I  YY     C+    C  +  +       L  +     CP C   +++P  S   L  QL +YR++       E L+  +K+ L             +      E+ L  S Y  V+   L A ++
Sbjct:   26 RARREKKSKK-GRQEALERLKKAKA-GEKYKYEVEDLTSVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDTCGKGSDGKAHRKDRKDVKKPSVTKPNNIKAMF--IASAGKKTTDKAVDLSKDDLLGDILQDLNTETAQITPP-------PVLIPKKKRSTGALLNPFSVHTPKAIPSGK--PASPV-LRNEPLLTPIPLKRAELA------------GELAQPECPEDEQELGVMEFEDGDFDESMDTEKVDEKPVTAKTWDQETEPVERVEHEADPERGTTSYLENFLPDVSCWDIDQDDESIPQEVQVDSSNLPLVKGADDEQVFQFYWLDAYEDPYNQPGVVFLFGKVWIESVKTHVSCCVMVKNIERTLYFLPREMKFDLNTGKETAIPVTMKDVYEEFDSKISAKYKIMKFKSKIVEKNYAFEIPDVPEKSEYLEVRYSAEVPQLPQNLKGETFSHVFGTNTSSLELFLMNRKIKGPCWLEVKNPQLLNQPISWCKFEVMALKPDLVNVIKDVSPPPLVVMSFSMKTMQNVQNHQHEIIAMAALVHHSFALDKAPPEPPFQTHFCVVSKPKDCIFPCDFKEVISKK---NMK--VEIAATERTLIGFFLAKVHKIDPDILVGHNICSFELEVLLQRINECKVPYWSKIGRLRRS-NMPKLG--SRSGFGERNATCGRMICDVEISAKELIHCKSYHLSELVQQIL--KTERIV--IPTENIRNMYSESSYLLYLLEHIWKDARFILQIMCELNVLPLALQITNIAGNIMSRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKK-GRKKATYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRV-------TSEVQKATEDEEQEQIPELPDPNLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLVLQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTYKGREILMHTKDMVQ--------KMN----LEVIYGDTDSIMINTNSTNL---EEVFKLGNKVKSEVNKLYKLLEIDIDAVFKSLLLLKKKKYAAL--VVEPTSDGNYITKQELKGLDIVRRDWCDLAKDTGNFVIGQILSDQ-SRDTIVENIQKRLIEIGENVLNGSVPVSQFEINKALTKDPQDYPDRKSLPHVHVALWINSQGG--RKVKAGDTVSYVICQDGSNLTATQRAYAPEQLQKLDN-----LAIDTQYYLAQQIHPVVARICEPIDGIDAVLIALWLGLDSTQFRVHQYHKDEENDALLGGPAQLTDEEKYKDCEKFKCLCPSCGTENIYDNVFEGSGLDMEPSLYRCSNVDCKVSPLTFMVQLSNKLIMDIRRCIKKYYDGWLICEEPTCCSRLRRL------PLHFSRNGPLCPVCMKAVLRPEYSDKSLYTQLCFYRYIFDADCALEKLTEHEKDKLKKQFFPLRVLQDYRKVKNIAEQFLSWSGYSEVNLSKLFANYA 1462          
BLAST of DNA polymerase vs. UniProt/SwissProt
Match: sp|O89042|DPOLA_RAT (DNA polymerase alpha catalytic subunit (Fragment) OS=Rattus norvegicus OX=10116 GN=Pola1 PE=1 SV=1)

HSP 1 Score: 783.482 bits (2022), Expect = 0.000e+0
Identity = 548/1493 (36.70%), Postives = 814/1493 (54.52%), Query Frame = 2
Query:   53 RPRRQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQLDNFIEGDSE--YMESGKEIFDE----------SDEEDIKIGPKRKKSMKNANLKNPKKACLDFKSIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNREEIKAPFLSKKKEEFK------FDIHQPKVISSSKI-KPNEPKEMPQKTVQEPIKFVKKQIVFNKGSSEKNKSPSTIENNETPEQHKIEDCIVLDDIDFDEPFETNPV-----VSAGF-------------------ATDTKLEEHKPLWETEEIEDESSNDKYDPFENIDKSSLKLI-----------YWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQA-------------QMTEVYSEVKS-ILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPP-FSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDK-----AAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDT-DQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKY--HHANQHNEADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSID--FK---MELEKPWLCGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFA--CPRCESGIMKPLLSSSLLNRQLGYYRFLLTGK---ENLSYKQKELLQMCSKYVERVLERSDYMNV 4261
            R RR++ SKK  + + L +LKKAK  G   K E+E +  +Y+ V+EE Y KL + RQ D++I  D    Y+E G+EIFD+           +  D K   K +K +K  ++  P      F  I S  +K+       +  +    +++ L D+L +L+T   +    P L  KK+         F +H    + S KI  P   KE P   V  P+K              + +    +   E PE  +    I  +D DFDEP +T  V     V+A                      T + L+   P     +I+ +  N        +D + L L+           YW DAY D    PGVVFLFGK   ES K  V+ C+ V  +ER +Y LP++                M +VY E  S I AK+ I   ++K V K YAF+  DVP++++YL V+Y ++ P+LP +L G+TFS +FG NTS LE+F+++ ++KGPCWL     +  +   S CK          + + K+ SPP   ++S ++KT+ N +++ +EI+A+   +H+   LD+APP   FQ +F +++ PKD + P    + +  +        V + A ER+L+   L K+H LDPDI+VGH + G++L +LLQR     +  W K GRL+RS  +PK+   S + + ER AT GR++CDVE+S +ELI C+SY   +L+Q++L  K +  V  +P  ++  +++  + +  L++    ++   + +M EL VLPLAL+IT I GN++ RTL GG+SERNE+LLLHAF E  YIVPDK         P +   EID    +  K  ++K  YAGGLVL+PK G Y+ FILL+DFNSLYPSII E+NICFTT+ R    ++  T D+    + +L   ++    GILP EIRKLVE R  VKQL+   +L+ + +LQ+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT+ GREIL++TK++++        K+N    L++IYGDTDS+M+NT   N+   + V K+G  +K EVN+ YK ++++IDGV + +LLL KKKYA+L  V    S G  I KQELKGLDIVRRDWC L+ + G  ++  IL ++ S + +  +I   L  I +++ N  + + +F I KALT++P++Y + +  PHV VAL INS GG  ++ +A DTV Y+IC DG++  ATQRAY+P+++      ++  L+ID  YYLA Q+HPVV R+ EPID IDA  +A  LGLD +++  H  ++  E D          +  ++ DC+     C  C  +   D  F+   M++E P L    N++   S A   V ++ KL   I R I  YY     C+           C    R+L +   +    CP C   +++P  S   L  QL +YR++       E L   +K+ L+    +  RVL+  DY  V
Sbjct:   26 RARREKKSKK-GRQEALERLKKAKA-GEKYKYEVEDLTSVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDTCGEGSDGKAHRKDRKDVKKPSVTKPNNIKAMF--IASAGKKT-------TDKTVDLSKDDLLGDILQDLNTETPQIAPPPVLIPKKKRSTGASPNPFSVHTATAVPSGKIASPVSRKEPPLTPV--PLK--------------RAEFAGDLAQPECPEDEQESGVIEFEDGDFDEPMDTEEVDEEEPVTAKIWDQESEPVEGVKHEADPETGTTSFLDSFLPDVSCWDIDQKDENSFLLQEVQVDSNHLPLVKGADDEQVFQFYWLDAYEDPYNQPGVVFLFGKVWVESAKTHVSCCVMVKNIERTLYFLPREMKIDLNTGKETATPITMKDVYEEFDSKISAKYKIMKFKSKIVEKNYAFEIPDVPEKSEYLEVRYSAEVPQLPQNLKGETFSHVFGTNTSSLELFLMNRKIKGPCWLEVKNPQLLNQPISWCKFEAMALKPDLVNVIKDVSPPPLVVMSFSMKTMQNVQNHQHEIIAMAALVHHNFPLDKAPPKPPFQTHFCVVSKPKDCIFPCAFKEVIKKK-----NMEVEVAATERTLLGFFLAKVHKLDPDILVGHNICGFELEVLLQRINECKVPFWSKIGRLRRS-NMPKLG--SRSGFGERNATCGRMICDVEISVKELIHCKSYHLSELVQQIL--KTERIV--IPTENIRNMYSEPSHLLYLLEHIWKDARFILQIMCELNVLPLALQITNIAGNIMSRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKPGDEDEEIDGDTNKYKK-GRKKAAYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRVASETLKATEDEEQEQIPELPDPNLDM--GILPREIRKLVERRKQVKQLMKQQDLNPDLVLQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTYKGREILMHTKEMVQ--------KMN----LEVIYGDTDSIMINTNSTNL---EEVFKLGNKVKNEVNKLYKLLEIDIDGVFKSLLLLKKKKYAAL--VVEPTSDGNYITKQELKGLDIVRRDWCDLAKDTGNFVIGQILSDQ-SRDTIVENIQKRLIEIGENVLNGSVPVSQFEINKALTKDPQDYPDKKSLPHVHVALWINSQGG--RKVKAGDTVSYVICQDGSNLPATQRAYAPEQL-----QKQDNLAIDTQYYLAQQIHPVVARICEPIDGIDAVLIALWLGLDSTQFRVHQYHKDEENDALLGGPAQLTDEEKYKDCEKFKCLCPSCGTENIYDNVFEGSGMDME-PSLNRCSNIDCKASPATFMVQLSNKLIMDIRRCIKKYYDGWLICE--------EPTCRNRIRRLPLHFSRNGPLCPACMKAVLRPEYSDKSLYTQLCFYRYIFDADCALEKLPEHEKDKLKK-QFFTPRVLQ--DYRKV 1439          
BLAST of DNA polymerase vs. UniProt/SwissProt
Match: sp|P26019|DPOLA_DROME (DNA polymerase alpha catalytic subunit OS=Drosophila melanogaster OX=7227 GN=DNApol-alpha180 PE=1 SV=2)

HSP 1 Score: 676.781 bits (1745), Expect = 0.000e+0
Identity = 443/1177 (37.64%), Postives = 653/1177 (55.48%), Query Frame = 2
Query:  932 LKLIYWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLP-------------KDQAQMTEVYSEVKSILAKH-GIESLRTKPVTKKYAFQFI--DVPDETDYLMVQYDSK--FPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPPFSILSL-----NIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEAN-ERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQ--SNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKYHHANQHNEADNTYSKQ-----ESTDEANRFIDCKPLPIYCRKCQHKTSIDFKMELEKPWLCGNCNVELLYSHADA----------VNVNKKLKEIIDRIIHIYYSCISTC---QCGYICRGMVNICNEEARKLLMTTGQFACPRCESGIMKPLLSSSLLNRQLGYYRFLLT-GKENLSYKQ------KELLQMCSKYVERVLERSDYMNVDFKSLMAKFSRQIKI 4306
            L+  YW +AY D  K+PG VFLFG+T D  +     VC+RV  + R +Y+LP             K +  + ++Y E  S +A    +E  R++ VTK +A   I  +VP   DYL V YD K   P L +D    + + IFGA T+ LE F+LD ++KGPCWL  +G + S    S C     +   K +++ ++K  P     L     N++T MN K++ NEI  I    HN  ++DR  P   F  +   LT P     P DLN ++A      YK++ + + + ER+L+S  L +   +D D+IV    +  QL ++  +  AL I  W + GRL+ S +  K         +E     GR++CDV+ SA E I+ RSY+ + L +++L  K ++    V   DL  ++     I +LI LT+ ++   + LM EL ++PLAL+IT ICGN + RTL GG+SERNE+LLLHAF+EK YIVPDK     ++   + D   S       +K+K  YAGGLVLEP +GLYE ++LLMDFNSLYPSII EYNICFTT+ +       D D+ +  L D   +     PGILP+++++LVE+R  VK+L+  P+LS E  +Q+ IRQ ALK+TANSMYGCLGF+ SRF A  LAALVT  GREIL NT+++++        K+N     D++YGDTDS+M+NT   N+  YD V KIG  IK+ VN+ YK ++L+IDGV   +LLL KKKYA++  +S+D S G L  +QE KGLDIVRRDW +L++ VGK +L  +L E+   E L  ++H  L+ I   +    + L  F+ITK LTR P+ Y+N    PHVQVALR+N      ++Y+  D V+Y+IC DGT+  A QRAY   E+ +S   E++KL +D NYYL HQ+HPVV R++E ++  DAS +AE LG+DP+K+    Q  + +NT   +     ++T +  R   C+P    C  C+ +          +P    N ++ +L   A +           +V  +L+  + + +  +Y     C    C +         N     L   + +  C +C SG +    +   L  QL Y RF+   GK+ L  K       ++  Q+  + V++ L+ S Y+ +    L A+   Q+ +
Sbjct:  362 LRFWYW-EAYEDPVKMPGEVFLFGRTADGKS-----VCLRVQNINRVLYLLPRQFLLDPISKEPTKQKVTVADIYKEFDSEVANQLKLEFFRSRKVTKSFAHHAIGIEVPQSCDYLEVHYDGKKPLPNLSADKKYNSIAHIFGATTNALERFLLDRKIKGPCWLQVTGFKVSPTPMSWCNTEVTLTEPKNVELVQDKGKPAPPPPLTLLSLNVRTSMNPKTSRNEICMISMLTHNRFHIDRPAPQPAFNRHMCALTRPAVVSWPLDLNFEMA-----KYKSTTVHKHDSERALLSWFLAQYQKIDADLIVTFDSMDCQLNVITDQIVALKIPQWSRMGRLRLSQSFGK-------RLLEHFV--GRMVCDVKRSAEECIRARSYDLQTLCKQVLKLK-ESERMEVNADDLLEMYEKGESITKLISLTMQDNSYLLRLMCELNIMPLALQITNICGNTMTRTLQGGRSERNEFLLLHAFHEKNYIVPDKKPVSKRSGAGDTDATLSGADATMQTKKKAAYAGGLVLEPMRGLYEKYVLLMDFNSLYPSIIQEYNICFTTVQQ-----PVDADE-LPTLPDSKTE-----PGILPLQLKRLVESRKEVKKLMAAPDLSPELQMQYHIRQMALKLTANSMYGCLGFAHSRFFAQHLAALVTHKGREILTNTQQLVQ--------KMN----YDVVYGDTDSLMINT---NITDYDQVYKIGHNIKQSVNKLYKQLELDIDGVFGCLLLLKKKKYAAIK-LSKD-SKGNLRREQEHKGLDIVRRDWSQLAVMVGKAVLDEVLSEKPLEEKLD-AVHAQLEKIKTQIAEGVVPLPLFVITKQLTRTPQEYANSASLPHVQVALRMNRERN--RRYKKGDMVDYVICLDGTTNAAMQRAYHLDELKTS---EDKKLQLDTNYYLGHQIHPVVTRMVEVLEGTDASRIAECLGMDPTKFRQNAQRTQRENTEQSEGESLLKTTLQLYRL--CEPFRFQCVTCKTE---QLMASAYRPG-PSNSHIAVLQQCAKSECQTAPIQYLASVRNQLQLSMRQYVQRFYKNWLVCDHPDCNF---------NTRTHSLRKKSHRPLCQKCRSGSLLRQYTERDLYNQLCYLRFMFDLGKQTLQQKPTLTPELEQAYQLLYETVDQQLQSSSYVIISLSKLFARSLAQMSL 1468          
BLAST of DNA polymerase vs. TrEMBL
Match: V4BGE0 (DNA polymerase (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_109334 PE=3 SV=1)

HSP 1 Score: 853.588 bits (2204), Expect = 0.000e+0
Identity = 565/1448 (39.02%), Postives = 811/1448 (56.01%), Query Frame = 2
Query:   53 RPRRQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIEVE-DIYDVVNEETYEKLKEKRQLDNFIEGD--SEYMESGKEIFDES-DEE-----DIKIGPKRKKSMKNANLKNPKKACLDFKSIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNREEIKAPFLSKKKEEFKFDIHQPK------VISSSKIKPNEPKEMPQKTVQEPIKFVKKQIVFNKGSSEKNKSPSTIENNETPEQHKIEDCIVLDDIDFDEPFETNPVVSAG-FATDTKLEEHKPL--------WETEEIED-ESSNDKYDPFENIDKSSLKLI-----------YWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPK-------------DQAQMTEVYSEVKSILA-KHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLN--FXXXXXXXXXXXXXXSPPFSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDR-APPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKIT-GHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDK----AAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKYHHANQHNEADNTYSKQESTDEANRFIDCKPLPIYCRK--CQHKTSIDFKMELEKPWL------CGNCNVELLYSHADAVN-VNKKLKEIIDRIIHIYYSCISTCQ---CGYICRGMVNICNEEARKLLMTTGQFACPRCESGIMKPLLSSSLLNRQLGYYRFLLTGKENLS 4183
            R RRQ+  +K  +     KLK+AK+ G   K EIE E  +Y++V+E+ Y ++  +RQ D++I  D  + Y+E G+EIFD+  DEE     D  IG K+K    N N+  P           +  + ++ SM   +S+  KK    ++     EL     EE+ +     K    K + ++P         S   +KP   K+ P  ++Q P     K         +K   P  +   + P + K E   V +D    E F+TN         T+ +++++           WE  + E  E   D +     +D S L L+           YW DAY D  K PG V+LFGK   ES +  V+ C+ V  ++RR+Y+LP+              +  M +VY+E    +A KH I   ++  VTK+YAF+ I+VP E++YL V+Y +  P LP+DL G+TFS IFGAN S LE+F++D +LKGP WL     +      S CK+           +  +    PP  I++LN++T+ N K++ NEI+   G IHN+  +D+ AP    FQ +F +L+ P D + P+D   KL+ E G N K  VL   NER+L++ LL K+H +DPD+I+GH + G+ L ++L R  A  I  W K GRLKRS+ +PK++ G    S  E+ A  GR++CD+++SA+ELI+ RSY+  +L+Q +L EK     S +   D+  +++SS  + QLI+LTL +S   + +M+EL ++PLAL+IT ICGN++ RTL GG+SERNEYLLLHAF EK ++VPDK       +  N   E   + +      KRKP YAGGLVLEPKKG Y+ FILL+DFNSLYPSII EYNICFTTI+R       + D+    L +L  K +   PGILP EIRKLVE+R  VKQL+   NLS E+ +Q+DIRQKALK+TANSMYGCLGFS SRF A  LAA+VT  GREIL+ T+ +++             + LD+IYGDTDS+M+NT   N    DTV K+G  +K EVN+ Y+ ++++IDGV + +LLL KKKYA+L+V     S G     QELKGLDIVRRDW  L+ E G  +++ IL  E S E++  +IH  L  + + +RN  IS   F ITK+LT+NPE+Y + +  PHVQVALR+NS GG  K+ R  DT+ YIIC DG++  A+QRAY P+E+      ++  L ID  YYL++Q+HPVV RL +PI+  DA+ +AE LGLDPS Y HA  HN+ ++     + T+E  R+ DC  L   C +  C  +   D      + ++      C N   E      D +  +  +L  +I + I  YY     C+   CG   + +          L+   G   C  C  GI+    S S L  QL +Y++L   ++ +S
Sbjct:    5 RSRRQKK-EKTGRAAAFEKLKRAKERGEKHKYEIEEEKSVYEIVDEDNYSEIVRQRQEDDWIIDDDGAGYVEDGREIFDDDMDEETVSKNDKNIGDKKK----NKNIVRPG----------TKPKANIKSMFAAASMVTKKKPEKDVSLADDELLGDLMEELGSS--QAKPLPVKINKNKPSNKAALNPFSVKPLKPRNIKQEPDHSIQRPQAPAIK--------IKKQHKPEPVRIKKEPVEIKPEP--VDEDSPMIEQFDTNMDDDDDVIQTENQVQQNGGANLEFVSSGWENVQSETVEPVGDIH-----VDSSKLPLVTNEEGEQIMRFYWLDAYEDPWKQPGTVYLFGKVFIESAESHVSCCVTVKNIDRRVYLLPRKNRYNMKTKEETEGEISMVDVYTEFNEQIADKHKIMKFKSMKVTKQYAFEKIEVPVESEYLEVRYAADLPALPTDLCGETFSHIFGANKSSLELFLIDRKLKGPGWLDLKTPQLPPGPVSWCKVEAVVTSPNHVTVLRDSLAPPPLVIMTLNLRTLPNPKTHQNEIIGAAGLIHNDYNMDKPAPKQNQFQQHFCVLSKPNDCIYPFDFKDKLSKE-GKNMKTEVL--PNERALLAFLLAKIHKIDPDLIIGHDIYGFDLDVMLHRINANKIPHWSKIGRLKRSV-MPKLSHGPGQRSHGEKSAMCGRMMCDIQISAKELIRSRSYDLTELVQHILHEK----RSEIDYDDIRNMYSSSKHLLQLIELTLVDSTFILRIMYELNIIPLALQITNICGNIMGRTLMGGRSERNEYLLLHAFTEKNFLVPDKEYKKKPVVHHNEDEEDLDTTKSKKSQGKRKPAYAGGLVLEPKKGFYDKFILLLDFNSLYPSIIQEYNICFTTINRTPVAQTNEEDE--EALPELPDKDLE--PGILPTEIRKLVESRKQVKQLMKVDNLSPEQKMQYDIRQKALKLTANSMYGCLGFSHSRFYAKPLAAMVTGKGREILLQTRDLVQ------------MMNLDVIYGDTDSIMINT---NSTDMDTVFKLGNKVKAEVNKLYRLLEIDIDGVFKSMLLLKKKKYAALSVSK--NSDGTYTTTQELKGLDIVRRDWSDLAKEAGNFVVSQILSGE-SREEIVENIHTKLIEVGEQVRNDGISTELFHITKSLTKNPEDYPDKKSLPHVQVALRLNSKGG--KKLRGGDTIPYIICEDGSNLPASQRAYHPEEL-----AKQETLKIDVKYYLSNQVHPVVSRLCDPIEGTDAAHLAECLGLDPSGYRHAVHHNDEEDALLGDQLTEE-ERYKDCDRLKFICPQPTCNKEIIFDSVFSGSEAYIECSLAKCTNPACE--SRPVDYLGRIKNQLTMVIRQHIKKYYEGWMKCEDTACGARTKKL---------PLMFQRGHPFCSACHRGILHLEYSDSALYTQLSFYQYLFDPEKAMS 1371          
BLAST of DNA polymerase vs. TrEMBL
Match: E7FB68 (DNA polymerase OS=Danio rerio OX=7955 GN=pola1 PE=1 SV=1)

HSP 1 Score: 848.195 bits (2190), Expect = 0.000e+0
Identity = 564/1517 (37.18%), Postives = 828/1517 (54.58%), Query Frame = 2
Query:   41 DTYG----RPRRQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQ--LDNFIEGDSEYMESGKEIFDESDEEDIKIGPKRKKSMKNANL-KNPKKACLDFKSIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNREEIKAPFLSKKKEEFKFDIHQPKVISSSK------------IKPNEPKEMPQKTVQEPIKFVKKQIVFN-----KGSSEKNKSPSTIENNETPEQHKIEDCIVLDDIDFDEPF----------------ETNPVVSAGFATDT----------------KLEEHKPLWETEEIEDESSNDKYDPFENIDKSSLKLIYWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQ------------AQMTEVYSEVKSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXS-PPFSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQG-GKFSK--RKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKYHHANQH--NEADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSIDFKMELEKPWL------CGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFA--CPRCESGIMKPLLSSSLLNRQLGYYRFL----------LTGKENLSYKQKELLQMCSKY------VERVLERSDYMNVDFKSLMAKF 4288
            DT G    R RR++  +K+ +   L +LK+AK+ G  +K E+E    IYD V+EE Y K+  +RQ       +  + Y+E G+EIFDE  ++D  +GPK K++ K  +  KN KK+ +       +S KS+F                   +   +LS   ++++    L     E    +  P +I+  K            +KP  PKE+P+  V +P   V +    +       S E +K+ +  +  +   +   E+ I  D++DFDEP                 ET P+V     T+                 K+EE KP+    E++ +SS  +    E  D   +   YW DA+ D+   PGVVFLFGK   ES +  V+ C+ V  +ER +Y+LP++               M +VY E   I  K  I   ++KPVTK YAF+  D+P +++YL V+Y ++ P LPSDL G TFS +FG NTS LE F+L+ +++GPCWL  +  + S+   S CK+    +    I + K+ S PP  ++S+++KTV N K++ NEIV+I   +H+   LD+APP   FQ +F +++ P D V PYD    +  + G      V I   ER+L+   L K+H +DPD++VGH + G+ L +LLQR     +  W K GRL+R+  +PK+ G S   + E+ AT GRL+CD+E+SA+ELI+C+SY   +L+ ++L    KA    VP  ++   ++ S  +  L++LT  ++ + + +M EL VLPLAL+IT I GN++ RTL GG+SERNEYLLLHAF+E+ +IVPDK         L  D+  + G GK +K  +K  YAGGLVL+PK G Y+ FILL+DFNSLYPSII E+NICFTT++R    +   T++    + +L  +S+    GILP EIRKLVE R  VKQL+  P+L+ +  LQ+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT  GREIL++TK++++             + L++IYGDTDS+M+NT   N+   + V K+G  +K EVN+ YK ++++IDGV + +LLL KKKYA+L V    +  GK   KQELKGLDIVRRDWC L+ E G  ++  IL ++ + + +  +I  +L  I + + N  I L  F I K+LT+ P++Y + +  PHV VAL INS GG  K+ +A DTV Y+IC DG++  A+QRAY+ +++      ++  L++D  YYL+ Q+HPVV R+ EPI+ IDA  +A  LGLDPS +    Q   +EAD+         +  R+ DC+     C  C  +   D   E     L      C  C+V    S  D  V +  KL+  I R I  YYS    C+           C    R+L +   +    CP C    +KP  S   L  QL +YR++          LTG + L +K KE  +    Y       + +L  S Y  V+   L   F
Sbjct:   20 DTCGIAASRSRREKK-EKVGRKSALEQLKRAKK-GEKVKYEVEEFTSIYDEVDEEQYSKIVRERQDDDWIIDDDGTGYVEDGREIFDEELDDD-ALGPKSKQAAKGGDSKKNVKKSSVS----KPNSIKSMF----------MNSNVKKPAEKHVDLS---QDDLLGDILQDLHSEKSVVLTPPPIITLKKKKTLGSPMNPFSVKPQMPKELPEVHVSKPRPVVTRVPPADPSPRSAASVEPSKA-TAAQIKKPKIEEPEEEAIEFDEMDFDEPMEAENLEEEPVKEKAEPETKPIVKVEPKTEPQDKMLISGLVGGMGWEKMEEGKPIETPVEVQVDSS--QLPLVEGPDGDMVFRFYWLDAFEDQYNQPGVVFLFGKVWIESAEAHVSCCVAVKNIERTMYLLPREHKVNLATGEKGVAVGMMDVYKEFNEISEKFKIMKFKSKPVTKNYAFEIPDIPSQSEYLEVKYSAEIPSLPSDLKGTTFSHVFGTNTSSLEHFLLNRKIRGPCWLDVTTPQLSNQPISWCKVEAVAQKSDLISVVKDLSPPPLVVMSISLKTVQNPKTHQNEIVSIAALVHHTFPLDKAPPRPPFQTHFCVVSKPNDCVFPYDFKDAVRKKNGI-----VEIAGTERALLGFFLAKMHKIDPDVLVGHDIFGFDLEVLLQRINVCKVPHWSKIGRLRRA-NMPKLGGRS--GFAEKSATCGRLVCDIEISAKELIRCKSYNLTELVSQIL----KAERPVVPPENIRNFYSDSTHLLYLLELTWMDAKLILQIMCELNVLPLALQITNIAGNVMSRTLMGGRSERNEYLLLHAFHERDFIVPDKQFFKKAQQDLGEDEEGDSGKGKSNKTRKKAAYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVERGATNTRKKTEEDEDEIPELPDQSLEM--GILPKEIRKLVERRRQVKQLMKEPDLNPDLYLQYDIRQKALKLTANSMYGCLGFSFSRFYAKPLAALVTHKGREILMHTKEMVQ------------RMNLEVIYGDTDSIMINTNSTNL---EEVFKLGNKVKSEVNKLYKLLEIDIDGVFKSLLLLKKKKYAALMV--EPQGDGKYTTKQELKGLDIVRRDWCDLAKECGNYVIGQILSDQ-NRDTIIENIQKHLIEIGEKVANGNIPLNMFEIHKSLTKEPQDYPDKKSLPHVHVALWINSQGG--KKVKAGDTVSYVICQDGSNLAASQRAYTLEQL-----QKQPGLNLDTQYYLSQQVHPVVGRICEPIEGIDAVLIATWLGLDPSHFRAQQQQREDEADDFLGAPAQLTDEERYRDCERFTFTCPDCGTENIYDNVFEGTGSTLQLSLKSC--CHVPCGGSPMDHQVQIGNKLQLDIRRHIRRYYSGWLLCE--------DQACRNRIRRLPIAFSRSGPICPACLRSTLKPEYSEKALYNQLSFYRYIFDWEYAINKVLTGDDKLKFKSKEWKEEMEVYKKLKGVTDNILATSGYSEVNLAKLFQAF 1464          
BLAST of DNA polymerase vs. TrEMBL
Match: E9QIM3 (DNA polymerase OS=Danio rerio OX=7955 GN=pola1 PE=1 SV=1)

HSP 1 Score: 838.18 bits (2164), Expect = 0.000e+0
Identity = 560/1500 (37.33%), Postives = 824/1500 (54.93%), Query Frame = 2
Query:   53 RPRRQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQLDNFIEG--DSEYMESGKEIFDESDEEDIKIGPKRKKSMKNANLK-NPKKACLDFKSIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNREEIKAPFLSKKKEEFKFDIHQPKVISSSKIK----PNEP----KEMPQKTVQEPIKFVKKQIVFNKGSSEKNKSPSTIENNETPEQHKIEDCIVLDDIDFDEPFE----------------TNPVVSAGFATDT----------------KLEEHKPLWETEEIEDESSNDKYDPFENIDKSSLKLIYWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQ------------AQMTEVYSEVKSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPP-FSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQG-GKFSK--RKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKYHHANQH--NEADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSIDFKMELEKPWL------CGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFA--CPRCESGIMKPLLSSSLLNRQLGYYRFL----------LTGKENLSYKQKELLQMCSKY------VERVLERSDYMNVDFKSLMAKF 4288
            R RR++  +K+ +   L +LK+AK+ G  +K E+E    IYD V+EE Y K+  +RQ D++I     + Y+E G+EIFDE  ++D  +GPK K++ K  + K N KK+ +       +S KS+F                   +   +LS   ++++    L     E    +  P +I+  K K    P  P     +MP+  +  P      +   +  S E +K+ +  +  +   +   E+ I  D++DFDEP E                T P+V     T+                 K+EE KP+    E++ +SS  +    E  D   +   YW DA+ D+   PGVVFLFGK   ES +  V+ C+ V  +ER +Y+LP++               M +VY E   I  K  I   ++KPVTK YAF+  D+P +++YL V+Y ++ P LPSDL G TFS +FG NTS LE F+L+ +++GPCWL  +  + S+   S CK+    +    I + K+ SPP   ++S+++KTV N K++ NEIV+I   +H+   LD+APP   FQ +F +++ P D V PYD    +  + G      V I   ER+L+   L K+H +DPD++VGH + G+ L +LLQR     +  W K GRL+R+  +PK+ G S   + E+ AT GRL+CD+E+SA+ELI+C+SY   +L+ ++L    KA    VP  ++   ++ S  +  L++LT  ++ + + +M EL VLPLAL+IT I GN++ RTL GG+SERNEYLLLHAF+E+ +IVPDK         L  D+  + G GK +K  +K  YAGGLVL+PK G Y+ FILL+DFNSLYPSII E+NICFTT++R    +   T++    + +L  +S+    GILP EIRKLVE R  VKQL+  P+L+ +  LQ+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT  GREIL++TK++++             + L++IYGDTDS+M+NT   N+   + V K+G  +K EVN+ YK ++++IDGV + +LLL KKKYA+L V    +  GK   KQELKGLDIVRRDWC L+ E G  ++  IL ++ + + +  +I  +L  I + + N  I L  F I K+LT+ P++Y + +  PHV VAL INS GG  K+ +A DTV Y+IC DG++  A+QRAY+ +++      ++  L++D  YYL+ Q+HPVV R+ EPI+ IDA  +A  LGLDPS +    Q   +EAD+         +  R+ DC+     C  C  +   D   E     L      C  C+V    S  D  V +  KL+  I R I  YYS    C+           C    R+L +   +    CP C    +KP  S   L  QL +YR++          LTG + L +K KE  +    Y       + +L  S Y  V+   L   F
Sbjct:   28 RSRREKK-EKVGRKSALEQLKRAKK-GEKVKYEVEEFTSIYDEVDEEQYSKIVRERQDDDWIIDDDGTGYVEDGREIFDEELDDD-ALGPKSKQAAKGGDSKKNVKKSSVS----KPNSIKSMF----------MNSNVKKPAEKHVDLS---QDDLLGDILQDLHSEKSVVLTPPPIITLKKKKTLGSPMNPFSVKPQMPKVKIPIPPADPSPR---SAASVEPSKA-TAAQIKKPKIEEPEEEAIEFDEMDFDEPMEAENLEEEPVKEKAEPETKPIVKVEPKTEPQDKMLISGLVGGMGWEKMEEGKPIETPVEVQVDSS--QLPLVEGPDGDMVFRFYWLDAFEDQYNQPGVVFLFGKVWIESAEAHVSCCVAVKNIERTMYLLPREHKVNLATGEKGVAVGMMDVYKEFNEISEKFKIMKFKSKPVTKNYAFEIPDIPSQSEYLEVKYSAEIPSLPSDLKGTTFSHVFGTNTSSLEHFLLNRKIRGPCWLDVTTPQLSNQPISWCKVEAVAQKSDLISVVKDLSPPPLVVMSISLKTVQNPKTHQNEIVSIAALVHHTFPLDKAPPRPPFQTHFCVVSKPNDCVFPYDFKDAVRKKNGI-----VEIAGTERALLGFFLAKMHKIDPDVLVGHDIFGFDLEVLLQRINVCKVPHWSKIGRLRRA-NMPKLGGRSG--FAEKSATCGRLVCDIEISAKELIRCKSYNLTELVSQIL----KAERPVVPPENIRNFYSDSTHLLYLLELTWMDAKLILQIMCELNVLPLALQITNIAGNVMSRTLMGGRSERNEYLLLHAFHERDFIVPDKQFFKKAQQDLGEDEEGDSGKGKSNKTRKKAAYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVERGATNTRKKTEEDEDEIPELPDQSLEM--GILPKEIRKLVERRRQVKQLMKEPDLNPDLYLQYDIRQKALKLTANSMYGCLGFSFSRFYAKPLAALVTHKGREILMHTKEMVQ------------RMNLEVIYGDTDSIMINTNSTNL---EEVFKLGNKVKSEVNKLYKLLEIDIDGVFKSLLLLKKKKYAALMV--EPQGDGKYTTKQELKGLDIVRRDWCDLAKECGNYVIGQILSDQ-NRDTIIENIQKHLIEIGEKVANGNIPLNMFEIHKSLTKEPQDYPDKKSLPHVHVALWINSQGG--KKVKAGDTVSYVICQDGSNLAASQRAYTLEQL-----QKQPGLNLDTQYYLSQQVHPVVGRICEPIEGIDAVLIATWLGLDPSHFRAQQQQREDEADDFLGAPAQLTDEERYRDCERFTFTCPDCGTENIYDNVFEGTGSTLQLSLKSC--CHVPCGGSPMDHQVQIGNKLQLDIRRHIRRYYSGWLLCE--------DQACRNRIRRLPIAFSRSGPICPACLRSTLKPEYSEKALYNQLSFYRYIFDWEYAINKVLTGDDKLKFKSKEWKEEMEVYKKLKGVTDNILATSGYSEVNLAKLFQAF 1452          
BLAST of DNA polymerase vs. TrEMBL
Match: B1WBE2 (DNA polymerase OS=Xenopus laevis OX=8355 GN=LOC398200 PE=2 SV=1)

HSP 1 Score: 825.083 bits (2130), Expect = 0.000e+0
Identity = 559/1522 (36.73%), Postives = 825/1522 (54.20%), Query Frame = 2
Query:   29 MSEDDTYGRPR-RQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQLDNFIEG--DSEYMESGKEIFDESDEEDI--------KIGPKRKKSMKNANLKNPKKACLDFKSIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNREEIKAPFLSKKKEE--------FKFDIHQPKVISSSK------IKPNEPKEMPQKTVQEPIKFVKKQIVFNKGSSEKNKSPSTIENNETPEQHKIEDC--IVLDDIDFDEPFETN----PVVSAGFATDTK---------LEEHKPLWETEEIEDESSNDKYDPFE------NIDKSSLKLI-----------YWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQ-------------AQMTEVYSEVKSILA-KHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPP-FSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALP-QNSQLEI--DQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPED-LAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKY---HHANQHNEADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSID-----FKMELEKPWLCGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFA--CPRCESGIMKPLLSSSLLNRQLGYYRFLL---------TGKENLSYKQKELLQ-------MCSKYVERVLERSDYMNVDFKSLM 4279
            MS+  ++   R R+  ++K  + + L +LK+AK  G  +K E+E V  IY+ V+E  Y KL   RQ D++I     + Y+E G+EIFD+  E++         K  PK K ++K +++  P      F  + S  +K+    +  S          +L      ++ P       P ++ KK++        F      PKV+ +S        KP  P    + +V   IK   K  + +         P  +E      Q K ED   +  DD DFDEP E +    PV S+   T  +         ++E K  + T    +ES  D+ D  E       +D S L L+           YW DAY D+   PGVV+LFGK   ES   +V+ C+ V  +ER +Y+LP++                M  VY E    +A K+ I   ++K V K YAF+  DVP  ++YL V+Y +  P+LP DL G+TFS +FG NTS LE+F+L  ++KGP WL     + SS   S CK+   +     + + K+ +PP   +LSL++KTV N K++ NEIVAI   +H+   LD+APP   FQ +F +L+   D + PYD N+ +  +  AN    + I   ER+L+   L K+H +DPD+IVGH + G+ L +LLQR  +  +  W K GRL+RS+ +PK+ G S   + ER A  GR++CD+E+SA+ELI+C+SY   +L+ ++L    KA    +P  ++   +N S  +  +++ T  ++   + +M EL VLPLAL+IT I GN++ RTL GG+SERNEYLLLHAF E  +IVPDK      Q + +E   D   +Q    S++K  YAGGLVLEPK G Y+ FILL+DFNSLYPSII EYNICFTT+ R    +    DQ    + +L H  +    GILP EIRKLVE R  VKQL+  P+L+ +  LQ+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT  GREIL++TK++++        K+N    L++IYGDTDS+M+NT   N+   + V K+G  +K E+N+ YK ++++IDG+ + +LLL KKKYA+L V       GK + KQELKGLDIVRRDWC+L+ + G  +++ IL ++  P D +  +I   L  I +++ N  + + ++ I KALT++P++Y + +  PHV VAL INS GG  ++ +A DT+ Y+IC DG++ +A+QRAY+ +++      ++  LSID  YYL+ Q+HPVV R+ EPID ID++ +A  LGLDPS++    H  Q  E D          +  ++ DC+    +C KC  +   D       +++E P L      E   S  D  + V+ KL   I R I  YYS    C+           C    R+L ++  +    C  C    ++       L  QL +YRF+L           ++   + +K+L Q            V++VL RS Y  V+   L 
Sbjct:    1 MSDSGSFAASRSRREKTEKSGRKEALERLKRAKA-GEKVKYEVEQVSSIYEEVDEAEYSKLVRDRQDDDWIVDDDGTGYVEDGREIFDDDLEDNALADSGKGAKGAPKDKTNVKKSSVSKPNNIKSMF--MASAVKKTTDKAVDLSKDDLLGDLLQDLKSQAVPITPP-------PVITLKKKKLAGSPLNPFSVPPTAPKVLPTSVKRLPAVTKPGHPAAQSKASVPRQIKKEPKAELISSAVG-----PLKVE-----AQVKEEDSGMVEFDDGDFDEPMEEDVEITPVDSSTIKTQAQSIKCVKEENIKEEKSSFITSATLNESCWDQIDEAEPMTTEIQVDSSHLPLVTGADGSQVFRFYWLDAYEDQYSQPGVVYLFGKVWIESADAYVSCCVSVKNIERTVYLLPRENRVQLSTGKDTGVPVSMMHVYQEFNEAVAEKYKIMKFKSKKVDKDYAFEIPDVPASSEYLEVRYSADSPQLPQDLKGETFSHVFGTNTSSLELFLLSRKIKGPSWLEIKSPQLSSQPMSWCKVEAVVTRPDQVSVVKDLAPPPVVVLSLSMKTVQNAKTHQNEIVAIAALVHHTFPLDKAPPQPPFQTHFCVLSKLNDCIFPYDYNEAVKQK-NAN----IEIALTERTLLGFFLAKIHKIDPDVIVGHDIYGFDLEVLLQRINSCKVPFWSKIGRLRRSV-MPKLGGRSG--FAERNAACGRIICDIEISAKELIRCKSYHLSELVHQIL----KAERVVIPPENIRNAYNDSVHLLYMLENTWIDAKFILQIMCELNVLPLALQITNIAGNVMSRTLMGGRSERNEYLLLHAFTENNFIVPDKPVFKKMQQTTVEDNDDMGTDQNKNKSRKKAAYAGGLVLEPKVGFYDKFILLLDFNSLYPSIIQEYNICFTTVHREAPSTQKGEDQDE--IPELPHSDLEM--GILPREIRKLVERRRHVKQLMKQPDLNPDLYLQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTHQGREILLHTKEMVQ--------KMN----LEVIYGDTDSIMINTNCNNL---EEVFKLGNRVKSEINKSYKLLEIDIDGIFKSLLLLKKKKYAALTV--EPTGDGKYVTKQELKGLDIVRRDWCELAKQAGNYVISQILSDQ--PRDSIVENIQKKLTEIGENVTNGTVPITQYEINKALTKDPQDYPDKKSLPHVHVALWINSQGG--RKVKAGDTISYVICQDGSNLSASQRAYAQEQL-----QKQENLSIDTQYYLSQQVHPVVARICEPIDGIDSALIAMWLGLDPSQFRAHRHYQQDEENDALLGGPSQLTDEEKYRDCERFKFFCPKCGTENIYDNVFDGSGLQIE-PGLKRCSKPECDASPLDYVIQVHNKLLLDIRRYIKKYYSGWLVCE--------EKTCQNRTRRLPLSFSRNGPICQACSKATLRSEYPEKALYTQLCFYRFILDWDYALEKVVSEQERGHLKKKLFQESENQYKKLKSTVDQVLSRSGYSEVNLSKLF 1451          
BLAST of DNA polymerase vs. TrEMBL
Match: B7ZRF3 (DNA polymerase OS=Xenopus laevis OX=8355 GN=LOC398200 PE=2 SV=1)

HSP 1 Score: 823.928 bits (2127), Expect = 0.000e+0
Identity = 558/1522 (36.66%), Postives = 825/1522 (54.20%), Query Frame = 2
Query:   29 MSEDDTYGRPR-RQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQLDNFIEG--DSEYMESGKEIFDESDEEDI--------KIGPKRKKSMKNANLKNPKKACLDFKSIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNREEIKAPFLSKKKEE--------FKFDIHQPKVISSSK------IKPNEPKEMPQKTVQEPIKFVKKQIVFNKGSSEKNKSPSTIENNETPEQHKIEDC--IVLDDIDFDEPFETN----PVVSAGFATDTK---------LEEHKPLWETEEIEDESSNDKYDPFE------NIDKSSLKLI-----------YWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQ-------------AQMTEVYSEVKSILA-KHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPP-FSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALP-QNSQLEI--DQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPED-LAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKY---HHANQHNEADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSID-----FKMELEKPWLCGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFA--CPRCESGIMKPLLSSSLLNRQLGYYRFL---------LTGKENLSYKQKELLQ-------MCSKYVERVLERSDYMNVDFKSLM 4279
            MS+  ++   R R+  ++K  + + L +LK+AK  G  +K E+E V  IY+ V+E  Y KL   RQ D++I     + Y+E G+EIFD+  E++         K  PK K ++K +++  P      F  + S  +K+    +  S          +L      ++ P       P ++ KK++        F      PKV+ +S        KP  P    + +V   IK   K  + +         P  +E      Q K ED   +  DD DFDEP E +    PV S+   T  +         ++E K  + T    +ES  D+ D  E       +D S L L+           YW DAY D+   PGVV+LFGK   ES   +V+ C+ V  +ER +Y+LP++                M  VY E    +A K+ I   ++K V K YAF+  DVP  ++YL V+Y +  P+LP DL G+TFS +FG NTS LE+F+L  ++KGP WL     + SS   S CK+   +     + + K+ +PP   +LSL++KTV N K++ NEIVAI   +H+   LD+APP   FQ +F +L+   D + PYD N+ +  +  AN    + I   ER+L+   L K+H +DPD+IVGH + G+ L +LLQR  +  +  W K GRL+RS+ +PK+ G S   + ER A  GR++CD+E+SA+ELI+C+SY   +L+ ++L    KA    +P  ++   +N S  +  +++ T  ++   + +M EL VLPLAL+IT I GN++ RTL GG+SERNEYLLLHAF E  +IVPDK      Q + +E   D   +Q    S++K  YAGGLVLEPK G Y+ FILL+DFNSLYPSII EYNICFTT+ R    +    DQ    + +L H  +    GILP EIRKLVE R  VKQL+  P+L+ +  LQ+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT  GREIL++TK++++        K+N    L++IYGDTDS+M+NT   N+   + V K+G  +K E+N+ YK ++++IDG+ + +LLL KKKYA+L V       GK + KQELKGLDIVRRDWC+L+ + G  +++ IL ++  P D +  +I   L  I +++ N  + + ++ I KALT++P++Y + +  PHV VAL INS GG  ++ +A DT+ Y+IC DG++ +A+QRAY+ +++      ++  LSID  YYL+ Q+HPVV R+ EPID ID++ +A  LGLDPS++    H  Q  E D          +  ++ DC+    +C KC  +   D       +++E P L      E   S  D  + V+ KL   I R I  YYS    C+           C    R+L ++  +    C  C    ++       L  QL +YRF+         +  ++   + +K+L Q            V++VL RS Y  V+   L 
Sbjct:    1 MSDSGSFAASRSRREKTEKSGRKEALERLKRAKA-GEKVKYEVEQVSSIYEEVDEAEYSKLVRDRQDDDWIVDDDGTGYVEDGREIFDDDLEDNALADSGKGAKGAPKDKTNVKKSSVSKPNNIKSMF--MASAVKKTTDKAVDLSKDDLLGDLLQDLKSQAVPITPP-------PVITLKKKKLAGSPLNPFSVPPTAPKVLPASVKRLPAVTKPGHPAAQSKASVPRQIKKEPKAELISSAVG-----PLKVE-----AQVKEEDSGMVEFDDGDFDEPMEEDVEITPVDSSTIKTQAQSIKCVKEENIKEEKSSFITSATLNESCWDQIDEAEPMTTEIQVDSSHLPLVTGADGSQVFRFYWLDAYEDQYSQPGVVYLFGKVWIESADAYVSCCVSVKNIERTVYLLPRENRVQLSTGKDTGVPVSMMHVYQEFNEAVAEKYKIMKFKSKKVDKDYAFEIPDVPASSEYLEVRYSADSPQLPQDLKGETFSHVFGTNTSSLELFLLSRKIKGPSWLEIKSPQLSSQPMSWCKVEAVVTRPDQVSVVKDLAPPPVVVLSLSMKTVQNAKTHQNEIVAIAALVHHTFPLDKAPPQPPFQTHFCVLSKLNDCIFPYDYNEAVKQK-NAN----IEIALTERTLLGFFLAKIHKIDPDVIVGHDIYGFDLEVLLQRINSCKVPFWSKIGRLRRSV-MPKLGGRSG--FAERNAACGRIICDIEISAKELIRCKSYHLSELVHQIL----KAERVVIPPENIRNAYNDSVHLLYMLENTWIDAKFILQIMCELNVLPLALQITNIAGNVMSRTLMGGRSERNEYLLLHAFTENNFIVPDKPVFKKMQQTTVEDNDDMGTDQNKNKSRKKAAYAGGLVLEPKVGFYDKFILLLDFNSLYPSIIQEYNICFTTVHREAPSTQKGEDQDE--IPELPHSDLEM--GILPREIRKLVERRRHVKQLMKQPDLNPDLYLQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTHQGREILLHTKEMVQ--------KMN----LEVIYGDTDSIMINTNCNNL---EEVFKLGNRVKSEINKSYKLLEIDIDGIFKSLLLLKKKKYAALTV--EPTGDGKYVTKQELKGLDIVRRDWCELAKQAGNYVISQILSDQ--PRDSIVENIQKKLTEIGENVTNGTVPITQYEINKALTKDPQDYPDKKSLPHVHVALWINSQGG--RKVKAGDTISYVICQDGSNLSASQRAYAQEQL-----QKQENLSIDTQYYLSQQVHPVVARICEPIDGIDSALIAMWLGLDPSQFRAHRHYQQDEENDALLGGPSQLTDEEKYRDCERFKFFCPKCGTENIYDNVFDGSGLQIE-PGLKRCSKPECDASPLDYVIQVHNKLLLDIRRYIKKYYSGWLVCE--------EKTCQNRTRRLPLSFSRNGPICQACSKATLRSEYPEKALYTQLCFYRFIFDWDYALEKVVSEQERGHLKKKLFQESENQYKKLKSTVDQVLSRSGYSEVNLSKLF 1451          
BLAST of DNA polymerase vs. Ensembl Cavefish
Match: ENSAMXT00000007988.2 (pep primary_assembly:Astyanax_mexicanus-2.0:3:18939687:19010256:1 gene:ENSAMXG00000007751.2 transcript:ENSAMXT00000007988.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 740.339 bits (1910), Expect = 0.000e+0
Identity = 513/1427 (35.95%), Postives = 755/1427 (52.91%), Query Frame = 2
Query:   53 RPRRQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQLDNFIEG--DSEYMESGKEIFDESDEEDIK---IGPKRKKSMKNANLKNPKKACLDFKSIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNREEIKAPFLSKKKEEFKFDIHQPKVISSSKIK----PNEPKEMPQKTVQEPIKFVKKQIVFNKGSSEKNKSPSTIENNETPEQHKIEDCIVLDDIDFDEPFETNPVVSAGFATDTKLEEHKPLWETEE---------IEDESSNDKYDPFENIDKSSLKLI-----------YWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQ-------------AQMTEVYSEVKSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLN-FXXXXXXXXXXXXXXSPPFSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAA-ALPQNSQLEIDQSNEQGGKFSKRK---PTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPS---KYHHANQHNEADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSIDFKME----LEKPWLCGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFACPRCESGIMKPLLSSSLLNRQLGYYRFLL 4162
            R RR++  +K+ +   L +LK+AK+ G  +K E+E +  +Y+ V+EE Y K+   RQ D++I     + Y+E G+EIFDE  E+++     G K  K+ K   +  P            +S KS+F                   +   +LS   ++++    L     E K  +  P VI+  K K    P  P  +  +T   P     KQ  F + SS    SP             + D +  D++DFDEP +             + E  +P+ + E            +E   D+      +D S L L+           YW DA+ D+   PGVV+LFGK   ES K  V+ C+ V  +ER +Y LP++                M +VY E  S+  K  I   ++K V K YAF+  DVP + +YL V+Y ++ P+LPSDL G TFS +FG NTS LE  +L  +++GPCWL       SS   S CK+    +K      ++    PP  ++S+++KTV N K++ NEIV++   IH +  LD+APP   +Q +F +++ P D + PYD N+ +  +     K  V I A ER+L+   L K+H +DPD+IVGH ++G+ L +LLQR     +  W K GRL+R+  +PK+ G     + E+ A  GRL+CDVEVSA+ELI+C+SY   +L  ++L    K   + V   ++  +++ S  +  L++LT  ++ + + +M EL VLPLAL+IT I GN++ RTL GG+SERNEYLLLHAF+EK YIVPDK     PQ    E D+  + G   S +      YAGGLVL+PK G Y+ FILL+DFNSLYPSII E+NICFTT+ R    S   T+   + + +L    +    G+LP EIRKLVE R  VKQL+  P+L+ +  LQ+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT  GRE+ +N                     LD+IYGDTDS+M+N+   N+   + VMK+G  +K EVN+ YK ++++IDGV + +LLL KKKYA+L V    +  G+   KQE KGLDIVRRDWC L+ E G  +L  IL ++ + + +  +I  +L  + + + +  I +  F I K    +P++Y + +  PHV VAL INS  G  ++ +A DT+ Y+IC DG++  A+QRAY+P+++      +++ LS+D  YYL+ Q+HPVV R+ EPI+ ID   +A  LGLDP          +  E+D          +  R+ DC+    +C  C  +   D   E    + +P L   C++    S  D  + ++ KL   I R I  YYS    C+                               +   +KP  S   L  QL +YR++ 
Sbjct:   26 RSRREKR-EKVGRKSALEQLKRAKK-GEKIKYEVEDISSVYEEVDEEQYSKMVRDRQDDDWIIDDDGTGYVEDGREIFDEELEDNVAEKGGGSKENKNAKKLAVSKP------------NSIKSMF----------MNSNVKRPAEKDVDLS---KDDLLGDILQDLHSE-KPVLTPPPVITLKKKKALGSPMNPFSVKSQT---PKVIFVKQFCFLRSSS---FSPP------------VGDSLDFDEMDFDEPMDLGAEEQKKVTVKVEAEP-EPIVKVESGMVGGSCWEKMEEEEADEAPVEVQVDSSQLPLVEGPDGEMVFRFYWLDAFEDQYNQPGVVYLFGKVWIESAKAHVSCCVAVKNIERTMYFLPRENKVNLQTGEVTDVPVGMMDVYQEFNSLSEKFKIMKFKSKKVEKNYAFEIPDVPTQCEYLEVRYSAEMPQLPSDLKGTTFSHVFGTNTSSLEHLLLSRKIRGPCWLDIKTPTLSSQPMSWCKVEAIALKSDLISVVKDLTPPPLVVMSISLKTVQNPKTHHNEIVSLAALIHYKFPLDKAPPRVPYQTHFCVVSKPNDCIYPYDFNEAVRKK-----KGIVEIAATERTLLGFFLAKMHKIDPDVIVGHDILGFDLEVLLQRITVCKVPFWSKIGRLRRA-NMPKLGGRGG--FAEKSAACGRLVCDVEVSAKELIRCKSYHLTELAAQIL----KTERAVVAPENIRNMYSDSPHLLYLLELTWMDAKLILQIMCELNVLPLALQITNIAGNVMSRTLMGGRSERNEYLLLHAFHEKNYIVPDKQFFKKPQQDPGE-DEDVDVGKNKSGKVKKKAAYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQREATGSRKKTEDDFNEVPELPDPDLEM--GVLPKEIRKLVERRRQVKQLMKQPDLNSDLYLQYDIRQKALKLTANSMYGCLGFSFSRFYAKPLAALVTHKGREVCMN---------------------LDVIYGDTDSIMINSNSTNL---EEVMKLGNKVKSEVNKLYKLLEIDIDGVFKSLLLLKKKKYAALMV--EQQGDGRYTTKQEFKGLDIVRRDWCDLAKECGNYVLGQILSDQ-NRDTILENIQQHLIEVGEKVASGSIPVNMFEIHK----DPQDYPDKKSLPHVHVALWINSQSG--RKVKAGDTISYVICQDGSNLAASQRAYAPEQL-----QKQQGLSLDNQYYLSQQVHPVVGRICEPIEGIDGVLIATWLGLDPGQFRAQQRQQREEESDGLLGVPAQLTDEERYRDCERFSFFCPDCGTENIYDSVFEGTGSVLEPSLKRCCHIPCGGSPMDHHIKISNKLLLDIRRHIRKYYSGWLVCE-------------------------------DQSTLKPEYSEKALYNQLSFYRYIF 1321          
BLAST of DNA polymerase vs. Ensembl Cavefish
Match: pold1 (DNA polymerase delta 1, catalytic subunit [Source:NCBI gene;Acc:103023852])

HSP 1 Score: 187.963 bits (476), Expect = 9.743e-48
Identity = 184/662 (27.79%), Postives = 310/662 (46.83%), Query Frame = 2
Query: 1700 NSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIER----MATAGRLLCDV-EVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTI---DRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVK-QLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRY-KGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVA--LRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPI 3649
            + +L    E+ L+      +  +DPDII G+ +  + L  LL R  AL +N +   GR++   ++ K +   +     R    +   GR+  D+ +V  R+  K RSY    +    L E+ +    S+ + DL     +    ++L    L ++ + + L+ +L  +   +E+  + G  +   LS G+  +    LL    ++  ++P                   +GG+       Y G  V+EP+KG Y   I  +DF+SLYPSI++ +N+C+TT+    +   L +   D       DL  KS  +  G+LP  +  L+ AR   K +L    +  K+++L  D RQ ALKI+ANS+YG  G    +    +++  VT  GR+++  TK+++E   +K +          ++YGDTDSVMV  G+  V +    M +G+   E V+  +   I+L  + V    LL+NKK+YA L   S  +   K+    + KG++ VRRD C L       ++   L++ L   D   ++ +  + ISD + N +I + + +ITK LTR  + Y+  Q   HV++A  +R   AG +       D V Y+I        A  ++  P  VL      E  + ID  YYL  QL   + R+ EPI
Sbjct:  370 SQILCFTQEKQLLQSWAEFVRTVDPDIITGYNIQNFDLPYLLNRAAALKVNLFPYLGRVRGIKSILKDSSFQSKQMGRRENKTVNMEGRVQFDLLQVLLRDY-KLRSYTLNAVSFHFLQEQKEDVQHSI-ITDLQN--GNEQTRRRLAVYCLKDAYLPLRLLQKLMCVINYMEMARVTGVPLTYLLSRGQQIKVVSQLLRQAMKQDLVMP---------------VVKTEGGE------DYTGATVIEPEKGYYSIPIATLDFSSLYPSIMMAHNLCYTTLLQKGQADKLGLSAEDFIRTPTGDLFVKSSVR-KGLLPEILENLLSARKRAKAELKKETDPFKKQVL--DGRQLALKISANSVYGFTGAQVGKLPCLEISQSVTGFGRQMIEQTKQLVE---SKYTIANGYKADAKVVYGDTDSVMVKLGVDTVQE---AMTVGREAAEWVSSHFVPPIKLEFEKVYHPYLLINKKRYAGLYFSSSAEHHDKM----DCKGIETVRRDNCPLVAN----LINTCLQKILIDRDPDGAVAHAKEVISDLLCN-RIDISQLVITKELTRTAQEYAGRQA--HVELAERMRKRDAGSAPN---LGDRVPYVIIKAAKGVAAYMKSEDPIYVL------ENNIPIDTQYYLEQQLSKPLMRIFEPI 977          
BLAST of DNA polymerase vs. Ensembl Cavefish
Match: pold1 (DNA polymerase delta 1, catalytic subunit [Source:NCBI gene;Acc:103023852])

HSP 1 Score: 187.578 bits (475), Expect = 1.266e-47
Identity = 184/662 (27.79%), Postives = 310/662 (46.83%), Query Frame = 2
Query: 1700 NSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIER----MATAGRLLCDV-EVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTI---DRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVK-QLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRY-KGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVA--LRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPI 3649
            + +L    E+ L+      +  +DPDII G+ +  + L  LL R  AL +N +   GR++   ++ K +   +     R    +   GR+  D+ +V  R+  K RSY    +    L E+ +    S+ + DL     +    ++L    L ++ + + L+ +L  +   +E+  + G  +   LS G+  +    LL    ++  ++P                   +GG+       Y G  V+EP+KG Y   I  +DF+SLYPSI++ +N+C+TT+    +   L +   D       DL  KS  +  G+LP  +  L+ AR   K +L    +  K+++L  D RQ ALKI+ANS+YG  G    +    +++  VT  GR+++  TK+++E   +K +          ++YGDTDSVMV  G+  V +    M +G+   E V+  +   I+L  + V    LL+NKK+YA L   S  +   K+    + KG++ VRRD C L       ++   L++ L   D   ++ +  + ISD + N +I + + +ITK LTR  + Y+  Q   HV++A  +R   AG +       D V Y+I        A  ++  P  VL      E  + ID  YYL  QL   + R+ EPI
Sbjct:  387 SQILCFTQEKQLLQSWAEFVRTVDPDIITGYNIQNFDLPYLLNRAAALKVNLFPYLGRVRGIKSILKDSSFQSKQMGRRENKTVNMEGRVQFDLLQVLLRDY-KLRSYTLNAVSFHFLQEQKEDVQHSI-ITDLQN--GNEQTRRRLAVYCLKDAYLPLRLLQKLMCVINYMEMARVTGVPLTYLLSRGQQIKVVSQLLRQAMKQDLVMP---------------VVKTEGGE------DYTGATVIEPEKGYYSIPIATLDFSSLYPSIMMAHNLCYTTLLQKGQADKLGLSAEDFIRTPTGDLFVKSSVR-KGLLPEILENLLSARKRAKAELKKETDPFKKQVL--DGRQLALKISANSVYGFTGAQVGKLPCLEISQSVTGFGRQMIEQTKQLVE---SKYTIANGYKADAKVVYGDTDSVMVKLGVDTVQE---AMTVGREAAEWVSSHFVPPIKLEFEKVYHPYLLINKKRYAGLYFSSSAEHHDKM----DCKGIETVRRDNCPLVAN----LINTCLQKILIDRDPDGAVAHAKEVISDLLCN-RIDISQLVITKELTRTAQEYAGRQA--HVELAERMRKRDAGSAPN---LGDRVPYVIIKAAKGVAAYMKSEDPIYVL------ENNIPIDTQYYLEQQLSKPLMRIFEPI 994          
BLAST of DNA polymerase vs. Ensembl Cavefish
Match: pold1 (DNA polymerase delta 1, catalytic subunit [Source:NCBI gene;Acc:103023852])

HSP 1 Score: 141.739 bits (356), Expect = 1.633e-33
Identity = 126/402 (31.34%), Postives = 199/402 (49.50%), Query Frame = 2
Query: 2465 MDFNSLYPSIILEYNICFTTI---DRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVK-QLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRY-KGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVA--LRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPI 3649
            +DF+SLYPSI++ +N+C+TT+    +   L +   D       DL  KS  +  G+LP  +  L+ AR   K +L    +  K+++L  D RQ ALKI+ANS+YG  G    +    +++  VT  GR+++  TK+++E   +K +          ++YGDTDSVMV  G+  V +    M +G+   E V+  +   I+L  + V    LL+NKK+YA L   S  +   K+    + KG++ VRRD C L       ++   L++ L   D   ++ +  + ISD + N +I + + +ITK LTR  + Y+  Q   HV++A  +R   AG +       D V Y+I            AY   EV S    E   +     YYL  QL   + R+ EPI
Sbjct:  582 LDFSSLYPSIMMAHNLCYTTLLQKGQADKLGLSAEDFIRTPTGDLFVKSSVRK-GLLPEILENLLSARKRAKAELKKETDPFKKQVL--DGRQLALKISANSVYGFTGAQVGKLPCLEISQSVTGFGRQMIEQTKQLVE---SKYTIANGYKADAKVVYGDTDSVMVKLGVDTVQE---AMTVGREAAEWVSSHFVPPIKLEFEKVYHPYLLINKKRYAGLYFSSSAEHHDKM----DCKGIETVRRDNCPLVAN----LINTCLQKILIDRDPDGAVAHAKEVISDLLCN-RIDISQLVITKELTRTAQEYAGRQA--HVELAERMRKRDAGSAPN---LGDRVPYVIIKAAKGVA----AYMKSEVGSVFLYESDPIY----YYLEQQLSKPLMRIFEPI 952          
BLAST of DNA polymerase vs. Ensembl Cavefish
Match: rev3l (REV3 like, DNA directed polymerase zeta catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-050302-55])

HSP 1 Score: 110.538 bits (275), Expect = 1.076e-23
Identity = 151/680 (22.21%), Postives = 268/680 (39.41%), Query Frame = 2
Query: 1718 ANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMAT---AGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNIC----LMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYI--VPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRC--KYLSVGDTDQ------AMHILMDLSHK-----------------SVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQH--DIRQKALKITANSMYG--CLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVN-RRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLI 3640
            A E+ L   + N +   DPDI+VG+ +     G LLQR  AL ++   +  R+       + T   +    + M+     GR+  ++    +      +Y   ++   +L ++F  +        L   F+    + +     +D  +  +C    L+ +  ++    E   + G      L+ G   R E ++L       YI   P       Q +   I                    LV+EP+   Y N ++++DF SLYPSI++ YN CF+T   C     S+G +D+      ++ +  DL ++                 SV K  G+LP  + ++++ R  VK ++   +   +K L    D RQ  LK+ AN  +G     FS  R  + ++   +    RE L    K++ +                ++YGDTDS+ V        Q     KIG  I E V     K I+L  + V    +L  KK+Y      + D+         + KG++ VRRD C    ++ +R + ++ E      D++  +  Y++     +   K S+      K   R   +Y      P +++  R+ S    + + R  + V Y+I          Q    P EVL     ++  L ++  YY+  Q+ P V R+ 
Sbjct: 2119 AEEKELFEEVCNIMRRYDPDILVGYEVQMRSWGYLLQRASALGVDLCQQLSRVPGDAKENRFTADKDEYGADTMSEIHIVGRITINLWRIMKTEAALNNYSFENVAFHLLHQRFPLYSPRT----LSDWFDHKTHLYRW--KVVDHYVSRVCGVVQLLRQQDIVGRTSEFARVFGIQFYHVLTRGSQYRVESMMLRVAKPMNYIPVTPSTQQRAQQRAPQCI-------------------PLVMEPESRFYSNSVVVLDFQSLYPSIVIAYNYCFST---CLGHVESLGTSDEFRFGCTSLRVPPDLLYQLRNDITVSPNGIAFVKASVRK--GVLPRMLEEILQTRFMVKGVMK--SYRDDKALHRLLDARQLGLKLIANVTFGYTSANFS-GRMPSVEVGDSIVHKARETLERAIKLVNE---------TKKWGARVVYGDTDSMFVLLKGATKEQ---AFKIGHEIAEAVTATNPKPIKLKFEKVYLPCVLQTKKRYVGYMYETVDQKDPVF----DAKGIETVRRDGCPAVAKILERSVKLLFET----RDISL-VKQYVQRQCVKVLEAKASMQDLTFAKEY-RGSGSYRPGACIPALELTRRMMSYDRRL-EPRVGERVPYVIVYGTPGVPLIQLVRRPLEVL-----QDPSLRLNATYYITKQILPPVARIF 2737          
BLAST of DNA polymerase vs. Ensembl Sea Lamprey
Match: pold1 (polymerase (DNA directed), delta 1, catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-060429-1])

HSP 1 Score: 167.933 bits (424), Expect = 3.165e-42
Identity = 178/651 (27.34%), Postives = 302/651 (46.39%), Query Frame = 2
Query: 1766 LDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIER----MATAGRLLCDV-EVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPP------------GILPIEIRKLVEARN---AVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAAL-VTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRY-KGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAG-GSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPI 3649
            +DPDII G+ +  + L  LL R   L ++T+   GR+    ++ K +   +     R    +   GR+  D+ +V  R+  K RSY    +    L E+ +    S+ + DL     +    ++L    L ++++ + L+ +L  +   +E+  + G  +   L+ G+  +    LL    ++  ++P      P+ ++                   YAG  V+EP KG Y   I  +DF+SLYPSI++ +N+C+TT+     L  G  +      + LS +   K P            G+LP  +  L+ AR    A ++L N  +  K+K+L  D RQ ALKI+ANS+YG  G    +    +++   VT  GR+++  TK ++E   ++ + +        +IYGDTDSVMV   +  V +    M++G+     V+  +   I+L  + V    LL+NKK+YA L   S  ++  K+    + KG++ VRRD   L       ++   L++ L   D   ++ +   +ISD + N +I + + +ITK LTR  + Y+  Q   HV++A R+     GS       D V Y+I        A  ++  P  VL      E  + ID  YYL  QL   + R+ EPI
Sbjct:  400 VDPDIITGYNIQNFDLPYLLNRASTLRVSTFSFLGRITSMRSVIKESSFQSKQMGRRDNKVINLEGRVTFDLLQVLLRDY-KLRSYTLNAVSFHFLQEQKEDVQHSI-ITDLQN--GNEQTRRRLAVYCLKDAMLPLRLLEKLMCVINYMEMARVTGVPLSYLLTRGQQIKVVSQLLRQAMKQDLLLP---VVKPEGNE------------------DYAGATVIEPIKGYYTVPIATLDFSSLYPSIMMAHNLCYTTL-----LQKGVVEN-----LGLSAEDFIKTPSGDHFVKSSVRKGLLPEILENLLSARKKRRAKEELKNETDPFKQKVL--DGRQLALKISANSVYGFTGAQVGKLPCLEISQQSVTGFGRQMIETTKNLVE---SRYTTENGQKADAKVIYGDTDSVMVKFSVKTVAEG---MEMGREAAAWVSSHFIPPIKLEFEKVYYPYLLINKKRYAGLYFSSSSETHDKM----DCKGIETVRRDNSPLV----ANLINTCLQKILIDRDPDGAVDHAKDTISDLLCN-RIDISQLVITKELTRTADEYAGKQA--HVELAERMRKRDPGSAPNL--GDRVPYVIVKATKGVAAYMKSEDPIYVL------ENNIPIDTQYYLEQQLAKPLLRIFEPI 988          
BLAST of DNA polymerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006446.1 (pep scaffold:Pmarinus_7.0:GL477096:156518:193524:1 gene:ENSPMAG00000005826.1 transcript:ENSPMAT00000006446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 6.870e-13
Identity = 69/281 (24.56%), Postives = 119/281 (42.35%), Query Frame = 2
Query: 1718 ANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSW--IERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGI--KQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTT-IDRCKYL 2545
            + E  L   L   +H  DPDI++G+ +     G LLQR  AL  +      R+K      ++    N        +   GR++ ++    R  +    Y   ++   +L E++  F        L   F++  G    +++D  +   + NI L+++L  +    E+  + G      LS G   R E ++L       YI     A  P   Q    ++ E               LV+EP+   Y + +L++DF SLYPSII+ YN C++T + R ++L
Sbjct:   88 SKEDQLFHELEQIVHRFDPDILLGYEVQMLSWGYLLQRAAALKRDFKSTISRMKVEPTETQVGVGKNEEDDDFPDIHIGGRVVLNLWSQMRSEVTLNIYSFENVAYHVLHERYPLFNFRT----LSDWFDNKTGPFRWKMVDYYVCRVVGNIKLLNQLDFIGRTSELARLFGIQFHEVLSRGSQFRVESMMLRVAKPLNYI-----AVSPSVQQRAHMRAAE------------CLPLVMEPESRFYSSPVLVLDFQSLYPSIIIAYNYCYSTCLGRVEHL 347          
BLAST of DNA polymerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009864.1 (pep scaffold:Pmarinus_7.0:GL480102:12343:24944:1 gene:ENSPMAG00000008922.1 transcript:ENSPMAT00000009864.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 6.065e-9
Identity = 79/349 (22.64%), Postives = 152/349 (43.55%), Query Frame = 2
Query: 2618 GILPIEIRKLVEARNAVKQLLNN--PNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKG-IQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDM 3655
            G+LP  + ++++ R  VK  + +   + +  +LL    RQ  LK+ AN  +G   ++ + F + ++  +    G  I+   ++ +E    +++          ++YGDTDS+ V     +  Q     + G+ I   V       I+L  + V    +L  KK+Y      S ++         + KG++ VRRD C    +V +R + ++ +E    +D++  +  Y++     +   + S+   I  K   R    Y      P + VA R+  A     + RA + V Y+I +        Q    P+E+L     +E  L I+  YY++ Q+ P + RL+  I +
Sbjct:   10 GVLPRMLEEILQTRIMVKHCMKDYRGDGALTRLLH--ARQLGLKLIANVTFG---YTAAHF-SGRMPCVEEQVGDSIVHKARETLERAIKQVNETKEWGA--RVVYGDTDSMFVLLEGASKEQ---AFRTGKEIAAAVTAANPSPIKLKFEKVYLPCVLQTKKRYVGYMYESLEQKDPVY----DAKGIETVRRDGCPAVAKVLERSIKLLFDE----KDIS-RVKQYVQRQCMKILEGRASMQDLIFAKEY-RGRSGYKPGACVPALHVARRMF-ACDRRSEPRAGERVPYVIVHGAPGLPLIQLVRRPQELL-----QEPSLLINAPYYVSKQILPPLDRLLSLIGV 331          
BLAST of DNA polymerase vs. Ensembl Yeast
Match: POL1 (Catalytic subunit of the DNA polymerase I alpha-primase complex; required for the initiation of DNA replication during mitotic DNA synthesis and premeiotic DNA synthesis [Source:SGD;Acc:S000005046])

HSP 1 Score: 478.789 bits (1231), Expect = 5.648e-145
Identity = 375/1186 (31.62%), Postives = 595/1186 (50.17%), Query Frame = 2
Query:  785 PFETNPVVSAGFATDTKLEEHKPLWETEEIEDESSNDKYDPFENIDKSSLKLIYWFDAYHDKKIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQAQMTEVYSEVKSILA-KHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPE-----LPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSS-NQFSTCKLNFXXXXXXXXXXXXXXS-PPFSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGR-LKRSIALPKITGHSNTSWIERMAT---AGRLLCDV--EVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLM-----HELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGK--FSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPP-----GILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICN--------DGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKYHH---ANQHNEADNTYSKQEST-DEANRFIDCKPLPIYCRKCQHK------TSIDFKMELEKPWLCGNCNVELLYSHADAVNVNKKLKEIIDRIIHIYYSCISTCQ---CGYICRGMVNICNEEARKLLMTTGQFACPRCESGIMKPLLSSSLLNRQLGYYRFLLTGKENLSYKQKEL 4201
            PF T P    G      L   K L    ++   + N K +   + +  + ++ +W D     ++   + LFGK + +     V+  ++++GL R ++ LP++    T+++ E+  +L  K+G++++R KP   KY+F+  D+P E+DYL V    + P+     +PSDLS  TF  +FG N++  E F++  R+ GPCWL   G + +S    S C +   +   + I     K+ P    LSL+I+T+MN K N  EIV+I    +  I LD   P  +  ++   L  P            LA+         V +  NE++++SC    L   DPD+I+GH L    L +L  R   LNI T+   GR L+R+   P+  G  N++      +   +GRL+CD+  E+      KC+S++  ++ Q    ++ K               NS       + + L E++ N C++     + +Q+L L  ++T + GN   +TL G ++ RNEY+LLH F+   +IVPDK       S+ +  + NE+      + +K  Y GGLV EP+KGL++N++L+MDFNSLYPSII E+NICFTT+DR K     D D+   +           PP     G+LP  +  LV+ R  VK+++        K +Q DIRQ+ALK+TANSMYGCLG+  SRF A  LA LVT  GREIL+NT+++ E            ++ L ++YGDTDSVM++TG  N   Y   +KIG   K  VN RY+ ++++ID V +++LL  KKKYA+L V      +G  +L  E+KGLD+ RR++C LS +V   +L  IL ++  PE+    +++YL+ I   +    I + K+ I   L+++P+ Y   +  P VQVALR+  AG  +K   A   + ++I          D  + +  +RA++  EV+  S      L  D  YYL  Q+   V RL+E ID  +   ++E LGLD  KY      N + E  N     E+T  +  RF D   L + C  C  +       S ++         C +C  E L++    + +  +++  I   I +YY+    C    CG + R  V++      K  +  G   C    +G+M+   S   L  QL Y+  L   ++N   K++EL
Sbjct:  306 PFVTAPGTPIGIKG---LTPSKSLQSNTDVATLAVNVKKEDVVDPETDTFQM-FWLDYC---EVNNTLILFGKVKLKD-DNCVSAMVQINGLCRELFFLPREGKTPTDIHEEIIPLLMDKYGLDNIRAKPQKMKYSFELPDIPSESDYLKVLLPYQTPKSSRDTIPSDLSSDTFYHVFGGNSNIFESFVIQNRIMGPCWLDIKGADFNSIRNASHCAVEVSVDKPQNITPTTTKTMPNLRCLSLSIQTLMNPKENKQEIVSITLSAYRNISLDSPIPENIKPDDLCTLVRPPQST---SFPLGLAALAKQKLPGRVRLFNNEKAMLSCFCAMLKVEDPDVIIGHRLQNVYLDVLAHRMHDLNIPTFSSIGRRLRRT--WPEKFGRGNSNMNHFFISDICSGRLICDIANEMGQSLTPKCQSWDLSEMYQVTCEKEHKPLDIDYQNPQYQNDVNS-------MTMALQENITN-CMISAEVSYRIQLLTLTKQLTNLAGNAWAQTLGGTRAGRNEYILLHEFSRNGFIVPDKEG---NRSRAQKQRQNEENADAPVNSKKAKYQGGLVFEPEKGLHKNYVLVMDFNSLYPSIIQEFNICFTTVDRNK----EDIDELPSV-----------PPSEVDQGVLPRLLANLVDRRREVKKVMKT-ETDPHKRVQCDIRQQALKLTANSMYGCLGYVNSRFYAKPLAMLVTNKGREILMNTRQLAE------------SMNLLVVYGDTDSVMIDTGCDN---YADAIKIGLGFKRLVNERYRLLEIDIDNVFKKLLLHAKKKYAALTVNLDKNGNGTTVL--EVKGLDMKRREFCPLSRDVSIHVLNTILSDK-DPEEALQEVYDYLEDIRIKVETNNIRIDKYKINMKLSKDPKAYPGGKNMPAVQVALRMRKAGRVVK---AGSVITFVITKQDEIDNAADTPALSVAERAHALNEVMIKSNN----LIPDPQYYLEKQIFAPVERLLERIDSFNVVRLSEALGLDSKKYFRREGGNNNGEDINNLQPLETTITDVERFKDTVTLELSCPSCDKRFPFGGIVSSNYYRVSYNGLQCKHC--EQLFT---PLQLTSQIEHSIRAHISLYYAGWLQCDDSTCGIVTR-QVSVFG----KRCLNDG---C----TGVMRYKYSDKQLYNQLLYFDSLFDCEKN---KKQEL 1406          
BLAST of DNA polymerase vs. Ensembl Yeast
Match: POL3 (Catalytic subunit of DNA polymerase delta; required for chromosomal DNA replication during mitosis and meiosis, intragenic recombination, repair of double strand DNA breaks, and DNA replication during nucleotide excision repair (NER) [Source:SGD;Acc:S000002260])

HSP 1 Score: 197.208 bits (500), Expect = 1.545e-51
Identity = 195/661 (29.50%), Postives = 305/661 (46.14%), Query Frame = 2
Query: 1706 VLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIER----MATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVG------DTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARN-AVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDG-CAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYK-GIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPI 3649
            +   A E  ++S   N +  +DPD+I+G+    + +  LL R +AL +N +  FGRLK      K +  S+ ++  R    +   GRL  D+    +   K RSY    +    L E+ K  V    + DL      S   ++L    L ++ + + LM +L  L    E+  + G      L+ G+  +    L     E   ++P+        SQ   DQ              Y G  V+EP +G Y+  I  +DFNSLYPSI++ +N+C+TT+  C   +V       D D  +    D    +  +  GILPI + +L+ AR  A K L +  +  K  +L    RQ ALKI+ANS+YG  G +  +     +++ VT +GR +++ TK  +++  C K   K +  V    +YGDTDSVMV  G  ++ +    M +G    + V+  +K  I L  +      LL+NKK+YA L   + DK       K + KGL  VRRD C L   V  ++L  IL E      LAF     ++   +D+ + ++ + K II+K L     NY+NP  QPH  +A R+    G        D V+Y+I   G ++    RA  P  VL      E  + +D  YYL +QL   +  ++ PI
Sbjct:  373 IFSHATEEEMLSNWRNFIIKVDPDVIIGYNTTNFDIPYLLNRAKALKVNDFPYFGRLKTVKQEIKESVFSSKAYGTRETKNVNIDGRLQLDLLQFIQREYKLRSYTLNAVSAHFLGEQ-KEDVHYSIISDLQN--GDSETRRRLAVYCLKDAYLPLRLMEKLMALVNYTEMARVTGVPFSYLLARGQQIKVVSQLFRKCLEIDTVIPN------MQSQASDDQ--------------YEGATVIEPIRGYYDVPIATLDFNSLYPSIMMAHNLCYTTL--CNKATVERLNLKIDEDYVITPNGDY-FVTTKRRRGILPIILDELISARKRAKKDLRDEKDPFKRDVLNG--RQLALKISANSVYGFTGATVGKLPCLAISSSVTAYGRTMILKTKTAVQEKYCIKNGYKHDAVV----VYGDTDSVMVKFGTTDLKE---AMDLGTEAAKYVSTLFKHPINLEFEKAYFPYLLINKKRYAGLFWTNPDKFD-----KLDQKGLASVRRDSCSLVSIVMNKVLKKILIERNVDGALAF-----VRETINDILHNRVDISKLIISKTLA---PNYTNP--QPHAVLAERMKRREGVGPN--VGDRVDYVII--GGNDKLYNRAEDPLFVL------ENNIQVDSRYYLTNQLQNPIISIVAPI 973          
BLAST of DNA polymerase vs. Ensembl Yeast
Match: REV3 (Catalytic subunit of DNA polymerase zeta; involved in translesion synthesis during post-replication repair; required for mutagenesis induced by DNA damage; involved in double-strand break repair; forms a complex with Rev7p, Pol31p and Pol32p [Source:SGD;Acc:S000006088])

HSP 1 Score: 122.479 bits (306), Expect = 2.330e-28
Identity = 158/677 (23.34%), Postives = 288/677 (42.54%), Query Frame = 2
Query: 1706 VLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALN-INTWYKFGRLKRSIA--LPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIV--PDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTT-IDRCKYLSVGDTDQAM-------HILMDLSHKSVAKPPGIL--PIEIRK---------LVEARNAVKQLLN---NPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQS-RFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRY-KGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPI 3649
            V+   +E  +   L + +  LDPDI+ G  +  +  G +++RCQ ++  +   +  R+K  I   L    G++++S I  M T GR + ++  + R  +    Y        +L ++   F S   + ++     S+  +K +++  L  + +NI L+ +   +   +E   + G         G   + E  L+     + +I+  P K                       K+K      LV+EP+   Y++ ++++DF SLYPSI++ YN C++T I R + +++ + +  +       +IL  L +     P G++     +RK         +++ R  +K+ +N   + N + ++LL +  +Q ALK+ AN  YG    S S R   + LA  +   GRE L     IIE          +      ++YGDTDS+ V        +      IG  + E V +   K I L  + V    +L++KK+Y   +     +S  + +   + KG++ VRRD     I   ++I+   +      +DL+  I  YL++    ++  K+S   F   K +               V V  RIN    +  QY  K+ + Y++      +   +R  SP+E L     E   L +D  YY+   L P + RL   I
Sbjct:  739 VMFYESEFEMFEALTDLVLLLDPDILSGFEIHNFSWGYIIERCQKIHQFDIVRELARVKCQIKTKLSDTWGYAHSSGI--MIT-GRHMINIWRALRSDVNLTQYTIESAAFNILHKRLPHF-SFESLTNMWNAKKSTTELKTVLNYWLSRAQINIQLLRKQDYIARNIEQARLIGIDFHSVYYRGSQFKVESFLIRICKSESFILLSPGKKDV-------------------RKQKALECVPLVMEPESAFYKSPLIVLDFQSLYPSIMIGYNYCYSTMIGRVREINLTENNLGVSKFSLPRNILALLKNDVTIAPNGVVYAKTSVRKSTLSKMLTDILDVRVMIKKTMNEIGDDNTTLKRLLNN--KQLALKLLANVTYGYTSASFSGRMPCSDLADSIVQTGRETLEKAIDIIEK---------DETWNAKVVYGDTDSLFVYLPGKTAIE---AFSIGHAMAERVTQNNPKPIFLKFEKVYHPSILISKKRYVGFSY----ESPSQTLPIFDAKGIETVRRD----GIPAQQKIIEKCIRLLFQTKDLS-KIKKYLQNEFFKIQIGKVSAQDFCFAKEVKLGAYKSEKTAPAGAVVVKRRINEDHRAEPQY--KERIPYLVVKGKQGQLLRERCVSPEEFL-----EGENLELDSEYYINKILIPPLDRLFNLI 1362          
BLAST of DNA polymerase vs. Ensembl Nematostella
Match: EDO39342 (DNA polymerase [Source:UniProtKB/TrEMBL;Acc:A7SAB6])

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 414/1174 (35.26%), Postives = 612/1174 (52.13%), Query Frame = 2
Query:  941 IYWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQ------------AQMTEVYSEV-KSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPPFSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKN-SVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKIT------GHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNK--KKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTS---ETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKYHHA--NQHNEADNTYSKQESTDEANRFIDCKPLPIYCRK--CQHKTSIDFKMELEK------PWLCGNC-NVELLYSHADAVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARK--LLMTTGQFACPRCESGIMKPLLSSSLLNRQLGYY-------RFLLTGKEN-------LSYKQ-----KELLQMCSKYVERVLERSDYMNVDFKSLMAKF 4288
             YWFDAY D+ K PGVV+LFGK + ES  K+V+ C+ +  ++R I++LP+++                +VY E  + I +K+ I     + V K YAF   D+P  ++YL V+Y   + +                                  WLS          F  C L F +             P   I +L++KT+MN++++  E++A+   +H E+ +D+A P   FQ  F +L       M   L+      W    ++  + + A+ER+L++ ++ K+H +DPD++VGH + G+ L ILL R  A  I  W + GRLKRSI +PK+       GH+    ++   T GRLLCDV++S+RELI+ +SY+  +L + +L    +         D+  ++N+S  +  L++LT  +SL+ + +M+EL VLPLA +IT I GN++ RTL GG+S+RNE+LLLHAF+EK YI PDK+    Q  + E D  +    K  +RKP YAGGLVLEPKKG Y+ FILL+DFNSLYPSII EYNICFTTIDR    S  D +  +  L D+      + PGILP EIRKLVE R  VK ++   +   +K LQ+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT  GREIL+ TK +++             + LD+IYGDTDS+M+NT   N      V K+G  ++         + L +   +R + LL+    +YA++ +   +   G +   +E+KGLDIVRRDWC L+ + G  +L+ IL  + S E +  ++H++L +I +D++  K+ L K++I K LT+ P +Y + +  PHV VAL + S     ++    DT+ Y+IC+        T     +     L  + T    L + + Y +++        + +PID  D++ +AE LGLDPS Y HA     +EAD     Q    +  RF DC  L + C++  C  +T+I+   EL K      P L   C   E LYS A  +N    L  II + I  YY+    C+           C+   R+  L+   G   CP C    M P+ S + L  QL +Y       R L T K+N        SY +     K         ++R++E + Y  VD   L   F
Sbjct:  188 FYWFDAYEDRIKQPGVVYLFGKVKIESAGKYVSCCVTIKNIDRNIFILPREKRIGADGSESENSVGFKDVYEEFNEKIASKNKIMKFVCRKVEKSYAFDIEDIPTSSEYLEVRYSVVWSQ---------------------------------TWLSL-------QWFPNC-LWFSM------------EPDQVIHNLSMKTLMNSRTHTQEVLAVSALVHQEVAVDKAAPKDKFQYRFCVLVSS----MMMHLHIFFTDFWHCIPQHLKIDVMASERALLAFVVAKIHKIDPDVLVGHDIFGFDLDILLHRISACKIPQWSRIGRLKRSI-MPKVRLSLGRGGHN----VDPTVTCGRLLCDVKISSRELIRSKSYDLSELSRVVLQTPRQELDQD----DIGNMYNTSQELLHLLELTTVDSLLTLRIMYELNVLPLAHQITTIAGNVLSRTLLGGRSKRNEFLLLHAFHEKGYICPDKSYGKKQVVR-EDDDDHVTTTKKGRRKPAYAGGLVLEPKKGFYDKFILLLDFNSLYPSIIQEYNICFTTIDR---KSAKDEEDDIVDLPDMD-----QDPGILPTEIRKLVERRRQVKGMMKTVSRDSDKYLQYDIRQKALKLTANSMYGCLGFSHSRFYAKPLAALVTSKGREILMKTKDLVQ------------QMHLDVIYGDTDSIMINT---NSTDLQEVKKVGNKVRHP---HATYLVLPVSYTLRFVNLLHILFSRYAAIMI--SENEDGTMNEVKEMKGLDIVRRDWCDLAKDAGNYVLSQILSAQ-SREAIVDNVHDFLITIGEDVKGGKVDLQKYVINKQLTKAPHDYPDKKSLPHVHVALWLMSKS---RKVGVGDTIPYVICDVSMHLPLVTCGALVHYLLRYLWRTCTLSLTLPVTHVYTISY--------ISDPIDGTDSARIAECLGLDPSGYRHAATRHDDEADALLGGQAQMTDEERFKDCVRLVLKCKQPGCDQQTTIE---ELCKDASARTPLLSALCPGCEKLYSPATVIN---HLTVIIRKHIKEYYAGWQRCEDPS--------CDHRTRQVPLMHHRGTPTCPNCHRAHMLPVYSDTALYNQLLFYGRLFDADRALKTLKDNGGKDFLLKSYLKENKIVKSFYTDVHTALQRIIEANAYSEVDLAKLFKTF 1240          

HSP 2 Score: 54.299 bits (129), Expect = 4.116e-7
Identity = 30/76 (39.47%), Postives = 48/76 (63.16%), Query Frame = 2
Query:  140 LKQEIEVEDIYDVVNEETYEKLKEKRQLDNFI---EGDSEYMESGKEIFDES-DEEDIKIGPKRKKSMKNANLKNP 355
            + Q   V+D+Y VV+EE Y  +  +RQ ++++   +G   Y+E G+EIFD+  DEE+++ GPK K   K  N+K P
Sbjct:    5 IAQVGSVKDVYRVVDEEEYSDIVRQRQEEDWVVDDDGAGGYVEDGREIFDDDLDEEEVQKGPKHKP--KKQNVKKP 78          
BLAST of DNA polymerase vs. Ensembl Nematostella
Match: EDO49294 (DNA polymerase [Source:UniProtKB/TrEMBL;Acc:A7RH52])

HSP 1 Score: 200.29 bits (508), Expect = 4.878e-52
Identity = 208/755 (27.55%), Postives = 333/755 (44.11%), Query Frame = 2
Query: 1706 VLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIER----MATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMD--LSHKSVAKPPGILPIEIRKLVEARNAVK-QLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRY-KGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKYHHANQHNEADNTYSKQES-TDEANRFIDCKPL-----PIYCRKCQHKTSIDFKMELE----------KPWL-CGNCNVEL 3895
            VL    E  L       +   DPDII G+ ++ + L  LL R  AL++N +   GR+    +    T   + ++ +R    +  +GR+  D+        K RSY    +    L E+ K  V    + DL    + +   ++L    + ++++ + L+ +L  +   +E+  + G  +   LS G+  +    LL   ++   ++P   A           ++ E+          YAG  V+EP KG Y   I  +DF+SLYPSI++ +N+C+T++     +     DQ +          KSV K  G+LP  +  L+ AR   K  L    +  K+K+L  D RQ ALKI+ANS+YG  G    +    +++  VT  GR ++  TK+++E   AK +          +IYGDTDSVMV  G+  V +    M++G    E V+  + K I+L  + V    LL++KK+YA L     DK       K + KG++ VRRD C L   +    L  +L E  +P+        Y K +  D+   +I + + +ITK LT+  E Y+  Q    +   +R   AG + K     D V Y+I        A ++A  P  VL      E  + ID  YYL +QL   + R+ EPI  +  S  +  L     K  H        +T  K    T + +  I CK L        C+ C+ + S  F+ E+E          + W  C NC   L
Sbjct:  358 VLSFDKEADLFKAWSEFVQECDPDIITGYNIVNFDLPYLLNRATALHVNNFSLLGRIVADKSTVTSTTFQSKAYGKRENKVINISGRVQFDLLHVLLRDYKLRSYTLNAVSFHFLQEQ-KEDVQHNIISDLQNGNDQTR--RRLAIYCMKDAILPLRLLEKLMCVINYMEMARVTGVPMGYLLSRGQQIKVMSQLLRKTHQTDLVIPAHKA-----------EAGEE----------YAGATVIEPNKGYYNIPIATLDFSSLYPSIMMAHNLCYTSLLHPSQVKETPPDQYIKTPSGNFFVKKSVRK--GLLPEILEHLLTARKKAKADLKKETDPFKKKVL--DGRQLALKISANSVYGFTGAQVGKLPCLEISQSVTAFGRMMIERTKELVE---AKYTVANGYKTDAKVIYGDTDSVMVRFGVETVAE---SMELGNEAAEYVSEHFVKPIKLEFEKVYFPYLLISKKRYAGLYFTKPDKHD-----KMDCKGIETVRRDNCPLVANLINACLKKLLIER-NPQGAV----EYTKQVISDLLCNRIDISQLVITKELTKTGEEYAGKQAHSELAERMRKRDAGSAPK---LGDRVPYVIIAGAKGAKAYEKAEDPIYVL------ENNVPIDTGYYLENQLSKPLLRIFEPI--LGESKASSAL----LKGEHTRTKTIVTSTVGKLSMFTKKRSTCIGCKALLDDDGSAVCKHCKSRESELFQKEIEHLRVLEERFARLWTQCQNCTGSL 1053          
BLAST of DNA polymerase vs. Ensembl Nematostella
Match: EDO27819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T875])

HSP 1 Score: 155.221 bits (391), Expect = 4.124e-42
Identity = 97/261 (37.16%), Postives = 153/261 (58.62%), Query Frame = 2
Query: 3011 IKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLG--LDPSKYHH-ANQHN-EADNTYSKQESTDEANRF 3781
            +K EVN+ Y+ ++++IDG+ + +LLL KKKYA++ +   +   G +   +E+KGLDIVRRDWC L+ + G  +L+ IL  + S E +  ++H++L +I +D++  K+ L K++I K LT+ P +Y + +  PHV VAL + S     ++    DT+ Y+IC+                +L   R  +  L ID  YYLA+Q+HPVV RL +PID  D++ +AE LG  L PS Y H A +H+ EAD    +     +  RF
Sbjct:    1 MKSEVNKLYRLLEIDIDGIFKSMLLLKKKKYAAIMI--SENEDGTMNEVKEMKGLDIVRRDWCDLAKDAGNYVLSQILSAQ-SREAIVDNVHDFLITIGEDVKGGKVDLQKYVINKQLTKAPHDYPDKKSLPHVHVALWLMSKS---RKVGVGDTIPYVICDVSMHLPLVTCGALVHYLLHEFRKSD-SLKIDTKYYLANQVHPVVARLCDPIDGTDSARIAECLGGILHPSGYRHAATRHDEEADALLGRHAQMTDEERF 254          
BLAST of DNA polymerase vs. Ensembl Nematostella
Match: EDO42056 (DNA polymerase [Source:UniProtKB/TrEMBL;Acc:A7S2J9])

HSP 1 Score: 107.457 bits (267), Expect = 4.362e-24
Identity = 124/528 (23.48%), Postives = 211/528 (39.96%), Query Frame = 2
Query: 1724 ERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMAT----AGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQL--IDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTT-IDRCKYLSVGDTDQAMHILMDLSHKSVAKPP--------------------------GILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQS-RFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMV-NTGIGNVYQYDTVMKIGQLIKEEVN-RRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWC 3199
            E+ L   LL      DPD+++G+ +     G L+QR    +++   K  R+  S +   +    +  W    A+    AGR++ +V    R  +    Y   ++   +L E+   F    P   L   ++    + +   +   +     N+ L+ +L  +    E+  + G L    +S G   R E ++L       YI     AA P      + Q N      S R P     LVLEP+   Y + +L++DF SLYPS+++ YN C++T + R   ++ G               S+++PP                          G+LP  +  ++  R  VK  +     +K      D RQ  LK+ AN  YG    + S R    ++A  +    RE L     ++ +  +K   +        ++YGDTDS+ V   G+      D   +IG  I E V  +  K ++L  + V    +L  KK+Y      + D+         + KG++ VRRD C
Sbjct:    6 EKDLFPALLGLFREWDPDVLIGYEVQMLSWGYLIQRALVFDLDLASKLARVSGSSSSSNMDSEKD-QWGAAHASEIKIAGRIVLNVWRLMRHEVTLNVYSFENVAFHVLHERIPLF----PYRSLSDWWDHKTDMHRWRTVQHYVTRCCGNVRLLEQLDFIGRTSELARLFGILFYSVISRGSQFRVESMMLRIAKPMNYI-----AASPS-----VQQRN------SMRAPEVIP-LVLEPESRFYHHPVLVLDFQSLYPSMMIAYNYCYSTCLGRVSSIAEGSH-------FKFGALSLSEPPSLLKQLERDIHISPNGVAFVKSNVRRGVLPRMLEDILNTRIMVKNSMKKWKDNKSTYRMLDARQLGLKLIANVTYGYTSANFSGRMPCVEIADSIVRKARETLERAIDLV-NTTSKWGAR--------VVYGDTDSLFVLLKGVSK----DEAFRIGHEITETVTAQNPKPVKLKFEKVYLPCVLQTKKRYVGYMYETADQKEAVF----DAKGIETVRRDTC 487          
BLAST of DNA polymerase vs. Ensembl Medaka
Match: pola1 (DNA polymerase alpha 1, catalytic subunit [Source:NCBI gene;Acc:101165771])

HSP 1 Score: 809.29 bits (2089), Expect = 0.000e+0
Identity = 554/1524 (36.35%), Postives = 812/1524 (53.28%), Query Frame = 2
Query:   53 RPRRQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQLDNFIEGD--SEYMESGKEIFDESDEEDI--------KIGPKRKKSMK---------------NANLKNPKKACLDFK--SIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNREEIKAPFLSKKKEEFKFDIHQPKVISSSKIKPNEPKEMPQ-----KTVQEPIKFVKKQIV----FNKGSSEKNKSPSTIENNETPEQHKIEDCIVLDDIDFDEPFETNPVV-----SAGFATDTKLEEHK------PL-------WETEEIEDESSNDKYDPFENIDKSSLKLI-----------YWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKD-------------QAQMTEVYSEVKSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLN-FXXXXXXXXXXXXXXSPPFSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQ---GGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPP---GILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKYHHANQHN---EADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSIDFKMELE----KPWLCGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFA--CPRCESGIMKPLLSSSLLNRQLGYYRFL----------LTGKENLSYK----QKELLQMCSKYVERVLERSDYMNVDFKSLMAKFS 4291
            R RR++  +K+ +   L +LKKAK  G  +K ++E    +Y+ V+EE Y KL ++RQ D++I  D  + Y+E G+EIFD+  ++D+          G + KK++K               N+N+K P +  +D     +  D  + L S  P                  A L+ P       P ++ KK   K  +  P  ++   I+   PKE P      KTV+ P   ++          K S +  K     E N         D + LD++DFDEP ET P +     +    +  K+E  K      PL       W  EE   E+         ++D S L L+           YW DA+ D    PGVV+LFGK   +S K  V+ C+ V  +ER IY+LP++                M +VY E   +  K  +   ++K V K YAF+  DVP++ +YL +QY ++FP LP DL G TFS IFG NTS LE F+L  ++KGPCWL     +      S CK+    ++G     ++    PP +++S+++KTV N K++ NEIV++   +H   ++D+APP   +QN F +++ P D + PYD  + L  + G      V I + ER+L+   L K+H +DPD++VGH + G+ L +LLQR     +  W K GRL+R+  +PK+ G     + E+ AT GRL+CDVE+SA+ELI+C+SY   +L  ++L    K    +VP  ++  L++ S  +  L++LT  ++ + + +M EL VLPLAL+IT I GN++ RTL GG+SERNEYLLLHAF++K YIVPDK +   + +QLE+    E    G    K+K  Y+GGLVL+PK G Y+ F+LL+DFNSLYPSII E+NICFTT+ R       ++ +            +  P    GILP EIRKLVE R  VKQL+   +++ +  +Q+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT  GREIL++TK +++        K+N    L++IYGDTDS+M+NT   N    + V K+G  +K EVN+ YK ++++IDGV + +LLL KKKYA+L  V      G+  +KQELKGLDIVRRDWC L+ E G  ++  IL ++ S + +  +I  +L  + + + N  I L  + I KALT++P++Y + +  PHV VAL INS GG  ++ +A DT+ Y+IC DG++  A+QRAY+ +++      ++  LS+D  YYLA Q+HPVV R+ EPI+ ID   +A  LGLDPS +    QH    EAD          +  R+ DC+     C  C      D   E      +P L   C++       D  V+++ KL   I R I  YYS    C+           C    R+L +   +    CP C    ++P  S   L  QL +YRF+          LT +E L       QKE+ +   +  E+ L  S Y  V+   L   FS
Sbjct:   29 RSRREKR-EKVGRKSALEQLKKAKM-GEKIKYKVEEFSHVYEEVDEEQYSKLVQERQEDDWIIDDDGTGYVEDGREIFDDDLDDDVVEKRGKGGAKGAESKKTVKKAAVTKPNTIKSLFMNSNVKKPAEKDIDLSKDDLLGDILQDLHSEKP------------------AVLAPP-------PVITLKK---KKSLGSP--MNPFSIRHQMPKESPMTGLKAKTVRPPPAELRPPACPSPPLEKSSEKVEKPKEEEEEN---------DSLALDEVDFDEPMETEPEIKEETEAEAAPSVPKVEPKKEPLSPAPLPSRVGGHWGQEE---ETGASDVPAEVHVDSSQLPLVEGEDGEPAFRFYWLDAFEDPYNQPGVVYLFGKVWIQSAKSHVSCCVTVKNIERTIYLLPREYKTNPKTGEVSGEPVGMMDVYQEFSELSEKFKVMKFKSKKVEKNYAFEIPDVPNQCEYLQIQYSAEFPALPPDLKGATFSHIFGTNTSSLEHFLLSRKIKGPCWLDIKTPQMMHQPVSWCKVEVLALRGDTISLVKDLPPPPLTVMSISLKTVQNPKTHHNEIVSLAALLHYGFHMDKAPPQTPYQNYFCVISKPADCIFPYDFKEALRKKNG-----KVEIASTERTLLGFFLAKMHKIDPDVLVGHDIFGFDLEVLLQRINVCKVPHWSKIGRLRRA-NMPKLGGRG--LFAEKNATCGRLVCDVEISAKELIRCKSYHLTELAAQVL----KVERVTVPQEEVKNLYSDSPHLLYLLELTWTDAKLILQIMCELNVLPLALQITNIAGNVLSRTLMGGRSERNEYLLLHAFHDKNYIVPDKPSF--KKAQLEMGDGEEDVDAGKGKRKKKAAYSGGLVLDPKVGFYDQFVLLLDFNSLYPSIIQEFNICFTTVQR----EAQNSRRKREEDESEEIPEIPDPGLEMGILPKEIRKLVERRKQVKQLMKQQDINPDLYMQYDIRQKALKLTANSMYGCLGFSFSRFYAKPLAALVTHKGREILMHTKDMVQ--------KMN----LEVIYGDTDSIMINT---NSKSLEEVFKLGNKVKAEVNKLYKLLEIDIDGVFKSLLLLKKKKYAAL--VVEHHGDGRYSVKQELKGLDIVRRDWCDLAKECGNYVIGQILSDQ-SRDIIVENIQKHLVEVGERVANGDIPLNLYEIHKALTKDPQDYPDKKSLPHVHVALWINSQGG--RRVKAGDTISYLICKDGSTLAASQRAYALEQL-----QKQEGLSVDTQYYLAQQIHPVVSRICEPIEGIDGVLIATWLGLDPSHFRSHQQHQREEEADGMLGAPVQLTDEERYRDCERFTFTCPSCGTDNIYDNVFEGAGNKVEPGLMRCCHIPCQSRPIDHPVHISNKLLLDIRRHIKKYYSGWLVCE--------DQACQNRTRRLPIAFSRHGPICPACSRATLRPEYSEKALYNQLCFYRFIFDWEHAFSKVLTQEERLLVNQMKMQKEVYRKLKEVPEKALAASGYSEVNLAKLFQAFS 1457          
BLAST of DNA polymerase vs. Ensembl Medaka
Match: pola1 (DNA polymerase alpha 1, catalytic subunit [Source:NCBI gene;Acc:101165771])

HSP 1 Score: 808.52 bits (2087), Expect = 0.000e+0
Identity = 554/1524 (36.35%), Postives = 812/1524 (53.28%), Query Frame = 2
Query:   53 RPRRQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQLDNFIEGD--SEYMESGKEIFDESDEEDI--------KIGPKRKKSMK---------------NANLKNPKKACLDFK--SIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNREEIKAPFLSKKKEEFKFDIHQPKVISSSKIKPNEPKEMPQ-----KTVQEPIKFVKKQIV----FNKGSSEKNKSPSTIENNETPEQHKIEDCIVLDDIDFDEPFETNPVV-----SAGFATDTKLEEHK------PL-------WETEEIEDESSNDKYDPFENIDKSSLKLI-----------YWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKD-------------QAQMTEVYSEVKSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLN-FXXXXXXXXXXXXXXSPPFSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQ---GGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPP---GILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKYHHANQHN---EADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSIDFKMELE----KPWLCGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFA--CPRCESGIMKPLLSSSLLNRQLGYYRFL----------LTGKENLSYK----QKELLQMCSKYVERVLERSDYMNVDFKSLMAKFS 4291
            R RR++  +K+ +   L +LKKAK  G  +K ++E    +Y+ V+EE Y KL ++RQ D++I  D  + Y+E G+EIFD+  ++D+          G + KK++K               N+N+K P +  +D     +  D  + L S  P                  A L+ P       P ++ KK   K  +  P  ++   I+   PKE P      KTV+ P   ++          K S +  K     E N         D + LD++DFDEP ET P +     +    +  K+E  K      PL       W  EE   E+         ++D S L L+           YW DA+ D    PGVV+LFGK   +S K  V+ C+ V  +ER IY+LP++                M +VY E   +  K  +   ++K V K YAF+  DVP++ +YL +QY ++FP LP DL G TFS IFG NTS LE F+L  ++KGPCWL     +      S CK+    ++G     ++    PP +++S+++KTV N K++ NEIV++   +H   ++D+APP   +QN F +++ P D + PYD  + L  + G      V I + ER+L+   L K+H +DPD++VGH + G+ L +LLQR     +  W K GRL+R+  +PK+ G     + E+ AT GRL+CDVE+SA+ELI+C+SY   +L  ++L    K    +VP  ++  L++ S  +  L++LT  ++ + + +M EL VLPLAL+IT I GN++ RTL GG+SERNEYLLLHAF++K YIVPDK +   + +QLE+    E    G    K+K  Y+GGLVL+PK G Y+ F+LL+DFNSLYPSII E+NICFTT+ R       ++ +            +  P    GILP EIRKLVE R  VKQL+   +++ +  +Q+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT  GREIL++TK +++        K+N    L++IYGDTDS+M+NT   N    + V K+G  +K EVN+ YK ++++IDGV + +LLL KKKYA+L  V      G+  +KQELKGLDIVRRDWC L+ E G  ++  IL ++ S + +  +I  +L  + + + N  I L  + I KALT++P++Y + +  PHV VAL INS GG  ++ +A DT+ Y+IC DG++  A+QRAY+ +++      ++  LS+D  YYLA Q+HPVV R+ EPI+ ID   +A  LGLDPS +    QH    EAD          +  R+ DC+     C  C      D   E      +P L   C++       D  V+++ KL   I R I  YYS    C+           C    R+L +   +    CP C    ++P  S   L  QL +YRF+          LT +E L       QKE+ +   +  E+ L  S Y  V+   L   FS
Sbjct:   25 RSRREKR-EKVGRKSALEQLKKAKM-GEKIKYKVEEFSHVYEEVDEEQYSKLVQERQEDDWIIDDDGTGYVEDGREIFDDDLDDDVVEKRGKGGAKGAESKKTVKKAAVTKPNTIKSLFMNSNVKKPAEKDIDLSKDDLLGDILQDLHSEKP------------------AVLAPP-------PVITLKK---KKSLGSP--MNPFSIRHQMPKESPMTGLKAKTVRPPPAELRPPACPSPPLEKSSEKVEKPKEEEEEN---------DSLALDEVDFDEPMETEPEIKEETEAEAAPSVPKVEPKKEPLSPAPLPSRVGGHWGQEE---ETGASDVPAEVHVDSSQLPLVEGEDGEPAFRFYWLDAFEDPYNQPGVVYLFGKVWIQSAKSHVSCCVTVKNIERTIYLLPREYKTNPKTGEVSGEPVGMMDVYQEFSELSEKFKVMKFKSKKVEKNYAFEIPDVPNQCEYLQIQYSAEFPALPPDLKGATFSHIFGTNTSSLEHFLLSRKIKGPCWLDIKTPQMMHQPVSWCKVEVLALRGDTISLVKDLPPPPLTVMSISLKTVQNPKTHHNEIVSLAALLHYGFHMDKAPPQTPYQNYFCVISKPADCIFPYDFKEALRKKNG-----KVEIASTERTLLGFFLAKMHKIDPDVLVGHDIFGFDLEVLLQRINVCKVPHWSKIGRLRRA-NMPKLGGRG--LFAEKNATCGRLVCDVEISAKELIRCKSYHLTELAAQVL----KVERVTVPQEEVKNLYSDSPHLLYLLELTWTDAKLILQIMCELNVLPLALQITNIAGNVLSRTLMGGRSERNEYLLLHAFHDKNYIVPDKPSF--KKAQLEMGDGEEDVDAGKGKRKKKAAYSGGLVLDPKVGFYDQFVLLLDFNSLYPSIIQEFNICFTTVQR----EAQNSRRKREEDESEEIPEIPDPGLEMGILPKEIRKLVERRKQVKQLMKQQDINPDLYMQYDIRQKALKLTANSMYGCLGFSFSRFYAKPLAALVTHKGREILMHTKDMVQ--------KMN----LEVIYGDTDSIMINT---NSKSLEEVFKLGNKVKAEVNKLYKLLEIDIDGVFKSLLLLKKKKYAAL--VVEHHGDGRYSVKQELKGLDIVRRDWCDLAKECGNYVIGQILSDQ-SRDIIVENIQKHLVEVGERVANGDIPLNLYEIHKALTKDPQDYPDKKSLPHVHVALWINSQGG--RRVKAGDTISYLICKDGSTLAASQRAYALEQL-----QKQEGLSVDTQYYLAQQIHPVVSRICEPIEGIDGVLIATWLGLDPSHFRSHQQHQREEEADGMLGAPVQLTDEERYRDCERFTFTCPSCGTDNIYDNVFEGAGNKVEPGLMRCCHIPCQSRPIDHPVHISNKLLLDIRRHIKKYYSGWLVCE--------DQACQNRTRRLPIAFSRHGPICPACSRATLRPEYSEKALYNQLCFYRFIFDWEHAFSKVLTQEERLLVNQMKMQKEVYRKLKEVPEKALAASGYSEVNLAKLFQAFS 1453          
BLAST of DNA polymerase vs. Ensembl Medaka
Match: pola1 (DNA polymerase alpha 1, catalytic subunit [Source:NCBI gene;Acc:101165771])

HSP 1 Score: 793.882 bits (2049), Expect = 0.000e+0
Identity = 548/1524 (35.96%), Postives = 801/1524 (52.56%), Query Frame = 2
Query:   53 RPRRQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIE-VEDIYDVVNEETYEKLKEKRQLDNFIEGD--SEYMESGKEIFDESDEEDI--------KIGPKRKKSMK---------------NANLKNPKKACLDFK--SIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNREEIKAPFLSKKKEEFKFDIHQPKVISSSKIKPNEPKEMPQ-----KTVQEPIKFVKKQIV----FNKGSSEKNKSPSTIENNETPEQHKIEDCIVLDDIDFDEPFETNPVV-----SAGFATDTKLEEHK------PL-------WETEEIEDESSNDKYDPFENIDKSSLKLI-----------YWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKD-------------QAQMTEVYSEVKSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLN-FXXXXXXXXXXXXXXSPPFSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQ---GGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPP---GILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKYHHANQHN---EADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSIDFKMELE----KPWLCGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFA--CPRCESGIMKPLLSSSLLNRQLGYYRFL----------LTGKENLSYK----QKELLQMCSKYVERVLERSDYMNVDFKSLMAKFS 4291
            R RR++  +K+ +   L +LKKAK  G  +K ++E    +Y+ V+EE Y KL ++RQ D++I  D  + Y+E G+EIFD+  ++D+          G + KK++K               N+N+K P +  +D     +  D  + L S  P                  A L+ P       P ++ KK   K  +  P  ++   I+   PKE P      KTV+ P   ++          K S +  K     E N         D + LD++DFDEP ET P +     +    +  K+E  K      PL       W  EE   E+         ++D S L L+           YW DA+ D    PGVV+LFGK   +S K  V+ C+ V  +ER IY+LP++                M +VY E   +  K  +   ++K V K YAF+  DVP++ +YL +QY ++FP LP DL G TFS IFG NTS LE F+L  ++KGPCWL     +      S CK+    ++G     ++    PP +++S+++KTV N K++ NEIV++   +H   ++D+APP   +QN F +++ P D + PYD  + L  + G      V I + ER+L+   L K+H +DPD++VGH + G+ L +LLQR     +  W K GRL+R+  +PK+ G     + E+ AT GRL+CDVE+SA+ELI+C+SY   +L  ++L    K    +VP  ++  L++ S  +  L++LT  ++ + + +M EL VLPLAL+IT I GN++ RTL GG+SERNEYLLLHAF++K YIVPDK +   + +QLE+    E    G    K+K  Y+GGLVL+PK G Y+ F+LL+DFNSLYPSII E+NICFTT+ R       ++ +            +  P    GILP EIRKLVE R  VKQL+   +++ +  +Q+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT  GRE+                        L++IYGDTDS+M+NT   N    + V K+G  +K EVN+ YK ++++IDGV + +LLL KKKYA+L  V      G+  +KQELKGLDIVRRDWC L+ E G  ++  IL ++ S + +  +I  +L  + + + N  I L  + I KALT++P++Y + +  PHV VAL INS GG  ++ +A DT+ Y+IC DG++  A+QRAY+ +++      ++  LS+D  YYLA Q+HPVV R+ EPI+ ID   +A  LGLDPS +    QH    EAD          +  R+ DC+     C  C      D   E      +P L   C++       D  V+++ KL   I R I  YYS    C+           C    R+L +   +    CP C    ++P  S   L  QL +YRF+          LT +E L       QKE+ +   +  E+ L  S Y  V+   L   FS
Sbjct:   25 RSRREKR-EKVGRKSALEQLKKAKM-GEKIKYKVEEFSHVYEEVDEEQYSKLVQERQEDDWIIDDDGTGYVEDGREIFDDDLDDDVVEKRGKGGAKGAESKKTVKKAAVTKPNTIKSLFMNSNVKKPAEKDIDLSKDDLLGDILQDLHSEKP------------------AVLAPP-------PVITLKK---KKSLGSP--MNPFSIRHQMPKESPMTGLKAKTVRPPPAELRPPACPSPPLEKSSEKVEKPKEEEEEN---------DSLALDEVDFDEPMETEPEIKEETEAEAAPSVPKVEPKKEPLSPAPLPSRVGGHWGQEE---ETGASDVPAEVHVDSSQLPLVEGEDGEPAFRFYWLDAFEDPYNQPGVVYLFGKVWIQSAKSHVSCCVTVKNIERTIYLLPREYKTNPKTGEVSGEPVGMMDVYQEFSELSEKFKVMKFKSKKVEKNYAFEIPDVPNQCEYLQIQYSAEFPALPPDLKGATFSHIFGTNTSSLEHFLLSRKIKGPCWLDIKTPQMMHQPVSWCKVEVLALRGDTISLVKDLPPPPLTVMSISLKTVQNPKTHHNEIVSLAALLHYGFHMDKAPPQTPYQNYFCVISKPADCIFPYDFKEALRKKNG-----KVEIASTERTLLGFFLAKMHKIDPDVLVGHDIFGFDLEVLLQRINVCKVPHWSKIGRLRRA-NMPKLGGRG--LFAEKNATCGRLVCDVEISAKELIRCKSYHLTELAAQVL----KVERVTVPQEEVKNLYSDSPHLLYLLELTWTDAKLILQIMCELNVLPLALQITNIAGNVLSRTLMGGRSERNEYLLLHAFHDKNYIVPDKPSF--KKAQLEMGDGEEDVDAGKGKRKKKAAYSGGLVLDPKVGFYDQFVLLLDFNSLYPSIIQEFNICFTTVQR----EAQNSRRKREEDESEEIPEIPDPGLEMGILPKEIRKLVERRKQVKQLMKQQDINPDLYMQYDIRQKALKLTANSMYGCLGFSFSRFYAKPLAALVTHKGREM-----------------------NLEVIYGDTDSIMINT---NSKSLEEVFKLGNKVKAEVNKLYKLLEIDIDGVFKSLLLLKKKKYAAL--VVEHHGDGRYSVKQELKGLDIVRRDWCDLAKECGNYVIGQILSDQ-SRDIIVENIQKHLVEVGERVANGDIPLNLYEIHKALTKDPQDYPDKKSLPHVHVALWINSQGG--RRVKAGDTISYLICKDGSTLAASQRAYALEQL-----QKQEGLSVDTQYYLAQQIHPVVSRICEPIEGIDGVLIATWLGLDPSHFRSHQQHQREEEADGMLGAPVQLTDEERYRDCERFTFTCPSCGTDNIYDNVFEGAGNKVEPGLMRCCHIPCQSRPIDHPVHISNKLLLDIRRHIKKYYSGWLVCE--------DQACQNRTRRLPIAFSRHGPICPACSRATLRPEYSEKALYNQLCFYRFIFDWEHAFSKVLTQEERLLVNQMKMQKEVYRKLKEVPEKALAASGYSEVNLAKLFQAFS 1442          
BLAST of DNA polymerase vs. Ensembl Medaka
Match: pola1 (DNA polymerase alpha 1, catalytic subunit [Source:NCBI gene;Acc:101165771])

HSP 1 Score: 772.696 bits (1994), Expect = 0.000e+0
Identity = 481/1245 (38.63%), Postives = 702/1245 (56.39%), Query Frame = 2
Query:  749 DCIVLDDIDFDEPFETNPVV-----SAGFATDTKLEEHK------PLWETEEIEDESSNDKYDPFE-NIDKSSLKLI-----------YWFDAYHDK-KIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQAQ-------MTEVYSEVKSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLN-FXXXXXXXXXXXXXXSPPFSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNS-VLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPP------GILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPIDMIDASTVAEHLGLDPSKYHHANQHN---EADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSIDFKMELE----KPWLCGNCNVELLYSHAD-AVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFA--CPRCESGIMKPLLSSSLLNRQLGYYRFL----------LTGKEN----LSY-KQKELLQMCSKYVERVLERSDYMNVDFKSLMAKFS 4291
            D + LD++DFDEP ET P +     +    +  K+E  K      PL      ++E +     P E ++D S L L+           YW DA+ D    PGVV+LFGK   +S K  V+ C+ V  +ER IY+LP++          M +VY E   +  K  +   ++K V K YAF+  DVP++ +YL +QY ++FP LP DL G TFS IFG NTS LE F+L  ++KGPCWL     +      S CK+    ++G     ++    PP +++S+++KTV N K++ NEIV++   +H   ++D+APP   +QN F   +   D++               N++N  V I + ER+L+   L K+H +DPD++VGH + G+ L +LLQR     +  W K GRL+R+  +PK+ G     + E+ AT GRL+CDVE+SA+ELI+C+SY   +L  ++L    K    +VP  ++  L++ S  +  L++LT  ++ + + +M EL VLPLAL+IT I GN++ RTL GG+SERNEYLLLHAF++K YIVPDK +   + +QLE+  + ++    +++K  Y+GGLVL+PK G Y+ F+LL+DFNSLYPSII E+NICFTT+ R          +A +       + + + P      GILP EIRKLVE R  VKQL+   +++ +  +Q+DIRQKALK+TANSMYGCLGFS SRF A  LAALVT  GREIL++TK +++        K+N    L++IYGDTDS+M+NT   N    + V K+G  +K EVN+ YK ++++IDGV + +LLL KKKYA+L  V      G+  +KQELKGLDIVRRDWC L+ E G  ++  IL ++ S + +  +I  +L  + + + N  I L  + I KALT++P++Y + +  PHV VAL INS GG  ++ +A DT+ Y+IC DG++  A+QRAY+ +++      ++  LS+D  YYLA Q+HPVV R+ EPI+ ID   +A  LGLDPS +    QH    EAD          +  R+ DC+     C  C      D   E      +P L   C++       D  V+++ KL   I R I  YYS    C+           C    R+L +   +    CP C    ++P  S   L  QL +YRF+          LT +E      SY K K LL     +V++ L  S Y  V+   L   FS
Sbjct:  266 DSLALDEVDFDEPMETEPEIKEETEAEAAPSVPKVEPKKEPLSPAPLVGGHWGQEEETGASDVPAEVHVDSSQLPLVEGEDGEPAFRFYWLDAFEDPYNQPGVVYLFGKVWIQSAKSHVSCCVTVKNIERTIYLLPREYVSATVFPVGMMDVYQEFSELSEKFKVMKFKSKKVEKNYAFEIPDVPNQCEYLQIQYSAEFPALPPDLKGATFSHIFGTNTSSLEHFLLSRKIKGPCWLDIKTPQMMHQPVSWCKVEVLALRGDTISLVKDLPPPPLTVMSISLKTVQNPKTHHNEIVSLAALLHYGFHMDKAPPQTPYQNYFCGESPVLDFLT-------------LNFRNGKVEIASTERTLLGFFLAKMHKIDPDVLVGHDIFGFDLEVLLQRINVCKVPHWSKIGRLRRA-NMPKLGGRG--LFAEKNATCGRLVCDVEISAKELIRCKSYHLTELAAQVL----KVERVTVPQEEVKNLYSDSPHLLYLLELTWTDAKLILQIMCELNVLPLALQITNIAGNVLSRTLMGGRSERNEYLLLHAFHDKNYIVPDKPSF--KKAQLEMVGTFKK----TRKKAAYSGGLVLDPKVGFYDQFVLLLDFNSLYPSIIQEFNICFTTVQR----------EAQNSRRKREVEEIPEIPDPGLEMGILPKEIRKLVERRKQVKQLMKQQDINPDLYMQYDIRQKALKLTANSMYGCLGFSFSRFYAKPLAALVTHKGREILMHTKDMVQ--------KMN----LEVIYGDTDSIMINT---NSKSLEEVFKLGNKVKAEVNKLYKLLEIDIDGVFKSLLLLKKKKYAAL--VVEHHGDGRYSVKQELKGLDIVRRDWCDLAKECGNYVIGQILSDQ-SRDIIVENIQKHLVEVGERVANGDIPLNLYEIHKALTKDPQDYPDKKSLPHVHVALWINSQGG--RRVKAGDTISYLICKDGSTLAASQRAYALEQL-----QKQEGLSVDTQYYLAQQIHPVVSRICEPIEGIDGVLIATWLGLDPSHFRSHQQHQREEEADGMLGAPVQLTDEERYRDCERFTFTCPSCGTDNIYDNVFEGAGNKVEPGLMRCCHIPCQSRPIDHPVHISNKLLLDIRRHIKKYYSGWLVCE--------DQACQNRTRRLPIAFSRHGPICPACSRATLRPEYSEKALYNQLCFYRFIFDWEHAFSKVLTQEERRKPKFSYTKLKPLLS----FVKKALAASGYSEVNLAKLFQAFS 1437          
BLAST of DNA polymerase vs. Ensembl Medaka
Match: pold1 (DNA polymerase delta 1, catalytic subunit [Source:NCBI gene;Acc:101155199])

HSP 1 Score: 183.726 bits (465), Expect = 1.868e-46
Identity = 188/671 (28.02%), Postives = 314/671 (46.80%), Query Frame = 2
Query: 1700 NSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIER----MATAGRLLCDV-EVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPP------------GILPIEIRKLVEARNAVK-QLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYK-GIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCKISLGKFIITKALTRNPENYSNPQGQPHVQVA--LRINSAGGSIKQYRAKDTVEYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVVCRLIEPI 3649
            + +L    E+ L+      L  +DPDII G+ +  +    L+ R  AL +  +   GR++   ++ K +   +     R    +   GR+  D+ +V  R+  K RSY    +    L E+ +    S+ + DL     +    ++L    L ++ + + L+ +L  +   +E+  + G  +   LS G+  +    LL               A+ QN  + + ++  +GG+       Y G  V+EP+KG Y   I  +DF+SLYPSI++ +N+C+TT+     L  G  ++     + LS +   K P            G+LP  +  L+ AR   K +L    +  K+++L  D RQ ALKI+ANS+YG  G    +    +++  VT  GR+++  TK+++E     ISN    +    +IYGDTDSVMV  G+  V +    M+IG+   E V+  +   I+L  + V    LL+NKK+YA L   S   +  K+    + KG++ VRRD C L       ++   L++ L   D   ++ +  + ISD + N +I + + +ITK LTR  + Y+  Q   HV++A  +R   AG +       D V Y+I        A  ++  P  VL      E  + ID  YYL  QL   + R+ EPI
Sbjct:  372 SQILCFTQEKQLLQSWAEFLRTVDPDIITGYNIQNFDFPYLINRAAALKVTYFPYLGRVRNMKSVLKESNFQSKQMGRRENKTINMEGRVQFDLLQVLLRDY-KLRSYTLNAVSFHFLQEQKEDVQHSI-ISDLQN--GNEQTRRRLAVYCLKDAYLPLRLLQKLMCVINYMEMARVTGVPLSYLLSRGQQIKVVSQLLRQ-------------AMKQNLVMPVVKT--EGGE------DYTGATVIEPEKGYYSVPITTLDFSSLYPSIMMAHNLCYTTL-----LQKGSVER-----LQLSSEDFIKTPTGDQFVKSSVRKGLLPEILENLLSARKRAKAELKKETDPFKKQVL--DGRQLALKISANSVYGFTGAQVGKLPCLEISQSVTGFGRQMIERTKQLVESKYT-ISNGYQADAK--VIYGDTDSVMVKLGVATVKE---AMEIGREAAEWVSSHFTPPIKLEFEKVYYPYLLINKKRYAGLYFSSSADTHDKM----DCKGIETVRRDNCPLV----ANLINTCLQKILIDRDPQGAVDHAKEVISDLLCN-RIDISQLVITKELTRTAQEYAGKQA--HVELAERMRKRDAGSAPN---LGDRVPYVIIKAAKGAAAYMKSEDPIYVL------ENTIPIDTQYYLEQQLSKPLLRIFEPI 979          
BLAST of DNA polymerase vs. Planmine SMEST
Match: SMESG000079687.1 (SMESG000079687.1)

HSP 1 Score: 2010.73 bits (5208), Expect = 0.000e+0
Identity = 1017/1063 (95.67%), Postives = 1030/1063 (96.90%), Query Frame = 2
Query:   29 MSEDDTYGRPRRQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIEVEDIYDVVNEETYEKLKEKRQLDNFIEGDSEYMESGKEIFDESDEEDIKIGPKRKKSMKNANLKNPKKACLDFKSIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNREEIKAPFLSKKKEEFKFDIHQPKVISSSKIKPNEPKEMPQKTVQEPIKFVKKQIVFNKGSSEKNKSPSTIENNETPEQHKIEDCIVLDDIDFDEPFETNPVVSAGFATDTKLEEHKPLWETEEIEDESSNDKYDPFENIDKSSLKLIYWFDAYHDKKIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQAQMTEVYSEVKSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPPFSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEV 3217
            MSE DTYGRPRRQ+NSKKIDKNDLLGKLKKAKQYGRNLKQEIEVEDIYDVVNEETYEKLK KRQLDNFIEGDS+YMESGKEIFDESDEEDIKIGPKRKKSMKNANLKNPKKACLDFKSIHSDSQKSLFSMLPKSSISKKK ENN LDDLLAELS+PNREEIKAPFLSKKKEEFKF+IHQPKVISSS IKPNEPKE+PQKT QEPIKF            ++ K    ++NNETPEQHKIED IVLDDIDFDEPFETNPV S G ATDTKLEEHKPLWETEEIEDESSNDK DPFENIDKSSLKLIYWFDAYHDKKIPGVVFLFGKTRDEST KFVNVCIRV+GLERRIYVLPKDQAQMTEVYSEVKSILAKHGIESLRTKPVTKKYAFQF+DVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFEIKGIKGIKIEKEKSPPFSILSLNIKTVMN  SNVNEIVAIGGFIHNEIYLDRAPP+KMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLD DIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDR KYLS+GDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEV
Sbjct:    1 MSEHDTYGRPRRQKNSKKIDKNDLLGKLKKAKQYGRNLKQEIEVEDIYDVVNEETYEKLKAKRQLDNFIEGDSDYMESGKEIFDESDEEDIKIGPKRKKSMKNANLKNPKKACLDFKSIHSDSQKSLFSMLPKSSISKKKFENNKLDDLLAELSSPNREEIKAPFLSKKKEEFKFNIHQPKVISSSTIKPNEPKEIPQKTAQEPIKF------------KRIKHRVQLKNNETPEQHKIEDNIVLDDIDFDEPFETNPVESTGLATDTKLEEHKPLWETEEIEDESSNDKCDPFENIDKSSLKLIYWFDAYHDKKIPGVVFLFGKTRDESTNKFVNVCIRVYGLERRIYVLPKDQAQMTEVYSEVKSILAKHGIESLRTKPVTKKYAFQFVDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFEIKGIKGIKIEKEKSPPFSILSLNIKTVMNKNSNVNEIVAIGGFIHNEIYLDRAPPNKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDLDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRNKYLSIGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEV 1051          
BLAST of DNA polymerase vs. Planmine SMEST
Match: SMESG000079687.1 (SMESG000079687.1)

HSP 1 Score: 2006.88 bits (5198), Expect = 0.000e+0
Identity = 1017/1061 (95.85%), Postives = 1029/1061 (96.98%), Query Frame = 2
Query:   35 EDDTYGRPRRQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIEVEDIYDVVNEETYEKLKEKRQLDNFIEGDSEYMESGKEIFDESDEEDIKIGPKRKKSMKNANLKNPKKACLDFKSIHSDSQKSLFSMLPXXXXXXXXXEXXXXXXXXAELSTPNREEIKAPFLSKKKEEFKFDIHQPKVISSSKIKPNEPKEMPQKTVQEPIKFVKKQIVFNKGSSEKNKSPSTIENNETPEQHKIEDCIVLDDIDFDEPFETNPVVSAGFATDTKLEEHKPLWETEEIEDESSNDKYDPFENIDKSSLKLIYWFDAYHDKKIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYVLPKDQAQMTEVYSEVKSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFXXXXXXXXXXXXXXSPPFSILSLNIKTVMNNKSNVNEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEV 3217
            E DTYGRPRRQ+NSKKIDKNDLLGKLKKAKQYGRNLKQEIEVEDIYDVVNEETYEKLK KRQLDNFIEGDS+YMESGKEIFDESDEEDIKIGPKRKKSMKNANLKNPKKACLDFKSIHSDSQKSLFSMLPKSSISKKK ENN LDDLLAELS+PNREEIKAPFLSKKKEEFKF+IHQPKVISSS IKPNEPKE+PQKT QEPIKF  K+I          K    ++NNETPEQHKIED IVLDDIDFDEPFETNPV S G ATDTKLEEHKPLWETEEIEDESSNDK DPFENIDKSSLKLIYWFDAYHDKKIPGVVFLFGKTRDEST KFVNVCIRV+GLERRIYVLPKDQAQMTEVYSEVKSILAKHGIESLRTKPVTKKYAFQF+DVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFEIKGIKGIKIEKEKSPPFSILSLNIKTVMN  SNVNEIVAIGGFIHNEIYLDRAPP+KMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLD DIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDR KYLS+GDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEV
Sbjct:  321 ETDTYGRPRRQKNSKKIDKNDLLGKLKKAKQYGRNLKQEIEVEDIYDVVNEETYEKLKAKRQLDNFIEGDSDYMESGKEIFDESDEEDIKIGPKRKKSMKNANLKNPKKACLDFKSIHSDSQKSLFSMLPKSSISKKKFENNKLDDLLAELSSPNREEIKAPFLSKKKEEFKFNIHQPKVISSSTIKPNEPKEIPQKTAQEPIKF--KRI----------KHRVQLKNNETPEQHKIEDNIVLDDIDFDEPFETNPVESTGLATDTKLEEHKPLWETEEIEDESSNDKCDPFENIDKSSLKLIYWFDAYHDKKIPGVVFLFGKTRDESTNKFVNVCIRVYGLERRIYVLPKDQAQMTEVYSEVKSILAKHGIESLRTKPVTKKYAFQFVDVPDETDYLMVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSGLESSSNQFSTCKLNFEIKGIKGIKIEKEKSPPFSILSLNIKTVMNKNSNVNEIVAIGGFIHNEIYLDRAPPNKMFQNNFIILTHPKDYVMPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDLDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRNKYLSIGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGCAKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVNRRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLDIVRRDWCKLSIEV 1369          
BLAST of DNA polymerase vs. Planmine SMEST
Match: SMESG000044739.1 (SMESG000044739.1)

HSP 1 Score: 777.319 bits (2006), Expect = 0.000e+0
Identity = 376/385 (97.66%), Postives = 379/385 (98.44%), Query Frame = 2
Query: 1646 MPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQA 2800
            MPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGH+NTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFK FVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQ+LPLALEITAICGNLICRTL GGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQ GKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDR KYLS+GDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARN VKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQ 
Sbjct:    1 MPYDLNQKLASEWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQRCQALNINTWYKFGRLKRSIALPKITGHNNTSWIERMATAGRLLCDVEVSARELIKCRSYEQRDLIQEMLPEKFKDFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQILPLALEITAICGNLICRTLFGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQSGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRNKYLSIGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNVVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQV 385          
BLAST of DNA polymerase vs. Planmine SMEST
Match: SMESG000044721.1 (SMESG000044721.1)

HSP 1 Score: 493.812 bits (1270), Expect = 5.906e-164
Identity = 239/255 (93.73%), Postives = 245/255 (96.08%), Query Frame = 2
Query: 2033 MLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLLLHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLEPKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHILMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIRQKALKITANSMYGCLGFSQSRFQ 2797
            MLPEKFK FVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQ+LPLALEITAICGNLICRTL GGKSERNEYLLLH+FNEKQYIVPDKAAALPQNSQLEIDQSNEQ GKFSKRKPTYA GLVLEPKKGLYEN ILLMDFNSLYPSIILEYNICFTTIDR  YLSV DTDQAMHIL+DLSHKSVA+PPGILP+EIRKLVEARN VKQLLNNPNLSK+KLLQHDIRQKALKIT NSMYGCLGFSQSRFQ
Sbjct:    1 MLPEKFKDFVSSVPVGDLCTLFNSSAGIKQLIDLTLDESLVNICLMHELQILPLALEITAICGNLICRTLFGGKSERNEYLLLHSFNEKQYIVPDKAAALPQNSQLEIDQSNEQSGKFSKRKPTYASGLVLEPKKGLYENLILLMDFNSLYPSIILEYNICFTTIDRNTYLSVSDTDQAMHILIDLSHKSVAEPPGILPMEIRKLVEARNVVKQLLNNPNLSKKKLLQHDIRQKALKITTNSMYGCLGFSQSRFQ 255          

HSP 2 Score: 51.9878 bits (123), Expect = 1.314e-6
Identity = 23/25 (92.00%), Postives = 23/25 (92.00%), Query Frame = 3
Query: 3561 EPKNENYRSIIITIWHINSTQWFAD 3635
            EPKNENY SIIITIWHINSTQ FAD
Sbjct:  256 EPKNENYVSIIITIWHINSTQRFAD 280          
BLAST of DNA polymerase vs. Planmine SMEST
Match: SMESG000079942.1 (SMESG000079942.1)

HSP 1 Score: 452.595 bits (1163), Expect = 2.408e-149
Identity = 214/219 (97.72%), Postives = 217/219 (99.09%), Query Frame = 2
Query: 3653 MIDASTVAEHLGLDPSKYHHANQHNEADNTYSKQESTDEANRFIDCKPLPIYCRKCQHKTSIDFKMELEKPWLCGNCNVELLYSHADAVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFACPRCESGIMKPLLSSSLLNRQLGYYRFLLTGKENLSYKQKELLQMCSKYVERVLERSDYMNVDFKSLMAKFSRQIKIV 4309
            MIDASTVAEHLGLDPSKYHHANQHNEADNT+SKQ+STDEANRFIDCKPLPIYCRKCQHKTSIDFKMELEKPWLCGNC+ ELLYSHADAVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFACPRCESGIMKPLLSSSLLNRQLGYYRFLLTGKENLSYK KELLQMCSKYVERVLERSDYMNVDFKSLMAKFSRQIKIV
Sbjct:    1 MIDASTVAEHLGLDPSKYHHANQHNEADNTFSKQDSTDEANRFIDCKPLPIYCRKCQHKTSIDFKMELEKPWLCGNCSGELLYSHADAVNVNKKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFACPRCESGIMKPLLSSSLLNRQLGYYRFLLTGKENLSYKHKELLQMCSKYVERVLERSDYMNVDFKSLMAKFSRQIKIV 219          
The following BLAST results are available for this feature:
BLAST of DNA polymerase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POLA10.000e+036.90DNA polymerase alpha 1, catalytic subunit [Source:... [more]
POLA10.000e+036.90DNA polymerase alpha 1, catalytic subunit [Source:... [more]
POLA10.000e+036.90DNA polymerase alpha 1, catalytic subunit [Source:... [more]
POLD11.964e-4728.38DNA polymerase delta 1, catalytic subunit [Source:... [more]
POLD11.964e-4728.38DNA polymerase delta 1, catalytic subunit [Source:... [more]
back to top
BLAST of DNA polymerase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pola-11.019e-17234.45DNA polymerase [Source:UniProtKB/TrEMBL;Acc:C7IVS... [more]
pola-17.866e-17234.86DNA polymerase [Source:UniProtKB/TrEMBL;Acc:C7IVS... [more]
F10C2.49.301e-4727.34DNA polymerase delta catalytic subunit [Source:Un... [more]
rev-31.663e-2123.99DNA polymerase [Source:UniProtKB/TrEMBL;Acc:A0A0K... [more]
rev-35.404e-2123.99DNA polymerase [Source:UniProtKB/TrEMBL;Acc:A0A0K... [more]
back to top
BLAST of DNA polymerase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
DNApol-alpha1800.000e+037.64gene:FBgn0259113 transcript:FBtr0084115[more]
DNApol-delta4.079e-4626.93gene:FBgn0263600 transcript:FBtr0075522[more]
DNApol-zeta2.257e-1926.65gene:FBgn0002891 transcript:FBtr0088831[more]
back to top
BLAST of DNA polymerase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pola10.000e+037.18polymerase (DNA directed), alpha 1 [Source:ZFIN;Ac... [more]
pola10.000e+037.33polymerase (DNA directed), alpha 1 [Source:ZFIN;Ac... [more]
pola11.819e-8635.84polymerase (DNA directed), alpha 1 [Source:ZFIN;Ac... [more]
pold11.014e-4628.12polymerase (DNA directed), delta 1, catalytic subu... [more]
rev3l5.444e-2321.98REV3 like, DNA directed polymerase zeta catalytic ... [more]
back to top
BLAST of DNA polymerase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POLA10.000e+036.07polymerase (DNA directed), alpha 1, catalytic subu... [more]
POLA10.000e+036.25polymerase (DNA directed), alpha 1, catalytic subu... [more]
POLA10.000e+038.99polymerase (DNA directed), alpha 1, catalytic subu... [more]
POLA19.016e-638.76polymerase (DNA directed), alpha 1, catalytic subu... [more]
POLA10.000e+038.76polymerase (DNA directed), alpha 1, catalytic subu... [more]
back to top
BLAST of DNA polymerase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pola10.000e+036.39polymerase (DNA directed), alpha 1 [Source:MGI Sym... [more]
Pold13.271e-4427.55polymerase (DNA directed), delta 1, catalytic subu... [more]
Pold18.981e-3827.15polymerase (DNA directed), delta 1, catalytic subu... [more]
Rev3l6.714e-2822.29REV3 like, DNA directed polymerase zeta catalytic ... [more]
Rev3l6.714e-2822.29REV3 like, DNA directed polymerase zeta catalytic ... [more]
back to top
BLAST of DNA polymerase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9DE46|DPOLA_XENLA0.000e+036.66DNA polymerase alpha catalytic subunit OS=Xenopus ... [more]
sp|P09884|DPOLA_HUMAN0.000e+036.90DNA polymerase alpha catalytic subunit OS=Homo sap... [more]
sp|P33609|DPOLA_MOUSE0.000e+036.39DNA polymerase alpha catalytic subunit OS=Mus musc... [more]
sp|O89042|DPOLA_RAT0.000e+036.70DNA polymerase alpha catalytic subunit (Fragment) ... [more]
sp|P26019|DPOLA_DROME0.000e+037.64DNA polymerase alpha catalytic subunit OS=Drosophi... [more]
back to top
BLAST of DNA polymerase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4BGE00.000e+039.02DNA polymerase (Fragment) OS=Lottia gigantea OX=22... [more]
E7FB680.000e+037.18DNA polymerase OS=Danio rerio OX=7955 GN=pola1 PE=... [more]
E9QIM30.000e+037.33DNA polymerase OS=Danio rerio OX=7955 GN=pola1 PE=... [more]
B1WBE20.000e+036.73DNA polymerase OS=Xenopus laevis OX=8355 GN=LOC398... [more]
B7ZRF30.000e+036.66DNA polymerase OS=Xenopus laevis OX=8355 GN=LOC398... [more]
back to top
BLAST of DNA polymerase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000007988.20.000e+035.95pep primary_assembly:Astyanax_mexicanus-2.0:3:1893... [more]
pold19.743e-4827.79DNA polymerase delta 1, catalytic subunit [Source:... [more]
pold11.266e-4727.79DNA polymerase delta 1, catalytic subunit [Source:... [more]
pold11.633e-3331.34DNA polymerase delta 1, catalytic subunit [Source:... [more]
rev3l1.076e-2322.21REV3 like, DNA directed polymerase zeta catalytic ... [more]
back to top
BLAST of DNA polymerase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pold13.165e-4227.34polymerase (DNA directed), delta 1, catalytic subu... [more]
ENSPMAT00000006446.16.870e-1324.56pep scaffold:Pmarinus_7.0:GL477096:156518:193524:1... [more]
ENSPMAT00000009864.16.065e-922.64pep scaffold:Pmarinus_7.0:GL480102:12343:24944:1 g... [more]
back to top
BLAST of DNA polymerase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
POL15.648e-14531.62Catalytic subunit of the DNA polymerase I alpha-pr... [more]
POL31.545e-5129.50Catalytic subunit of DNA polymerase delta; require... [more]
REV32.330e-2823.34Catalytic subunit of DNA polymerase zeta; involved... [more]
back to top
BLAST of DNA polymerase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO393424.116e-735.26DNA polymerase [Source:UniProtKB/TrEMBL;Acc:A7SAB... [more]
EDO492944.878e-5227.55DNA polymerase [Source:UniProtKB/TrEMBL;Acc:A7RH5... [more]
EDO278194.124e-4237.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420564.362e-2423.48DNA polymerase [Source:UniProtKB/TrEMBL;Acc:A7S2J... [more]
back to top
BLAST of DNA polymerase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pola10.000e+036.35DNA polymerase alpha 1, catalytic subunit [Source:... [more]
pola10.000e+036.35DNA polymerase alpha 1, catalytic subunit [Source:... [more]
pola10.000e+035.96DNA polymerase alpha 1, catalytic subunit [Source:... [more]
pola10.000e+038.63DNA polymerase alpha 1, catalytic subunit [Source:... [more]
pold11.868e-4628.02DNA polymerase delta 1, catalytic subunit [Source:... [more]
back to top
BLAST of DNA polymerase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079687.10.000e+095.67SMESG000079687.1[more]
SMESG000079687.10.000e+095.85SMESG000079687.1[more]
SMESG000044739.10.000e+097.66SMESG000044739.1[more]
SMESG000044721.15.906e-16493.73SMESG000044721.1[more]
SMESG000079942.12.408e-14997.72SMESG000079942.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004136 ID=SMED30004136|Name=DNA polymerase|organism=Schmidtea mediterranea sexual|type=transcript|length=4341bp
TTTAATTACAAAGATTTATTAGTTTGAAATGTCTGAAGACGATACTTATG
GAAGACCTAGGCGTCAGAGAAATTCAAAGAAAATTGATAAAAATGATTTG
CTTGGTAAATTAAAGAAGGCTAAGCAATATGGACGAAATCTGAAACAAGA
AATTGAAGTTGAAGATATTTATGATGTGGTTAATGAAGAAACTTATGAAA
AATTAAAAGAGAAGAGACAGTTGGATAATTTTATAGAAGGTGATTCAGAG
TATATGGAAAGTGGTAAAGAAATTTTCGATGAATCAGACGAGGAAGATAT
TAAAATTGGACCGAAACGCAAAAAATCAATGAAAAATGCTAATTTAAAAA
ATCCCAAAAAAGCTTGTTTAGATTTCAAAAGCATTCATAGTGATTCACAA
AAGAGTCTTTTTAGTATGTTACCCAAATCAAGTATTTCAAAAAAGAAAAT
TGAAAACAACAACCTAGATGATCTGCTAGCTGAGTTATCTACACCAAATC
GGGAAGAAATAAAGGCGCCATTTTTGTCAAAAAAGAAAGAAGAATTTAAG
TTTGACATACATCAACCGAAAGTCATAAGTTCATCGAAAATTAAACCAAA
TGAACCGAAAGAGATGCCTCAAAAAACTGTACAAGAGCCAATTAAATTTG
TGAAGAAACAAATAGTTTTTAATAAAGGATCTTCAGAAAAAAATAAATCA
CCGAGTACAATTGAAAATAATGAAACACCAGAACAACATAAAATTGAAGA
TTGTATTGTTCTGGATGATATAGATTTCGATGAGCCATTTGAGACAAATC
CAGTTGTATCAGCTGGATTTGCAACCGACACGAAATTGGAGGAACATAAA
CCTCTATGGGAAACTGAAGAGATAGAAGATGAAAGTTCAAATGATAAATA
TGATCCATTCGAAAATATAGATAAATCCTCATTGAAATTAATTTACTGGT
TCGATGCATATCACGACAAAAAGATTCCAGGAGTTGTATTTCTATTTGGG
AAAACCCGTGATGAATCCACAAAGAAATTTGTCAATGTCTGCATTAGGGT
TCACGGACTGGAAAGGAGGATTTATGTTCTGCCAAAGGACCAAGCCCAAA
TGACAGAGGTGTACAGTGAAGTGAAATCAATATTGGCCAAGCATGGCATT
GAGAGCTTACGCACGAAACCTGTAACTAAGAAATATGCGTTCCAATTTAT
TGACGTTCCCGATGAAACCGACTATTTAATGGTGCAATACGATTCTAAAT
TCCCTGAATTGCCCAGTGATTTAAGCGGGAAAACCTTTTCCCGAATATTT
GGTGCCAACACATCATGCTTAGAAATGTTTATTTTGGATCTGCGGCTAAA
AGGACCTTGTTGGTTAAGTTTCAGTGGATTAGAATCCTCAAGCAATCAAT
TTAGTACTTGTAAATTGAATTTCGAAATTAAAGGAATCAAAGGCATAAAG
ATTGAAAAAGAAAAAAGTCCACCATTTTCTATTCTGTCCTTAAATATAAA
AACTGTAATGAATAACAAGTCTAATGTCAATGAAATCGTTGCAATTGGTG
GATTTATTCACAATGAAATATATTTAGACAGAGCCCCTCCTAGCAAAATG
TTTCAGAATAACTTTATCATATTAACTCATCCAAAAGATTATGTCATGCC
GTATGATCTCAACCAAAAATTGGCATCAGAATGGGGCGCAAATTATAAAA
ATTCCGTACTAATTGAAGCCAATGAAAGGTCTCTCATCAGCTGCTTGCTC
AATAAACTGCATCACCTTGATCCCGATATCATCGTTGGCCATGCACTGAT
TGGCTACCAACTGGGAATTCTCCTCCAGAGATGTCAGGCACTGAATATAA
ACACCTGGTATAAATTCGGGCGCCTGAAGAGAAGCATTGCCCTGCCAAAG
ATCACCGGGCACAGCAACACATCGTGGATCGAAAGGATGGCAACAGCCGG
CCGGCTTCTGTGCGACGTAGAAGTCAGTGCTCGAGAACTGATTAAATGCC
GAAGCTATGAACAGCGTGATCTGATCCAGGAAATGCTGCCGGAGAAATTC
AAGGCCTTCGTAAGCAGTGTGCCTGTCGGTGATTTGTGCACCTTATTCAA
CAGTTCCGCCGGCATCAAACAATTAATCGATCTGACCCTTGACGAGTCGC
TGGTCAATATTTGCCTGATGCACGAACTGCAAGTCCTTCCTCTGGCATTG
GAAATAACAGCGATATGTGGAAATCTGATCTGTCGGACGTTATCTGGCGG
TAAATCCGAGCGCAATGAATATCTGCTGCTTCATGCATTCAATGAAAAGC
AATATATAGTGCCAGATAAAGCCGCCGCGTTGCCACAAAATAGCCAGCTA
GAAATTGACCAATCAAATGAGCAGGGCGGGAAATTCTCCAAGCGCAAGCC
AACTTATGCCGGCGGGCTTGTATTGGAACCGAAAAAGGGATTATATGAGA
ATTTCATTCTACTGATGGATTTCAATTCACTTTATCCGTCGATAATTCTG
GAATATAATATCTGCTTCACGACAATCGATCGCTGCAAATACCTCAGTGT
TGGCGACACTGATCAGGCAATGCATATACTGATGGATTTATCGCACAAAT
CGGTTGCCAAGCCGCCGGGAATATTACCAATAGAAATTCGGAAATTAGTA
GAGGCCAGAAACGCGGTGAAGCAACTTCTCAATAATCCCAATCTTTCGAA
GGAAAAGCTCCTCCAGCATGATATAAGGCAGAAAGCTCTCAAGATTACAG
CCAATAGTATGTATGGATGTTTGGGATTCAGCCAATCACGATTTCAGGCT
ACACAATTAGCAGCATTGGTTACATTTCATGGCAGAGAAATATTGATCAA
TACCAAAAAAATAATCGAAGACGGATGTGCAAAAATTTCCAATAAGATCA
ATTTGAATGTGGCGTTGGATATAATTTACGGTGACACCGATTCAGTGATG
GTGAACACCGGCATTGGGAATGTCTATCAGTATGATACGGTAATGAAAAT
TGGGCAGCTTATCAAGGAGGAAGTCAACCGACGATACAAAGGCATCCAAT
TGAACATTGACGGTGTCATGAGAAGAATATTACTGTTGAACAAAAAGAAA
TATGCGTCGTTAAATGTGGTTTCAAGGGATAAAAGCTCAGGAAAATTGAT
TCTTAAACAAGAACTAAAAGGCTTGGATATAGTTCGAAGAGATTGGTGTA
AACTGTCCATCGAAGTTGGTAAGCGCATATTGACAATGATTTTGGAAGAG
GAATTGTCGCCGGAGGATTTAGCATTTTCCATTCACAATTACCTTAAATC
AATTAGTGATGATATGAGAAACTGTAAAATCTCGTTGGGGAAGTTTATTA
TTACAAAGGCACTGACAAGGAATCCGGAAAATTATTCCAATCCCCAAGGC
CAACCGCATGTGCAAGTTGCATTGAGAATTAACAGTGCCGGCGGGTCTAT
CAAGCAGTACCGAGCAAAGGATACAGTGGAATACATTATTTGCAATGATG
GAACCTCAGAAACCGCAACTCAAAGAGCATATAGCCCAAAGGAAGTATTA
TCTTCAAGCCGAACCGAAGAACGAAAATTATCGATCGATTATAATTACTA
TCTGGCACATCAACTCCACCCAGTGGTTTGCAGATTAATTGAACCTATTG
ATATGATAGATGCATCAACGGTGGCAGAGCATTTAGGCCTTGATCCATCA
AAGTACCACCACGCTAACCAACATAATGAGGCAGATAATACCTATTCTAA
ACAAGAATCCACCGATGAAGCAAACCGATTTATTGATTGCAAACCTCTTC
CTATTTACTGCCGAAAGTGCCAACATAAAACGAGCATCGATTTTAAAATG
GAACTAGAGAAGCCTTGGTTATGTGGCAATTGCAATGTCGAGCTGTTATA
TTCACACGCTGATGCAGTTAATGTCAATAAGAAACTCAAGGAAATCATAG
ATCGAATAATTCACATATATTACTCGTGCATTTCCACGTGTCAATGCGGG
TATATCTGTCGGGGAATGGTCAATATATGCAATGAGGAAGCTAGGAAGTT
ATTAATGACAACCGGTCAATTTGCTTGTCCAAGATGTGAAAGCGGGATTA
TGAAGCCTCTACTCAGTAGTTCTTTACTTAATCGACAACTCGGTTATTAT
CGATTCTTACTTACTGGCAAAGAAAACCTATCGTACAAACAGAAAGAATT
ATTACAAATGTGCAGCAAATATGTGGAGCGAGTCCTGGAACGTTCCGATT
ACATGAATGTGGATTTCAAAAGTTTAATGGCGAAATTCTCACGACAGATT
AAAATTGTTTAATTTCCTATAGATTTTATGTTTTATAAATA
back to top

protein sequence of SMED30004136-orf-1

>SMED30004136-orf-1 ID=SMED30004136-orf-1|Name=SMED30004136-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1428bp
MSEDDTYGRPRRQRNSKKIDKNDLLGKLKKAKQYGRNLKQEIEVEDIYDV
VNEETYEKLKEKRQLDNFIEGDSEYMESGKEIFDESDEEDIKIGPKRKKS
MKNANLKNPKKACLDFKSIHSDSQKSLFSMLPKSSISKKKIENNNLDDLL
AELSTPNREEIKAPFLSKKKEEFKFDIHQPKVISSSKIKPNEPKEMPQKT
VQEPIKFVKKQIVFNKGSSEKNKSPSTIENNETPEQHKIEDCIVLDDIDF
DEPFETNPVVSAGFATDTKLEEHKPLWETEEIEDESSNDKYDPFENIDKS
SLKLIYWFDAYHDKKIPGVVFLFGKTRDESTKKFVNVCIRVHGLERRIYV
LPKDQAQMTEVYSEVKSILAKHGIESLRTKPVTKKYAFQFIDVPDETDYL
MVQYDSKFPELPSDLSGKTFSRIFGANTSCLEMFILDLRLKGPCWLSFSG
LESSSNQFSTCKLNFEIKGIKGIKIEKEKSPPFSILSLNIKTVMNNKSNV
NEIVAIGGFIHNEIYLDRAPPSKMFQNNFIILTHPKDYVMPYDLNQKLAS
EWGANYKNSVLIEANERSLISCLLNKLHHLDPDIIVGHALIGYQLGILLQ
RCQALNINTWYKFGRLKRSIALPKITGHSNTSWIERMATAGRLLCDVEVS
ARELIKCRSYEQRDLIQEMLPEKFKAFVSSVPVGDLCTLFNSSAGIKQLI
DLTLDESLVNICLMHELQVLPLALEITAICGNLICRTLSGGKSERNEYLL
LHAFNEKQYIVPDKAAALPQNSQLEIDQSNEQGGKFSKRKPTYAGGLVLE
PKKGLYENFILLMDFNSLYPSIILEYNICFTTIDRCKYLSVGDTDQAMHI
LMDLSHKSVAKPPGILPIEIRKLVEARNAVKQLLNNPNLSKEKLLQHDIR
QKALKITANSMYGCLGFSQSRFQATQLAALVTFHGREILINTKKIIEDGC
AKISNKINLNVALDIIYGDTDSVMVNTGIGNVYQYDTVMKIGQLIKEEVN
RRYKGIQLNIDGVMRRILLLNKKKYASLNVVSRDKSSGKLILKQELKGLD
IVRRDWCKLSIEVGKRILTMILEEELSPEDLAFSIHNYLKSISDDMRNCK
ISLGKFIITKALTRNPENYSNPQGQPHVQVALRINSAGGSIKQYRAKDTV
EYIICNDGTSETATQRAYSPKEVLSSSRTEERKLSIDYNYYLAHQLHPVV
CRLIEPIDMIDASTVAEHLGLDPSKYHHANQHNEADNTYSKQESTDEANR
FIDCKPLPIYCRKCQHKTSIDFKMELEKPWLCGNCNVELLYSHADAVNVN
KKLKEIIDRIIHIYYSCISTCQCGYICRGMVNICNEEARKLLMTTGQFAC
PRCESGIMKPLLSSSLLNRQLGYYRFLLTGKENLSYKQKELLQMCSKYVE
RVLERSDYMNVDFKSLMAKFSRQIKIV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0051536iron-sulfur cluster binding
GO:00515394 iron, 4 sulfur cluster binding
GO:0004197cysteine-type endopeptidase activity
GO:0003676nucleic acid binding
GO:0003887DNA-directed DNA polymerase activity
GO:0000166nucleotide binding
GO:0001882nucleoside binding
GO:00084083'-5' exonuclease activity
GO:0003677DNA binding
GO:0016740transferase activity
GO:0016779nucleotidyltransferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR008741AV_PCPalpha
IPR006172DNA-dir_DNA_pol_B
IPR015088Znf_DNA-dir_DNA_pol_B_alpha
IPR024647DNA_pol_a_cat_su_N
IPR023211DNA_pol_palm_dom_sf
IPR006133DNA-dir_DNA_pol_B_exonuc
IPR006134DNA-dir_DNA_pol_B_multi_dom
IPR012337RNaseH-like_sf
IPR017964DNA-dir_DNA_pol_B_CS
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0006270DNA replication initiation
GO:0071897DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis