14-3-3 protein beta/alpha

Overview
Name14-3-3 protein beta/alpha
Smed IDSMED30004124
Length (bp)1130
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 14-3-3 protein beta/alpha (SMED30004124) t-SNE clustered cells

Violin plots show distribution of expression levels for 14-3-3 protein beta/alpha (SMED30004124) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 14-3-3 protein beta/alpha (SMED30004124) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 14-3-3 protein beta/alpha (SMED30004124) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004124

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30004124SMESG000065824.1 SMESG000018862.1 Contig5GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30004124SMESG000055903.1 Contig5GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30004124SMESG000055903.1 dd_Smed_v4_138_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30004124SMESG000055903.1 dd_Smed_v4_138_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004124SMESG000055903.1 dd_Smed_v4_138_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30004124SMESG000055903.1 dd_Smed_v4_138_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004124SMESG000055903.1 dd_Smed_v4_138_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004124SMESG000055903.1 dd_Smed_v4_138_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30004124SMESG000055903.1 dd_Smed_v4_138_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30004124SMESG000055903.1 dd_Smed_v4_138_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30004124SMESG000055903.1 dd_Smed_v4_138_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004124SMESG000055903.1 dd_Smed_v4_138_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30004124SMESG000055903.1 dd_Smed_v4_138_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004124SMESG000055903.1 dd_Smed_v4_138_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30004124SMESG000055903.1 dd_Smed_v4_138_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004124SMESG000055903.1 dd_Smed_v4_138_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004124SMESG000055903.1 Contig45933uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004124SMESG000055903.1 Contig45933newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neural progenitor cellSMED30004124SMESG000055903.1 dd_Smed_v6_138_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30004124SMESG000055903.1 dd_Smed_v6_138_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Human
Match: YWHAZ (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta [Source:HGNC Symbol;Acc:HGNC:12855])

HSP 1 Score: 309.686 bits (792), Expect = 1.014e-104
Identity = 169/240 (70.42%), Postives = 193/240 (80.42%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEG 907
            + ELV  AKL+EQAERY+DMA  MK VTE G ELSNEERNLLSVAYKNVVGARRS+WRV++SIEQKTEG+EKKQ  A EYR KIE+EL  ICNDVL LL  +LIP A+   QAES+VF+LKM+GDYYRYLAEVA+  +K  IV  S  AY  A   S  ++  THPIRLGLALNFSVFYYEI N+  +AC LAKTAFD+AIA++D L E+SYKDSTLIMQLLRDNLTLWTSD QGD+ E 
Sbjct:    3 KNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNAS---QAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEA 239          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Human
Match: YWHAZ (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta [Source:HGNC Symbol;Acc:HGNC:12855])

HSP 1 Score: 309.686 bits (792), Expect = 1.014e-104
Identity = 169/240 (70.42%), Postives = 193/240 (80.42%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEG 907
            + ELV  AKL+EQAERY+DMA  MK VTE G ELSNEERNLLSVAYKNVVGARRS+WRV++SIEQKTEG+EKKQ  A EYR KIE+EL  ICNDVL LL  +LIP A+   QAES+VF+LKM+GDYYRYLAEVA+  +K  IV  S  AY  A   S  ++  THPIRLGLALNFSVFYYEI N+  +AC LAKTAFD+AIA++D L E+SYKDSTLIMQLLRDNLTLWTSD QGD+ E 
Sbjct:    3 KNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNAS---QAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEA 239          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Human
Match: YWHAZ (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta [Source:HGNC Symbol;Acc:HGNC:12855])

HSP 1 Score: 309.686 bits (792), Expect = 1.014e-104
Identity = 169/240 (70.42%), Postives = 193/240 (80.42%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEG 907
            + ELV  AKL+EQAERY+DMA  MK VTE G ELSNEERNLLSVAYKNVVGARRS+WRV++SIEQKTEG+EKKQ  A EYR KIE+EL  ICNDVL LL  +LIP A+   QAES+VF+LKM+GDYYRYLAEVA+  +K  IV  S  AY  A   S  ++  THPIRLGLALNFSVFYYEI N+  +AC LAKTAFD+AIA++D L E+SYKDSTLIMQLLRDNLTLWTSD QGD+ E 
Sbjct:    3 KNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNAS---QAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEA 239          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Human
Match: YWHAZ (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta [Source:HGNC Symbol;Acc:HGNC:12855])

HSP 1 Score: 309.686 bits (792), Expect = 1.014e-104
Identity = 169/240 (70.42%), Postives = 193/240 (80.42%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEG 907
            + ELV  AKL+EQAERY+DMA  MK VTE G ELSNEERNLLSVAYKNVVGARRS+WRV++SIEQKTEG+EKKQ  A EYR KIE+EL  ICNDVL LL  +LIP A+   QAES+VF+LKM+GDYYRYLAEVA+  +K  IV  S  AY  A   S  ++  THPIRLGLALNFSVFYYEI N+  +AC LAKTAFD+AIA++D L E+SYKDSTLIMQLLRDNLTLWTSD QGD+ E 
Sbjct:    3 KNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNAS---QAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEA 239          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Human
Match: YWHAZ (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta [Source:HGNC Symbol;Acc:HGNC:12855])

HSP 1 Score: 309.686 bits (792), Expect = 1.014e-104
Identity = 169/240 (70.42%), Postives = 193/240 (80.42%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEG 907
            + ELV  AKL+EQAERY+DMA  MK VTE G ELSNEERNLLSVAYKNVVGARRS+WRV++SIEQKTEG+EKKQ  A EYR KIE+EL  ICNDVL LL  +LIP A+   QAES+VF+LKM+GDYYRYLAEVA+  +K  IV  S  AY  A   S  ++  THPIRLGLALNFSVFYYEI N+  +AC LAKTAFD+AIA++D L E+SYKDSTLIMQLLRDNLTLWTSD QGD+ E 
Sbjct:    3 KNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNAS---QAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEA 239          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Celegans
Match: par-5 (14-3-3-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:P41932])

HSP 1 Score: 312.383 bits (799), Expect = 3.735e-106
Identity = 172/238 (72.27%), Postives = 196/238 (82.35%), Query Frame = 2
Query:  194 EELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSAS-KLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNE 904
            EELV  AKL+EQAERY+DMA AMKKVTE G+ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTEGSEKKQ  A EYR+K+E ELN IC DVLKLL ++LI    K+G AES+VF+LKM+GDYYRYLAEVA S++++ +V+ S  AY  A   A  K+  THPIRLGLALNFSVFYYEI N    AC+LAK AFDDAIA++D L EDSYKDSTLIMQLLRDNLTLWTSD   +D E
Sbjct:    6 EELVQRAKLAEQAERYDDMAAAMKKVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQLAKEYRVKVEQELNDICQDVLKLLDEFLI---VKAGAAESKVFYLKMKGDYYRYLAEVA-SEDRAAVVEKSQKAYQEALDIAKDKMQPTHPIRLGLALNFSVFYYEILNTPEHACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDVGAEDQE 239          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Celegans
Match: par-5 (14-3-3-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:P41932])

HSP 1 Score: 312.383 bits (799), Expect = 3.735e-106
Identity = 172/238 (72.27%), Postives = 196/238 (82.35%), Query Frame = 2
Query:  194 EELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSAS-KLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNE 904
            EELV  AKL+EQAERY+DMA AMKKVTE G+ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTEGSEKKQ  A EYR+K+E ELN IC DVLKLL ++LI    K+G AES+VF+LKM+GDYYRYLAEVA S++++ +V+ S  AY  A   A  K+  THPIRLGLALNFSVFYYEI N    AC+LAK AFDDAIA++D L EDSYKDSTLIMQLLRDNLTLWTSD   +D E
Sbjct:    6 EELVQRAKLAEQAERYDDMAAAMKKVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQLAKEYRVKVEQELNDICQDVLKLLDEFLI---VKAGAAESKVFYLKMKGDYYRYLAEVA-SEDRAAVVEKSQKAYQEALDIAKDKMQPTHPIRLGLALNFSVFYYEILNTPEHACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDVGAEDQE 239          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Celegans
Match: par-5 (14-3-3-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:P41932])

HSP 1 Score: 312.383 bits (799), Expect = 3.735e-106
Identity = 172/238 (72.27%), Postives = 196/238 (82.35%), Query Frame = 2
Query:  194 EELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSAS-KLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNE 904
            EELV  AKL+EQAERY+DMA AMKKVTE G+ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTEGSEKKQ  A EYR+K+E ELN IC DVLKLL ++LI    K+G AES+VF+LKM+GDYYRYLAEVA S++++ +V+ S  AY  A   A  K+  THPIRLGLALNFSVFYYEI N    AC+LAK AFDDAIA++D L EDSYKDSTLIMQLLRDNLTLWTSD   +D E
Sbjct:    6 EELVQRAKLAEQAERYDDMAAAMKKVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQLAKEYRVKVEQELNDICQDVLKLLDEFLI---VKAGAAESKVFYLKMKGDYYRYLAEVA-SEDRAAVVEKSQKAYQEALDIAKDKMQPTHPIRLGLALNFSVFYYEILNTPEHACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDVGAEDQE 239          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Celegans
Match: ftt-2 (14-3-3-like protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20655])

HSP 1 Score: 310.457 bits (794), Expect = 2.488e-105
Identity = 169/244 (69.26%), Postives = 197/244 (80.74%), Query Frame = 2
Query:  188 SREELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSAS-KLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEGVDT 916
             +EELV+ AKL+EQAERY+DMA +MKKVTE+G ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTEGSEKKQ  A EYR K+E EL  IC DVL LL  +LIP   K+G AES+VF+LKM+GDYYRYLAEVAS  +++ +V+ S  +Y  A   A  K+  THPIRLGLALNFSVF+YEI N   +AC+LAK AFDDAIA++D L EDSYKDSTLIMQLLRDNLTLWTSD   DD +  +T
Sbjct:    4 GKEELVNRAKLAEQAERYDDMAASMKKVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQMAKEYREKVEKELRDICQDVLNLLDKFLIP---KAGAAESKVFYLKMKGDYYRYLAEVASGDDRNSVVEKSQQSYQEAFDIAKDKMQPTHPIRLGLALNFSVFFYEILNAPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAATDDTDANET 244          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Celegans
Match: ftt-2 (14-3-3-like protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20655])

HSP 1 Score: 310.457 bits (794), Expect = 2.488e-105
Identity = 169/244 (69.26%), Postives = 197/244 (80.74%), Query Frame = 2
Query:  188 SREELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSAS-KLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEGVDT 916
             +EELV+ AKL+EQAERY+DMA +MKKVTE+G ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTEGSEKKQ  A EYR K+E EL  IC DVL LL  +LIP   K+G AES+VF+LKM+GDYYRYLAEVAS  +++ +V+ S  +Y  A   A  K+  THPIRLGLALNFSVF+YEI N   +AC+LAK AFDDAIA++D L EDSYKDSTLIMQLLRDNLTLWTSD   DD +  +T
Sbjct:    4 GKEELVNRAKLAEQAERYDDMAASMKKVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQMAKEYREKVEKELRDICQDVLNLLDKFLIP---KAGAAESKVFYLKMKGDYYRYLAEVASGDDRNSVVEKSQQSYQEAFDIAKDKMQPTHPIRLGLALNFSVFFYEILNAPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAATDDTDANET 244          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Fly
Match: 14-3-3zeta (gene:FBgn0004907 transcript:FBtr0088413)

HSP 1 Score: 301.597 bits (771), Expect = 8.316e-102
Identity = 165/239 (69.04%), Postives = 192/239 (80.33%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSA-SKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNE 904
            +EELV  AKL+EQ+ERY+DMA AMK VTE G ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTE S +KQ  A EYR ++E EL  IC +VL LL  YLIP   K+   ES+VF+LKM+GDYYRYLAEVA+   ++ +V +S NAY  A   A +K+  THPIRLGLALNFSVFYYEI N+  +AC+LAK AFDDAIA++D L EDSYKDSTLIMQLLRDNLTLWTSD QGD+ E
Sbjct:    6 KEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIP---KASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKNAYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAE 241          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Fly
Match: 14-3-3zeta (gene:FBgn0004907 transcript:FBtr0088418)

HSP 1 Score: 301.597 bits (771), Expect = 8.316e-102
Identity = 165/239 (69.04%), Postives = 192/239 (80.33%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSA-SKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNE 904
            +EELV  AKL+EQ+ERY+DMA AMK VTE G ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTE S +KQ  A EYR ++E EL  IC +VL LL  YLIP   K+   ES+VF+LKM+GDYYRYLAEVA+   ++ +V +S NAY  A   A +K+  THPIRLGLALNFSVFYYEI N+  +AC+LAK AFDDAIA++D L EDSYKDSTLIMQLLRDNLTLWTSD QGD+ E
Sbjct:    6 KEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIP---KASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKNAYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAE 241          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Fly
Match: 14-3-3zeta (gene:FBgn0004907 transcript:FBtr0088417)

HSP 1 Score: 301.597 bits (771), Expect = 8.316e-102
Identity = 165/239 (69.04%), Postives = 192/239 (80.33%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSA-SKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNE 904
            +EELV  AKL+EQ+ERY+DMA AMK VTE G ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTE S +KQ  A EYR ++E EL  IC +VL LL  YLIP   K+   ES+VF+LKM+GDYYRYLAEVA+   ++ +V +S NAY  A   A +K+  THPIRLGLALNFSVFYYEI N+  +AC+LAK AFDDAIA++D L EDSYKDSTLIMQLLRDNLTLWTSD QGD+ E
Sbjct:    6 KEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIP---KASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKNAYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAE 241          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Fly
Match: 14-3-3zeta (gene:FBgn0004907 transcript:FBtr0088412)

HSP 1 Score: 301.597 bits (771), Expect = 8.316e-102
Identity = 165/239 (69.04%), Postives = 192/239 (80.33%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSA-SKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNE 904
            +EELV  AKL+EQ+ERY+DMA AMK VTE G ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTE S +KQ  A EYR ++E EL  IC +VL LL  YLIP   K+   ES+VF+LKM+GDYYRYLAEVA+   ++ +V +S NAY  A   A +K+  THPIRLGLALNFSVFYYEI N+  +AC+LAK AFDDAIA++D L EDSYKDSTLIMQLLRDNLTLWTSD QGD+ E
Sbjct:    6 KEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIP---KASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKNAYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAE 241          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Fly
Match: 14-3-3zeta (gene:FBgn0004907 transcript:FBtr0100182)

HSP 1 Score: 301.597 bits (771), Expect = 8.316e-102
Identity = 165/239 (69.04%), Postives = 192/239 (80.33%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSA-SKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNE 904
            +EELV  AKL+EQ+ERY+DMA AMK VTE G ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTE S +KQ  A EYR ++E EL  IC +VL LL  YLIP   K+   ES+VF+LKM+GDYYRYLAEVA+   ++ +V +S NAY  A   A +K+  THPIRLGLALNFSVFYYEI N+  +AC+LAK AFDDAIA++D L EDSYKDSTLIMQLLRDNLTLWTSD QGD+ E
Sbjct:    6 KEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIP---KASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKNAYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAE 241          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Zebrafish
Match: ywhaba (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide a [Source:NCBI gene;Acc:323055])

HSP 1 Score: 311.612 bits (797), Expect = 1.495e-105
Identity = 169/240 (70.42%), Postives = 196/240 (81.67%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEG 907
            + +LV  AKL+EQAERY+DMA +MK VTE G ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTEG+EKKQ  A EYR KIE+EL  ICNDVL LL  YLIP A+   QAES+VF+LKM+GDYYRYL+EVAS  +K   V+NS  AY +A   S  ++  THPIRLGLALNFSVFYYEI N   +AC LAKTAFD+AIA++D L EDSYKDSTLIMQLLRDNLTLWTS++QGD+ + 
Sbjct:    3 KSDLVQKAKLAEQAERYDDMAASMKAVTEGGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNEKKQQMAREYREKIEAELQEICNDVLGLLEKYLIPNAS---QAESKVFYLKMKGDYYRYLSEVASGDSKRTTVENSQKAYQDAFEISKKEMQPTHPIRLGLALNFSVFYYEILNTPEQACSLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGDEGDA 239          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Zebrafish
Match: ywhabb (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide b [Source:NCBI gene;Acc:406419])

HSP 1 Score: 305.449 bits (781), Expect = 3.245e-103
Identity = 167/237 (70.46%), Postives = 197/237 (83.12%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSASK-LHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDD 898
            + +LV  AKL+EQAERY+DMA AMK VTE G ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTEG+EKKQ  A EYR KIE+EL  IC+DVL LL  YLI  A+   QAES+VF+LKM+GDYYRYL+EVAS ++K+  V+NS  AY +A   + K +  THPIRLGLALNFSVFYYEI N+   AC+LAKTAFD+AIA++D L EDSYKDSTLIMQLLRDNLTLWTS++QG++
Sbjct:    3 KSDLVQKAKLAEQAERYDDMAAAMKAVTEGGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNEKKQQMAREYREKIETELQDICSDVLGLLEKYLIANAS---QAESKVFYLKMKGDYYRYLSEVASGESKATTVENSQKAYQDAFDISKKDMQPTHPIRLGLALNFSVFYYEILNSPENACQLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGEE 236          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Zebrafish
Match: ywhabl (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide like [Source:ZFIN;Acc:ZDB-GENE-030131-448])

HSP 1 Score: 303.908 bits (777), Expect = 1.403e-102
Identity = 166/236 (70.34%), Postives = 191/236 (80.93%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGD 895
            + ELV  AKL+EQAERY+DMA AMK VTE   ELSNEERNLLSVAYKNVVGARRS+WRV++SIEQK EGS+KKQ    EYR KIE EL  ICNDVL LL  YLIP AT    AES VF+LKM+GDY+RYLAEVA  + K+ I+ NS  AY +A   S +++  THPIRLGLALNFSVFYYEI N+  +ACKLAKTAFD+AIA++D L E+SYKDSTLIMQLLRDNLTLWTSD+QG+
Sbjct:    3 KSELVQKAKLAEQAERYDDMAAAMKAVTEGDIELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKMEGSDKKQQMVKEYREKIEKELKEICNDVLVLLDKYLIPKATP---AESRVFYLKMKGDYFRYLAEVAVGEEKNSIIGNSQEAYKDAFEISKAEMQPTHPIRLGLALNFSVFYYEILNSPEQACKLAKTAFDEAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDNQGE 235          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Zebrafish
Match: ywhabl (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide like [Source:ZFIN;Acc:ZDB-GENE-030131-448])

HSP 1 Score: 303.908 bits (777), Expect = 1.403e-102
Identity = 166/236 (70.34%), Postives = 191/236 (80.93%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGD 895
            + ELV  AKL+EQAERY+DMA AMK VTE   ELSNEERNLLSVAYKNVVGARRS+WRV++SIEQK EGS+KKQ    EYR KIE EL  ICNDVL LL  YLIP AT    AES VF+LKM+GDY+RYLAEVA  + K+ I+ NS  AY +A   S +++  THPIRLGLALNFSVFYYEI N+  +ACKLAKTAFD+AIA++D L E+SYKDSTLIMQLLRDNLTLWTSD+QG+
Sbjct:    3 KSELVQKAKLAEQAERYDDMAAAMKAVTEGDIELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKMEGSDKKQQMVKEYREKIEKELKEICNDVLVLLDKYLIPKATP---AESRVFYLKMKGDYFRYLAEVAVGEEKNSIIGNSQEAYKDAFEISKAEMQPTHPIRLGLALNFSVFYYEILNSPEQACKLAKTAFDEAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDNQGE 235          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Zebrafish
Match: ywhabl (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide like [Source:ZFIN;Acc:ZDB-GENE-030131-448])

HSP 1 Score: 303.908 bits (777), Expect = 1.403e-102
Identity = 166/236 (70.34%), Postives = 191/236 (80.93%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGD 895
            + ELV  AKL+EQAERY+DMA AMK VTE   ELSNEERNLLSVAYKNVVGARRS+WRV++SIEQK EGS+KKQ    EYR KIE EL  ICNDVL LL  YLIP AT    AES VF+LKM+GDY+RYLAEVA  + K+ I+ NS  AY +A   S +++  THPIRLGLALNFSVFYYEI N+  +ACKLAKTAFD+AIA++D L E+SYKDSTLIMQLLRDNLTLWTSD+QG+
Sbjct:    3 KSELVQKAKLAEQAERYDDMAAAMKAVTEGDIELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKMEGSDKKQQMVKEYREKIEKELKEICNDVLVLLDKYLIPKATP---AESRVFYLKMKGDYFRYLAEVAVGEEKNSIIGNSQEAYKDAFEISKAEMQPTHPIRLGLALNFSVFYYEILNSPEQACKLAKTAFDEAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDNQGE 235          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Xenopus
Match: edf1 (endothelial differentiation related factor 1 [Source:Xenbase;Acc:XB-GENE-975205])

HSP 1 Score: 303.138 bits (775), Expect = 4.059e-102
Identity = 167/239 (69.87%), Postives = 193/239 (80.75%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNE 904
            + ELV  AKL+EQAERY+DMA  MK+VTE G ELSNEERNLLSVAYKNVVGARRS+WRV++SIEQKTEG+EKKQ  + EYR KIE+EL  ICNDVL LL  +LI  A+   Q ES+VF+LKM+GDYYRYLAEVAS   K+DIV  S  AY +A   S +++  THPIRLGLALNFSVFYYEI N   +AC LAK AFD+AIA++D L E+SYKDSTLIMQLLRDNLTLWTSD QGD+ E
Sbjct:    3 KNELVQKAKLAEQAERYDDMAACMKRVTEEGGELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQEMSREYREKIEAELREICNDVLNLLDKFLIANAS---QPESKVFYLKMKGDYYRYLAEVASGDAKADIVAQSQKAYQDAFDISKTEMQPTHPIRLGLALNFSVFYYEILNCPEKACSLAKAAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAE 238          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Xenopus
Match: ywhab (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta [Source:NCBI gene;Acc:496529])

HSP 1 Score: 300.442 bits (768), Expect = 4.759e-101
Identity = 162/237 (68.35%), Postives = 193/237 (81.43%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDD 898
            + ELV  AKLSEQAERY+DMA +MK VTE+G ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTEG++K+Q  A EYR K+E+EL  IC DVL LL  YL+P AT     ES+VF+LKM+GDYYRYL+EVAS  +K + V  S  AY  A   S S++  THPIRLGLALNFSVFYYEI N+  +AC LAK+AFD+AIA++D L E+SYKDSTLIMQLLRDNLTLWTS++QG++
Sbjct:    4 KSELVQKAKLSEQAERYDDMAASMKAVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNDKRQQMAREYREKVETELQDICKDVLGLLDKYLVPNATP---PESKVFYLKMKGDYYRYLSEVASGDSKQETVTCSQQAYQEAFEISKSEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKSAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGEE 237          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Xenopus
Match: insm1 (insulinoma associated 1 [Source:Xenbase;Acc:XB-GENE-993149])

HSP 1 Score: 287.73 bits (735), Expect = 4.846e-96
Identity = 160/239 (66.95%), Postives = 191/239 (79.92%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKT--EGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDD 898
            RE+LV  A+L+EQAERY+DMA AMK VTE+ E LSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKT  +G+EKK      YR KIE EL A+C DVL LL ++LI   +++ Q ES+VF+LKM+GDYYRYLAEVA+ + ++ +V++S  AY  A   S   +  THPIRLGLALN+SVFYYEI+N   +AC LAKTAFDDAIA++D L EDSYKDSTLIMQLLRDNLTLWTSD Q DD
Sbjct:    4 REQLVQKARLAEQAERYDDMAAAMKAVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNFLIKNCSET-QYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDD 241          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Xenopus
Match: ywhab (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta [Source:NCBI gene;Acc:496529])

HSP 1 Score: 285.804 bits (730), Expect = 2.049e-95
Identity = 157/231 (67.97%), Postives = 186/231 (80.52%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTS 880
            + ELV  AKLSEQAERY+DMA +MK VTE+G ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTEG++K+Q  A EYR K+E+EL  IC DVL LL  YL+P AT     ES+VF+LKM+GDYYRYL+EVAS  +K + V  S  AY  A   S S++  THPIRLGLALNFSVFYYEI N+  +AC LAK+AFD+AIA++D L E+SYKDSTLIMQLLRDNLT+ T+
Sbjct:    3 KSELVQKAKLSEQAERYDDMAASMKAVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNDKRQQMAREYREKVETELQDICKDVLGLLDKYLVPNATP---PESKVFYLKMKGDYYRYLSEVASGDSKQETVTCSQQAYQEAFEISKSEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKSAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTVTTN 230          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Xenopus
Match: edf1 (endothelial differentiation related factor 1 [Source:Xenbase;Acc:XB-GENE-975205])

HSP 1 Score: 283.493 bits (724), Expect = 1.257e-94
Identity = 159/231 (68.83%), Postives = 185/231 (80.09%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTS 880
            + ELV  AKL+EQAERY+DMA  MK+VTE G ELSNEERNLLSVAYKNVVGARRS+WRV++SIEQKTEG+EKKQ  + EYR KIE+EL  ICNDVL LL  +LI  A+   Q ES+VF+LKM+GDYYRYLAEVAS   K+DIV  S  AY +A   S +++  THPIRLGLALNFSVFYYEI N   +AC LAK AFD+AIA++D L E+SYKDSTLIMQLLRDNLT  T+
Sbjct:    3 KNELVQKAKLAEQAERYDDMAACMKRVTEEGGELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQEMSREYREKIEAELREICNDVLNLLDKFLIANAS---QPESKVFYLKMKGDYYRYLAEVASGDAKADIVAQSQKAYQDAFDISKTEMQPTHPIRLGLALNFSVFYYEILNCPEKACSLAKAAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTGITN 230          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Mouse
Match: Ywhaz (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [Source:MGI Symbol;Acc:MGI:109484])

HSP 1 Score: 308.145 bits (788), Expect = 3.132e-104
Identity = 168/240 (70.00%), Postives = 192/240 (80.00%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEG 907
            + ELV  AKL+EQAERY+DMA  MK VTE G ELSNEERNLLSVAYKNVVGARRS+WRV++SIEQKTEG+EKKQ  A EYR KIE+EL  ICNDVL LL  +LIP A+   Q ES+VF+LKM+GDYYRYLAEVA+  +K  IV  S  AY  A   S  ++  THPIRLGLALNFSVFYYEI N+  +AC LAKTAFD+AIA++D L E+SYKDSTLIMQLLRDNLTLWTSD QGD+ E 
Sbjct:    3 KNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNAS---QPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEA 239          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Mouse
Match: Ywhaz (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [Source:MGI Symbol;Acc:MGI:109484])

HSP 1 Score: 308.145 bits (788), Expect = 3.132e-104
Identity = 168/240 (70.00%), Postives = 192/240 (80.00%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEG 907
            + ELV  AKL+EQAERY+DMA  MK VTE G ELSNEERNLLSVAYKNVVGARRS+WRV++SIEQKTEG+EKKQ  A EYR KIE+EL  ICNDVL LL  +LIP A+   Q ES+VF+LKM+GDYYRYLAEVA+  +K  IV  S  AY  A   S  ++  THPIRLGLALNFSVFYYEI N+  +AC LAKTAFD+AIA++D L E+SYKDSTLIMQLLRDNLTLWTSD QGD+ E 
Sbjct:    3 KNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNAS---QPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEA 239          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Mouse
Match: Ywhaz (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [Source:MGI Symbol;Acc:MGI:109484])

HSP 1 Score: 308.145 bits (788), Expect = 3.132e-104
Identity = 168/240 (70.00%), Postives = 192/240 (80.00%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEG 907
            + ELV  AKL+EQAERY+DMA  MK VTE G ELSNEERNLLSVAYKNVVGARRS+WRV++SIEQKTEG+EKKQ  A EYR KIE+EL  ICNDVL LL  +LIP A+   Q ES+VF+LKM+GDYYRYLAEVA+  +K  IV  S  AY  A   S  ++  THPIRLGLALNFSVFYYEI N+  +AC LAKTAFD+AIA++D L E+SYKDSTLIMQLLRDNLTLWTSD QGD+ E 
Sbjct:    3 KNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNAS---QPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEA 239          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Mouse
Match: Ywhab (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide [Source:MGI Symbol;Acc:MGI:1891917])

HSP 1 Score: 305.449 bits (781), Expect = 3.265e-103
Identity = 168/240 (70.00%), Postives = 194/240 (80.83%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEG 907
            + ELV  AKL+EQAERY+DMA AMK VTE G ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTE +EKKQ    EYR KIE+EL  ICNDVL+LL  YLI  AT   QAES+VF+LKM+GDY+RYL+EVAS +NK   V NS  AY  A   S  ++  THPIRLGLALNFSVFYYEI N+  +AC LAKTAFD+AIA++D L E+SYKDSTLIMQLLRDNLTLWTS++QGD+ + 
Sbjct:    5 KSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNAT---QAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDA 241          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Mouse
Match: Ywhag (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide [Source:MGI Symbol;Acc:MGI:108109])

HSP 1 Score: 289.271 bits (739), Expect = 7.827e-97
Identity = 161/239 (67.36%), Postives = 191/239 (79.92%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKT--EGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDD 898
            RE+LV  A+L+EQAERY+DMA AMK VTE+ E LSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKT  +G+EKK      YR KIE EL A+C DVL LL +YLI   +++ Q ES+VF+LKM+GDYYRYLAEVA+ + ++ +V++S  AY  A   S   +  THPIRLGLALN+SVFYYEI+N   +AC LAKTAFDDAIA++D L EDSYKDSTLIMQLLRDNLTLWTSD Q DD
Sbjct:    4 REQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSET-QYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDD 241          
BLAST of 14-3-3 protein beta/alpha vs. UniProt/SwissProt
Match: sp|Q2F637|1433Z_BOMMO (14-3-3 protein zeta OS=Bombyx mori OX=7091 GN=14-3-3zeta PE=2 SV=2)

HSP 1 Score: 312.768 bits (800), Expect = 3.311e-105
Identity = 168/239 (70.29%), Postives = 197/239 (82.43%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNE 904
            +EELV  AKL+EQAERY+DMA AMK+VTE G ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTEGSE+KQ  A EYR+K+E EL  IC DVL LL  +LIP   K+   ES+VF+LKM+GDYYRYLAEVA+ + +  +V++S  AY +A   S +K+  THPIRLGLALNFSVFYYEI N+  +AC+LAK AFDDAIA++D L EDSYKDSTLIMQLLRDNLTLWTSD QGD +E
Sbjct:    5 KEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIP---KASNPESKVFYLKMKGDYYRYLAEVATGETRHSVVEDSQKAYQDAFEISKAKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDE 240          
BLAST of 14-3-3 protein beta/alpha vs. UniProt/SwissProt
Match: sp|P41932|14331_CAEEL (14-3-3-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=par-5 PE=1 SV=2)

HSP 1 Score: 312.383 bits (799), Expect = 4.751e-105
Identity = 172/238 (72.27%), Postives = 196/238 (82.35%), Query Frame = 2
Query:  194 EELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSAS-KLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNE 904
            EELV  AKL+EQAERY+DMA AMKKVTE G+ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTEGSEKKQ  A EYR+K+E ELN IC DVLKLL ++LI    K+G AES+VF+LKM+GDYYRYLAEVA S++++ +V+ S  AY  A   A  K+  THPIRLGLALNFSVFYYEI N    AC+LAK AFDDAIA++D L EDSYKDSTLIMQLLRDNLTLWTSD   +D E
Sbjct:    6 EELVQRAKLAEQAERYDDMAAAMKKVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQLAKEYRVKVEQELNDICQDVLKLLDEFLI---VKAGAAESKVFYLKMKGDYYRYLAEVA-SEDRAAVVEKSQKAYQEALDIAKDKMQPTHPIRLGLALNFSVFYYEILNTPEHACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDVGAEDQE 239          
BLAST of 14-3-3 protein beta/alpha vs. UniProt/SwissProt
Match: sp|Q5PRD0|143BA_DANRE (14-3-3 protein beta/alpha-A OS=Danio rerio OX=7955 GN=ywhaba PE=2 SV=2)

HSP 1 Score: 311.612 bits (797), Expect = 1.129e-104
Identity = 169/240 (70.42%), Postives = 196/240 (81.67%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEG 907
            + +LV  AKL+EQAERY+DMA +MK VTE G ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTEG+EKKQ  A EYR KIE+EL  ICNDVL LL  YLIP A+   QAES+VF+LKM+GDYYRYL+EVAS  +K   V+NS  AY +A   S  ++  THPIRLGLALNFSVFYYEI N   +AC LAKTAFD+AIA++D L EDSYKDSTLIMQLLRDNLTLWTS++QGD+ + 
Sbjct:    3 KSDLVQKAKLAEQAERYDDMAASMKAVTEGGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNEKKQQMAREYREKIEAELQEICNDVLGLLEKYLIPNAS---QAESKVFYLKMKGDYYRYLSEVASGDSKRTTVENSQKAYQDAFEISKKEMQPTHPIRLGLALNFSVFYYEILNTPEQACSLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGDEGDA 239          
BLAST of 14-3-3 protein beta/alpha vs. UniProt/SwissProt
Match: sp|Q5ZKC9|1433Z_CHICK (14-3-3 protein zeta OS=Gallus gallus OX=9031 GN=YWHAZ PE=2 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 2.151e-104
Identity = 169/240 (70.42%), Postives = 194/240 (80.83%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEG 907
            + ELV  AKL+EQAERY+DMA  MK VTE G ELSNEERNLLSVAYKNVVGARRS+WRV++SIEQKTEG+EKKQ  A EYR KIE+EL  ICNDVL LL  +LIP A+   QAES+VF+LKM+GDYYRYLAEVA+  +K  IV+ S  AY  A   S  ++  THPIRLGLALNFSVFYYEI N+  +AC LAKTAFD+AIA++D L E+SYKDSTLIMQLLRDNLTLWTSD QGD+ E 
Sbjct:    3 KNELVQKAKLAEQAERYDDMASCMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNAS---QAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVEQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEA 239          
BLAST of 14-3-3 protein beta/alpha vs. UniProt/SwissProt
Match: sp|Q20655|14332_CAEEL (14-3-3-like protein 2 OS=Caenorhabditis elegans OX=6239 GN=ftt-2 PE=1 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 3.164e-104
Identity = 169/244 (69.26%), Postives = 197/244 (80.74%), Query Frame = 2
Query:  188 SREELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSAS-KLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEGVDT 916
             +EELV+ AKL+EQAERY+DMA +MKKVTE+G ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTEGSEKKQ  A EYR K+E EL  IC DVL LL  +LIP   K+G AES+VF+LKM+GDYYRYLAEVAS  +++ +V+ S  +Y  A   A  K+  THPIRLGLALNFSVF+YEI N   +AC+LAK AFDDAIA++D L EDSYKDSTLIMQLLRDNLTLWTSD   DD +  +T
Sbjct:    4 GKEELVNRAKLAEQAERYDDMAASMKKVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQMAKEYREKVEKELRDICQDVLNLLDKFLIP---KAGAAESKVFYLKMKGDYYRYLAEVASGDDRNSVVEKSQQSYQEAFDIAKDKMQPTHPIRLGLALNFSVFFYEILNAPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAATDDTDANET 244          
BLAST of 14-3-3 protein beta/alpha vs. TrEMBL
Match: A0A1V0M3W3 (14-3-3 alpha protein OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 327.02 bits (837), Expect = 4.530e-108
Identity = 179/248 (72.18%), Postives = 208/248 (83.87%), Query Frame = 2
Query:  167 WIEE-QFKSREELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSASK-LHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNE 904
            WI+  Q  SR+ELVHIAKL+EQAERY+DMA AMK+VTE G ELSNEERNLLSVAYKNVVG+RRS+WRVI+SIEQKTEG+EKK  F+++YRLKIE+EL+ IC DVLKLL D+LIP AT S   ES VFFLKM+GDYYRYLAEVAS + K + V+ S++AY NAT  A K L TTHPIRLGLALN+SVF+YEIKN    AC+LA+TAFD AIA+ID LQE+SYKDSTLIMQLLRDNLTLWTS+   +  E
Sbjct:   10 WIDSSQIGSRDELVHIAKLAEQAERYDDMAIAMKRVTEKGFELSNEERNLLSVAYKNVVGSRRSSWRVISSIEQKTEGNEKKVKFSSDYRLKIETELHDICRDVLKLLKDHLIPKATVS---ESVVFFLKMEGDYYRYLAEVASGEIKEEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARTAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDTEPGE 254          
BLAST of 14-3-3 protein beta/alpha vs. TrEMBL
Match: A0A4U5UCS2 (14-3-3 protein beta/alpha-1 OS=Collichthys lucidus OX=240159 GN=D9C73_004730 PE=3 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 6.289e-106
Identity = 172/242 (71.07%), Postives = 201/242 (83.06%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEGVD 913
            + +LV  AKL+EQAERY+DMA AMK VTE G+ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKT+GSEKKQ  A EYR+KIE+EL  IC DVL LL DYLIP+AT   QAES VF+LKM+GDY+RYL+EVAS  +K D V+NS  AY +A + S  ++  THPIRLGLALNFSVFYYEI N+  +AC LAK AFD+AIA++D L EDSYKDSTLIMQLLRDNLTLWTS++QGD+ E  D
Sbjct:    3 KNDLVQKAKLAEQAERYDDMAAAMKAVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTDGSEKKQQMAREYRMKIEAELQEICQDVLNLLGDYLIPIAT---QAESRVFYLKMKGDYFRYLSEVASGDSKKDTVENSQQAYQDAFNISKKEMQPTHPIRLGLALNFSVFYYEILNSPEQACSLAKQAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGDEGETGD 241          
BLAST of 14-3-3 protein beta/alpha vs. TrEMBL
Match: A0A0F8BQG8 (14-3-3 protein beta/alpha-1 OS=Larimichthys crocea OX=215358 GN=EH28_11076 PE=3 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 6.289e-106
Identity = 172/242 (71.07%), Postives = 201/242 (83.06%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEGVD 913
            + +LV  AKL+EQAERY+DMA AMK VTE G+ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKT+GSEKKQ  A EYR+KIE+EL  IC DVL LL DYLIP+AT   QAES VF+LKM+GDY+RYL+EVAS  +K D V+NS  AY +A + S  ++  THPIRLGLALNFSVFYYEI N+  +AC LAK AFD+AIA++D L EDSYKDSTLIMQLLRDNLTLWTS++QGD+ E  D
Sbjct:    3 KNDLVQKAKLAEQAERYDDMAAAMKAVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTDGSEKKQQMAREYRMKIEAELQEICQDVLNLLGDYLIPIAT---QAESRVFYLKMKGDYFRYLSEVASGDSKKDTVENSQQAYQDAFNISKKEMQPTHPIRLGLALNFSVFYYEILNSPEQACSLAKQAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGDEGETGD 241          
BLAST of 14-3-3 protein beta/alpha vs. TrEMBL
Match: A0A0F8AX46 (14-3-3 protein beta/alpha-1 OS=Larimichthys crocea OX=215358 GN=EH28_11077 PE=3 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 6.557e-106
Identity = 172/242 (71.07%), Postives = 201/242 (83.06%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEGVD 913
            + +LV  AKL+EQAERY+DMA AMK VTE G+ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKT+GSEKKQ  A EYR+KIE+EL  IC DVL LL DYLIP+AT   QAES VF+LKM+GDY+RYL+EVAS  +K D V+NS  AY +A + S  ++  THPIRLGLALNFSVFYYEI N+  +AC LAK AFD+AIA++D L EDSYKDSTLIMQLLRDNLTLWTS++QGD+ E  D
Sbjct:   36 KNDLVQKAKLAEQAERYDDMAAAMKAVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTDGSEKKQQMAREYRMKIEAELQEICQDVLNLLGDYLIPIAT---QAESRVFYLKMKGDYFRYLSEVASGDSKKDTVENSQQAYQDAFNISKKEMQPTHPIRLGLALNFSVFYYEILNSPEQACSLAKQAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGDEGETGD 274          
BLAST of 14-3-3 protein beta/alpha vs. TrEMBL
Match: A0A4U5UBF7 (14-3-3 protein beta/alpha-1 OS=Collichthys lucidus OX=240159 GN=D9C73_004714 PE=3 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 8.330e-106
Identity = 172/242 (71.07%), Postives = 201/242 (83.06%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEGVD 913
            + +LV  AKL+EQAERY+DMA AMK VTE G+ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKT+GSEKKQ  A EYR+KIE+EL  IC DVL LL DYLIP+AT   QAES VF+LKM+GDY+RYL+EVAS  +K D V+NS  AY +A + S  ++  THPIRLGLALNFSVFYYEI N+  +AC LAK AFD+AIA++D L EDSYKDSTLIMQLLRDNLTLWTS++QGD+ E  D
Sbjct:   21 KNDLVQKAKLAEQAERYDDMAAAMKAVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTDGSEKKQQMAREYRMKIEAELQEICQDVLNLLGDYLIPIAT---QAESRVFYLKMKGDYFRYLSEVASGDSKKDTVENSQQAYQDAFNISKKEMQPTHPIRLGLALNFSVFYYEILNSPEQACSLAKQAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGDEGETGD 259          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Cavefish
Match: ywhabb (14-3-3 protein beta/alpha-A-like [Source:NCBI gene;Acc:103023259])

HSP 1 Score: 312.768 bits (800), Expect = 4.308e-106
Identity = 170/237 (71.73%), Postives = 197/237 (83.12%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSASK-LHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDD 898
            + +LV  AKL+EQAERY+DMA AMK VTE G ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTEG+EKKQ  A EYR KIESEL  ICNDVL LL  +LIP A+   QAES+VF+LKM+GDYYRYL+EVAS ++K+  V NS  AY +A   + K +  THPIRLGLALNFSVFYYEI N+  +AC LAKTAFD+AIA++D L EDSYKDSTLIMQLLRDNLTLWTS++QGD+
Sbjct:    3 KSDLVQKAKLAEQAERYDDMATAMKAVTEGGMELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNEKKQQMAREYREKIESELQEICNDVLGLLEKFLIPNAS---QAESKVFYLKMKGDYYRYLSEVASGESKTTTVDNSQKAYQDAFEISKKDMQPTHPIRLGLALNFSVFYYEILNSPEKACNLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGDE 236          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Cavefish
Match: ywhaba (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta [Source:NCBI gene;Acc:103026368])

HSP 1 Score: 311.612 bits (797), Expect = 1.634e-105
Identity = 169/237 (71.31%), Postives = 195/237 (82.28%), Query Frame = 2
Query:  197 ELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNE 904
            +LV  AKL+EQAERY+DMA +MK VTE G ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTEG+EKKQ  A EYR KIE+EL  ICNDVL LL  YLIP A+   QAES+VF+LKM+GDYYRYL+EVAS ++K   V NS  AY +A   S  ++  THPIRLGLALNFSVFYYEI N   +AC LAKTAFD+AIA++D L EDSYKDSTLIMQLLRDNLTLWTS++QGD+ +
Sbjct:   14 DLVQKAKLAEQAERYDDMAASMKAVTEGGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNEKKQQMAREYREKIETELQDICNDVLGLLEKYLIPNAS---QAESKVFYLKMKGDYYRYLSEVASGESKRTTVDNSQKAYQDAFEISKKEMQPTHPIRLGLALNFSVFYYEILNTPEQACSLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGDEGD 247          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Cavefish
Match: ywhaba (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta [Source:NCBI gene;Acc:103026368])

HSP 1 Score: 310.842 bits (795), Expect = 2.070e-105
Identity = 169/240 (70.42%), Postives = 196/240 (81.67%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEG 907
            + +LV  AKL+EQAERY+DMA +MK VTE G ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTEG+EKKQ  A EYR KIE+EL  ICNDVL LL  YLIP A+   QAES+VF+LKM+GDYYRYL+EVAS ++K   V NS  AY +A   S  ++  THPIRLGLALNFSVFYYEI N   +AC LAKTAFD+AIA++D L EDSYKDSTLIMQLLRDNLTLWTS++QGD+ + 
Sbjct:    3 KSDLVQKAKLAEQAERYDDMAASMKAVTEGGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNEKKQQMAREYREKIETELQDICNDVLGLLEKYLIPNAS---QAESKVFYLKMKGDYYRYLSEVASGESKRTTVDNSQKAYQDAFEISKKEMQPTHPIRLGLALNFSVFYYEILNTPEQACSLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGDEGDA 239          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Cavefish
Match: ywhabl (14-3-3 protein beta/alpha-A-like [Source:NCBI gene;Acc:103045356])

HSP 1 Score: 303.138 bits (775), Expect = 2.414e-102
Identity = 167/234 (71.37%), Postives = 193/234 (82.48%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQ 889
            + ELV  AKL+EQAERY+DMA AMK VTE   ELSNEERNLLSVAYKNVVGARRS+WRV++SIEQKTEGS+KKQ  A EYR KIE EL  ICNDVL LL  YLIP AT    AES+VF+LKM+GDY+RYLAEVA   +K  I++NS +AY +A   S +++  THPIRLGLALNFSVFYYEI N+  +ACKLAKTAFD+AIA++D L E+SYKDSTLIMQLLRDNLTLWTSD+Q
Sbjct:    3 KSELVQKAKLAEQAERYDDMAAAMKAVTEGDVELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGSDKKQQMAKEYREKIEKELKEICNDVLVLLDKYLIPKATP---AESKVFYLKMKGDYFRYLAEVALGDDKIAIIQNSQDAYKDAFEISKAEMQPTHPIRLGLALNFSVFYYEILNSPEQACKLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSDNQ 233          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Cavefish
Match: ywhaqa (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta [Source:NCBI gene;Acc:103042311])

HSP 1 Score: 295.819 bits (756), Expect = 1.608e-99
Identity = 162/233 (69.53%), Postives = 186/233 (79.83%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDD 886
            + EL+  AKL+EQAERY+DMA +MK VTE G EL+NEERNLLSVAYKNVVGARRSAWRVI+SIEQKTEGS+KK     EYR K+E EL  ICNDVL LL  YLI     S  AES+VF+LKM+GDYYRYLAEVAS  +K D + NS +AY +A   S  ++  THPIRLGLALNFSVFYYEI N+  +AC LAK AFD+AIA++D L EDSYKDSTLIMQLLRDNLTLWTSD+
Sbjct:    3 KTELIQKAKLAEQAERYDDMAASMKLVTEQGSELTNEERNLLSVAYKNVVGARRSAWRVISSIEQKTEGSDKKLQMVKEYREKVEEELREICNDVLGLLSKYLIE---NSSSAESKVFYLKMKGDYYRYLAEVASGDDKKDTISNSQSAYQDAFDISKKEMQPTHPIRLGLALNFSVFYYEILNSPEQACALAKQAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDN 232          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Sea Lamprey
Match: ywhaqb (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide b [Source:ZFIN;Acc:ZDB-GENE-030131-7135])

HSP 1 Score: 290.426 bits (742), Expect = 4.992e-98
Identity = 163/237 (68.78%), Postives = 190/237 (80.17%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDD 898
            + ELV  AKL+EQAERY+DM+ AMK VTE G ELSNEERNLLSVAYKNVVGARRSAWRVI+SIEQK++ S+KKQ  A EYR K+E EL  ICNDVL LL  +LI  AT    AES+VF+ KM+GDYYRYLAEVA   +K+  ++ S  AYL+A   S +++  THPIRLGLALNFSVFYYEI N+  +AC LAKTAFD+AIA++D L EDSYKDSTLIMQLLRDNLTLW SD QG+D
Sbjct:    5 KSELVQKAKLAEQAERYDDMSAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSAWRVISSIEQKSDASDKKQHMAKEYRHKVEKELCDICNDVLALLDKHLIVSAT---SAESKVFYQKMKGDYYRYLAEVAVGIDKASAMERSQAAYLSAFDVSKAEMSPTHPIRLGLALNFSVFYYEILNSPEKACNLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWASDAQGED 238          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005915.1 (pep scaffold:Pmarinus_7.0:GL476980:154455:158510:1 gene:ENSPMAG00000005339.1 transcript:ENSPMAT00000005915.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 286.189 bits (731), Expect = 2.714e-96
Identity = 159/239 (66.53%), Postives = 185/239 (77.41%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKT--EGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSASK-LHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDD 898
            RE LV  A+L+EQAERY+DMA AMK VTE+ E LSNEERNLLSVAYKNVVGARRSAWRVI+SIEQKT  +GSEKKQ     YR K+E EL  +C DVL LL  +L+  +    Q ES+VF+LKM+GDY+RYLAEVA+   +  +V NS  AY  A     + +  THPIRLGLALNFSVFYYEI+N   +AC+LAKTAFDD+IA++D L EDSYKDSTLIMQLLRDNLTLWTSD Q DD
Sbjct:    4 RELLVQKARLAEQAERYDDMAAAMKAVTELNEPLSNEERNLLSVAYKNVVGARRSAWRVISSIEQKTAGDGSEKKQAMVKAYREKVEKELETVCQDVLDLLDKFLVK-SCDDSQQESKVFYLKMKGDYFRYLAEVAAGDKRDGVVLNSEKAYKEAYEICKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACELAKTAFDDSIAELDSLNEDSYKDSTLIMQLLRDNLTLWTSDRQQDD 241          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007337.1 (pep scaffold:Pmarinus_7.0:GL477279:15491:28515:1 gene:ENSPMAG00000006598.1 transcript:ENSPMAT00000007337.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 270.396 bits (690), Expect = 6.061e-90
Identity = 151/241 (62.66%), Postives = 183/241 (75.93%), Query Frame = 2
Query:  182 FKSREELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTE--GSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSAS-KLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGD 895
             + RE+ V+ AKL+EQAERY++M   MKKV  +  ELS EERNLLSVAYKNV+GARR++WR+I+SIEQK E  GSE K     EYR  +E EL  IC D+L++L  +LIP A      ES+VF+ KM+GDY+RYLAE A+  ++ +  +NSL AY  A+  A+ +L  THPIRLGLALNFSVFYYEI N+   ACKLAKTAFDDAIA++D L EDSYKDSTLIMQLLRDNLTLWTSD QGD
Sbjct:    1 MEEREDQVYQAKLAEQAERYDEMVEVMKKVAGLNTELSVEERNLLSVAYKNVIGARRASWRIISSIEQKEESKGSEGKLKIIREYRQTVEKELKDICMDILEVLDKHLIPAAM---TGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIATTELPPTHPIRLGLALNFSVFYYEILNSPDRACKLAKTAFDDAIAELDTLSEDSYKDSTLIMQLLRDNLTLWTSDMQGD 238          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011016.1 (pep scaffold:Pmarinus_7.0:GL483328:5531:6205:1 gene:ENSPMAG00000009989.1 transcript:ENSPMAT00000011016.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 257.684 bits (657), Expect = 1.446e-85
Identity = 143/218 (65.60%), Postives = 170/218 (77.98%), Query Frame = 2
Query:  254 CAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKT--EGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDD 898
            C  ++VTE+ E LSNEERNLLSVAYKNVVGARRSAWRVI+SIEQKT  +G+EK+      YR KIE EL A+C DVL LL ++LIP      Q ES+VF+LKM+GDY+RYLAEVA+ + +  +V NS  AY  A   S  ++  THPIRLGLALNFSVFYYEI+N   +AC+LAKTAFD+AIA++D L EDSYKDSTLIMQLLRDNLTLWTSD Q D+
Sbjct:    3 CRRRQVTELTEPLSNEERNLLSVAYKNVVGARRSAWRVISSIEQKTATDGNEKRLGLVRSYREKIEQELEAVCGDVLNLLDNHLIPRCDHP-QYESKVFYLKMKGDYFRYLAEVATGEKRDHVVSNSEKAYKEAYEVSKEQMMPTHPIRLGLALNFSVFYYEIQNAPEQACQLAKTAFDEAIAELDSLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDE 219          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006708.1 (pep scaffold:Pmarinus_7.0:GL478275:1612:6605:-1 gene:ENSPMAG00000006053.1 transcript:ENSPMAT00000006708.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 243.432 bits (620), Expect = 9.005e-80
Identity = 135/223 (60.54%), Postives = 168/223 (75.34%), Query Frame = 2
Query:  245 DMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTE--GSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSAS-KLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNE 904
            +M  +MKKV  +  ELS EERNLLSVAYKNV+GARR++WR+I+SIEQK E  G E+K     EYR  +E EL +IC D+L +L  +LIP A+     ES+VF+ KM+GDY+RYLAE  ++ ++ +  +NSL AY  A+  A+ +L  THPIRLGLALNFSVFYYEI N+   AC+LAK AFDDAIA++D L E+SYKDSTLIMQLLRDNLTLWTSD QGD  E
Sbjct:    1 EMVESMKKVAALDVELSVEERNLLSVAYKNVIGARRASWRIISSIEQKEESKGGEEKLKLIREYRQMVEKELKSICGDILDVLDKHLIPTAS---TGESKVFYYKMKGDYHRYLAEFTTANDRKEAAENSLVAYKAASDIATTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDAEE 220          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Yeast
Match: BMH2 (14-3-3 protein, minor isoform; controls proteome at post-transcriptional level, binds proteins and DNA, involved in regulation of many processes including exocytosis, vesicle transport, Ras/MAPK signaling, and rapamycin-sensitive signaling; protein increases in abundance and relative distribution to the nucleus increases upon DNA replication stress; abundance relative to Bmh1p increases during sporulation [Source:SGD;Acc:S000002506])

HSP 1 Score: 259.225 bits (661), Expect = 1.317e-85
Identity = 143/237 (60.34%), Postives = 179/237 (75.53%), Query Frame = 2
Query:  185 KSREELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQM---FANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSAS-KLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSD 883
            ++RE+ V++AKL+EQAERYE+M   MK V   G+ELS EERNLLSVAYKNV+GARR++WR+++SIEQK E  EK +        YR KIE+EL  I +D+L +L  +LIP AT     ES+VF+ KM+GDY+RYLAE +S   +     +SL AY  A+  A+ +L  THPIRLGLALNFSVFYYEI+N+  +AC LAK AFDDAIA++D L E+SYKDSTLIMQLLRDNLTLWTSD
Sbjct:    3 QTREDSVYLAKLAEQAERYEEMVENMKAVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKEKSEHQVELIRSYRSKIETELTKISDDILSVLDSHLIPSATT---GESKVFYYKMKGDYHRYLAEFSSGDAREKATNSSLEAYKTASEIATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSD 236          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Yeast
Match: BMH1 (14-3-3 protein, major isoform; controls proteome at post-transcriptional level, binds proteins and DNA, involved in regulation of exocytosis, vesicle transport, Ras/MAPK and rapamycin-sensitive signaling, aggresome formation, spindle position checkpoint; protein increases in abundance and relative distribution to the nucleus increases upon DNA replication stress; antiapoptotic gene similar to human 14-3-3; BMH1 has a paralog, BMH2, that arose from whole genome duplication [Source:SGD;Acc:S000000979])

HSP 1 Score: 257.684 bits (657), Expect = 4.737e-85
Identity = 144/236 (61.02%), Postives = 177/236 (75.00%), Query Frame = 2
Query:  188 SREELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQM---FANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSAS-KLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSD 883
            SRE+ V++AKL+EQAERYE+M   MK V   G+ELS EERNLLSVAYKNV+GARR++WR+++SIEQK E  EK +        YR KIE+EL  I +D+L +L  +LIP AT     ES+VF+ KM+GDY+RYLAE +S   +      SL AY  A+  A+ +L  THPIRLGLALNFSVFYYEI+N+  +AC LAK AFDDAIA++D L E+SYKDSTLIMQLLRDNLTLWTSD
Sbjct:    4 SREDSVYLAKLAEQAERYEEMVENMKTVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKEKSEHQVELICSYRSKIETELTKISDDILSVLDSHLIPSATT---GESKVFYYKMKGDYHRYLAEFSSGDAREKATNASLEAYKTASEIATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSD 236          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Nematostella
Match: EDO42859 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0E0])

HSP 1 Score: 279.641 bits (714), Expect = 1.499e-93
Identity = 154/243 (63.37%), Postives = 183/243 (75.31%), Query Frame = 2
Query:  188 SREELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSA---SKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTS---DDQGDD 898
            S+EELV +AK +EQAERYEDMA AMK+ TE+ E L  EERNLLSVAYKNVVGA+RS+WRVI+SIEQK EGSE+K+     YR  IE+ELN +C  VLKLL   LIP A  +   ES+VF+LKM+GDYYRY  EVA +  + ++V+ ++ AY  A   A    KL  T PIRLGLALNFSVFYYEI  +  +AC LAK AFDDAIA++D L ED YKDSTLIMQLLRDNLTLW+S   +DQGDD
Sbjct:    3 SKEELVQMAKYAEQAERYEDMAKAMKEATEISETLEQEERNLLSVAYKNVVGAKRSSWRVISSIEQKLEGSERKKQNTETYRQTIENELNEVCETVLKLLESKLIPNAQST---ESKVFYLKMKGDYYRYEGEVAGADRRREVVQKAMKAYSEAQEIAEKDPKLPPTDPIRLGLALNFSVFYYEIVEDSKQACDLAKKAFDDAIAELDSLNEDQYKDSTLIMQLLRDNLTLWSSENQEDQGDD 242          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Nematostella
Match: EDO42175 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S252])

HSP 1 Score: 264.618 bits (675), Expect = 1.097e-87
Identity = 142/241 (58.92%), Postives = 185/241 (76.76%), Query Frame = 2
Query:  188 SREELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTS--DDQGDDNE 904
            SREEL+H+AK++EQAERY+DM  AM  VT+ G+ L++EERNLLSVAYKNVVGARRS+WRVI+S+EQK    E+      +YR  I +ELN  C +VL +L +YL+         E++VF+LKM+GDY+RYL EVA   ++ + ++ S  AY +A++ A +L  +HPIRLGLALNFSVFYYEI+N   EACKLAK AFDDAIA +D+L+++SYKDSTLIMQLLRDNLTLWTS  D +G D++
Sbjct:   10 SREELIHLAKMAEQAERYDDMVNAMSAVTKEGKPLNDEERNLLSVAYKNVVGARRSSWRVISSMEQK--APEEMAALTKKYREDITNELNGKCAEVLDILENYLLKDGQDDINTEAKVFYLKMRGDYHRYLVEVAEGDSRKENIEKSREAYKDASAKAEELSPSHPIRLGLALNFSVFYYEIENKPPEACKLAKEAFDDAIAVLDNLKDESYKDSTLIMQLLRDNLTLWTSEQDQEGQDDD 248          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Nematostella
Match: EDO41372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4S2])

HSP 1 Score: 254.603 bits (649), Expect = 9.667e-84
Identity = 147/243 (60.49%), Postives = 180/243 (74.07%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGS----EKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSASK-LHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNE 904
            +EE V++AKL+EQAERY+DM  +MK+V +MG ELS E+RNLLSVAYKNV+GARR++WR+ITSIEQK E       K +M  N YR  IE EL  IC ++L LL D LI     S   ES+VF+ KM+GDY+RY+AE  S + + +  K S  AY  A + A++ L  THPIRLGLALNFSVFYYEI+N   +ACKLAK AFDDAI+++D LQE+SYKDSTLIMQLLRDNLTLWTSD    D E
Sbjct:    4 KEEHVYMAKLAEQAERYDDMVNSMKEVAKMGTELSTEDRNLLSVAYKNVIGARRASWRIITSIEQKEESKGEDMAKLEMIRN-YRKTIEEELKTICGEILSLLDDSLIK---NSQSEESKVFYNKMKGDYHRYVAEF-SKEGRDEAAKQSETAYKEAQTIATEHLAKTHPIRLGLALNFSVFYYEIQNAPEKACKLAKEAFDDAISELDSLQEESYKDSTLIMQLLRDNLTLWTSDSTKGDGE 241          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Nematostella
Match: EDO42821 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0E3])

HSP 1 Score: 154.451 bits (389), Expect = 1.829e-44
Identity = 108/274 (39.42%), Postives = 152/274 (55.47%), Query Frame = 2
Query:  188 SREELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKT----EGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSD----------------------------------------IVKNSLNAYLNATSSASK-LHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLW 874
            SR ELV +AKL+EQ ER+ED+   MKK  E+   L+ E RNLLSV YKNVVG++R AWR +     ++      S+ K +   +Y+ KIE EL  +C ++L L+   L+  A     AE++VF+ KM GDY+RYLAE+ S + + D                                          + SL AY +A+S+A++ L  T P+RLGLALNF+VFY EI N    A   +K A+  A+ ++D L E+ Y+DS LIM LL DN+T+W
Sbjct:    4 SRNELVQLAKLAEQTERFEDVILYMKKAIEINPSLNKEHRNLLSVGYKNVVGSKRFAWRHLHHDALQSGRYIRDSQLKGII--KYKEKIEMELKTLCREILTLIETCLLDAAE---DAEAKVFYDKMTGDYWRYLAEIYSGKQQKDSYGTAVEHEDACDNYDASDNYIACGNYDACDIDNWYDDDEAAERSLGAYKHASSTAAEYLSPTDPVRLGLALNFAVFYKEILNEAEMAIMHSKQAYAAALPEMDSLSEEVYRDSNLIMHLLNDNITIW 272          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Medaka
Match: ENSORLT00000024336.2 (14-3-3 protein beta/alpha-1 [Source:NCBI gene;Acc:101154846])

HSP 1 Score: 308.531 bits (789), Expect = 2.050e-104
Identity = 167/242 (69.01%), Postives = 200/242 (82.64%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSASK-LHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEGVD 913
            + +LV  AKL+EQAERY+DMA AMK VTE G ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTEG+EKK+  A++YR+KIE+EL  IC+DVL LL  +LIP A+   QAES+VF+LKM+GDY+RYL+EVAS  +K D V+NS  AY +A   + K +  THPIRLGLALNFSVFYYEI N+  +AC LAK AFD+AIA++D L EDSYKDSTLIMQLLRDNLTLWTS++QGD+ E  D
Sbjct:    3 KNDLVQKAKLAEQAERYDDMAAAMKAVTEQGLELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNEKKRQMASDYRVKIEAELQEICHDVLNLLDKFLIPNAS---QAESKVFYLKMKGDYFRYLSEVASGDSKKDTVENSQQAYQDAFDISKKDMQPTHPIRLGLALNFSVFYYEILNSPEQACSLAKQAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGDEPETGD 241          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Medaka
Match: YWHAB (14-3-3 protein beta/alpha-1 [Source:NCBI gene;Acc:101167287])

HSP 1 Score: 303.138 bits (775), Expect = 2.475e-102
Identity = 168/242 (69.42%), Postives = 194/242 (80.17%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEGVD 913
            + +LV  AKL+EQAERY+DMA AMK VTE G ELSNEERNLLSVAYKNVVGARRS+WRVI+SIEQKTEG++KKQ  A EYR KIE+EL  IC+DVL LL ++LI  A+    AES+VF+LKM+GDYYRYL+EVAS   K D V NS  AY  A   S  ++  THPIRLGLALNFSVFYYEI NN  +AC LAKTAFD+AIA++D L EDSYKDSTLIMQLLRDNLTLWTS++Q D+ E  D
Sbjct:    3 KNDLVQKAKLAEQAERYDDMAAAMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNDKKQQMAREYREKIETELQDICHDVLGLLDNFLIANASS---AESKVFYLKMKGDYYRYLSEVASGDIKKDTVDNSQQAYQQAFDISKGEMQPTHPIRLGLALNFSVFYYEILNNPDKACSLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQADEGETGD 241          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Medaka
Match: ENSORLT00000027323.1 (14-3-3 protein zeta [Source:NCBI gene;Acc:101163516])

HSP 1 Score: 296.59 bits (758), Expect = 1.288e-99
Identity = 164/242 (67.77%), Postives = 195/242 (80.58%), Query Frame = 2
Query:  188 SREELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQ--GDDNE 904
             +++LV  AKL+EQAERY+DMA AMK VTE  E+LSNEERNLLSVAYKNVVGARRS+WRV++SIEQK EGS++K+  A EYR KIE EL  ICNDVL LL  +LIP   K+  AES+VF+LKM+GDYYRYLAEVAS ++K  I+ +S  AY  A   S  ++  THPIRLGLALN+SVF+YEI N+  EAC+LAK AFDDAIA++D L E+SYKDSTLIMQLLRDNLTLWTSD+Q  GDD E
Sbjct:   13 PQKDLVQKAKLAEQAERYDDMATAMKTVTEDSEQLSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKAEGSDRKKAMAQEYREKIEQELKDICNDVLGLLDKFLIP---KASTAESKVFYLKMKGDYYRYLAEVASKEDKKGIIGDSQAAYKEAFEISKMEMQPTHPIRLGLALNYSVFFYEILNSPEEACQLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDNQTEGDDAE 251          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Medaka
Match: ENSORLT00000032209.1 (14-3-3 protein zeta [Source:NCBI gene;Acc:101163516])

HSP 1 Score: 296.204 bits (757), Expect = 1.317e-99
Identity = 164/242 (67.77%), Postives = 195/242 (80.58%), Query Frame = 2
Query:  188 SREELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQ--GDDNE 904
             +++LV  AKL+EQAERY+DMA AMK VTE  E+LSNEERNLLSVAYKNVVGARRS+WRV++SIEQK EGS++K+  A EYR KIE EL  ICNDVL LL  +LIP   K+  AES+VF+LKM+GDYYRYLAEVAS ++K  I+ +S  AY  A   S  ++  THPIRLGLALN+SVF+YEI N+  EAC+LAK AFDDAIA++D L E+SYKDSTLIMQLLRDNLTLWTSD+Q  GDD E
Sbjct:    5 PQKDLVQKAKLAEQAERYDDMATAMKTVTEDSEQLSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKAEGSDRKKAMAQEYREKIEQELKDICNDVLGLLDKFLIP---KASTAESKVFYLKMKGDYYRYLAEVASKEDKKGIIGDSQAAYKEAFEISKMEMQPTHPIRLGLALNYSVFFYEILNSPEEACQLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDNQTEGDDAE 243          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Medaka
Match: ENSORLT00000003300.2 (14-3-3 protein zeta [Source:NCBI gene;Acc:101163516])

HSP 1 Score: 294.664 bits (753), Expect = 5.082e-99
Identity = 164/238 (68.91%), Postives = 192/238 (80.67%), Query Frame = 2
Query:  200 LVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATS-SASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQ--GDDNE 904
            LV  AKL+EQAERY+DMA AMK VTE  E+LSNEERNLLSVAYKNVVGARRS+WRV++SIEQK EGS++K+  A EYR KIE EL  ICNDVL LL  +LIP   K+  AES+VF+LKM+GDYYRYLAEVAS ++K  I+ +S  AY  A   S  ++  THPIRLGLALN+SVF+YEI N+  EAC+LAK AFDDAIA++D L E+SYKDSTLIMQLLRDNLTLWTSD+Q  GDD E
Sbjct:    9 LVQKAKLAEQAERYDDMATAMKTVTEDSEQLSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKAEGSDRKKAMAQEYREKIEQELKDICNDVLGLLDKFLIP---KASTAESKVFYLKMKGDYYRYLAEVASKEDKKGIIGDSQAAYKEAFEISKMEMQPTHPIRLGLALNYSVFFYEILNSPEEACQLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDNQTEGDDAE 243          
BLAST of 14-3-3 protein beta/alpha vs. Planmine SMEST
Match: SMESG000055903.1 (SMESG000055903.1)

HSP 1 Score: 503.442 bits (1295), Expect = 0.000e+0
Identity = 257/257 (100.00%), Postives = 257/257 (100.00%), Query Frame = 2
Query:  146 MTLISSPWIEEQFKSREELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEGVDT 916
            MTLISSPWIEEQFKSREELVHIAKLSEQAERYEDMACAMKKVTEMGEELSNEERNLLSVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEGVDT
Sbjct:    1 MTLISSPWIEEQFKSREELVHIAKLSEQAERYEDMACAMKKVTEMGEELSNEERNLLSVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSASKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEGVDT 257          
BLAST of 14-3-3 protein beta/alpha vs. Planmine SMEST
Match: SMESG000067831.1 (SMESG000067831.1)

HSP 1 Score: 323.168 bits (827), Expect = 3.620e-110
Identity = 178/249 (71.49%), Postives = 204/249 (81.93%), Query Frame = 2
Query:  167 WIEE-QFKSREELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSASK-LHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEG 907
            WI+  Q   REELVHIAKL+EQAERY+DMA AMK+VTE G ELSNEERNLLSVAYKNVVG+RRS+WRVI+SIEQKT+G+EKK  F+ EYRLKIE EL+ IC DVLKLL +YLIP AT S   ES VFFLKM+GDYYRYLAEVAS   K + V+ S++AY NAT  A K L TTHPIRLGLALN+SVF+YEIKN    AC+LA++AFD AIA+ID LQE+SYKDSTLIMQLLRDNLTLWTS+   +  E 
Sbjct:   10 WIDAVQVSVREELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNVVGSRRSSWRVISSIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATIS---ESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEA 255          
BLAST of 14-3-3 protein beta/alpha vs. Planmine SMEST
Match: SMESG000075252.1 (SMESG000075252.1)

HSP 1 Score: 255.758 bits (652), Expect = 8.185e-84
Identity = 139/233 (59.66%), Postives = 179/233 (76.82%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQM-FANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSA-SKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSD 883
            REE V+ AKL+EQAERYE+M  AM++V  M  +L+ EERNLLSVAYKNV+G+RR++WR+I+SIEQK E  + +++    ++R +IE EL  +C D++++L   L+  AT     E+ VFFLKM+GDYYRYLAE      + D  +NSL+AY  A++ A S+L  THPIRLGLALNFSVFYYEI N+   AC+LAK AFDDAIA++D+L E+SYKDSTLIMQLLRDNLTLWTSD
Sbjct:    4 REEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVIGSRRASWRIISSIEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNE---EARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSD 233          
BLAST of 14-3-3 protein beta/alpha vs. Planmine SMEST
Match: SMESG000075252.1 (SMESG000075252.1)

HSP 1 Score: 255.373 bits (651), Expect = 1.085e-83
Identity = 139/233 (59.66%), Postives = 179/233 (76.82%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQM-FANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSA-SKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSD 883
            REE V+ AKL+EQAERYE+M  AM++V  M  +L+ EERNLLSVAYKNV+G+RR++WR+I+SIEQK E  + +++    ++R +IE EL  +C D++++L   L+  AT     E+ VFFLKM+GDYYRYLAE      + D  +NSL+AY  A++ A S+L  THPIRLGLALNFSVFYYEI N+   AC+LAK AFDDAIA++D+L E+SYKDSTLIMQLLRDNLTLWTSD
Sbjct:    4 REEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVIGSRRASWRIISSIEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNE---EARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSD 233          
BLAST of 14-3-3 protein beta/alpha vs. Planmine SMEST
Match: SMESG000047644.1 (SMESG000047644.1)

HSP 1 Score: 245.743 bits (626), Expect = 4.897e-80
Identity = 137/238 (57.56%), Postives = 176/238 (73.95%), Query Frame = 2
Query:  191 REELVHIAKLSEQAERYEDMACAMKKVTEMGXXXXXXXXXXXXVAYKNVVGARRSAWRVITSIEQKTEGSEKKQM-FANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSA-SKLHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDD 898
            RE  V+ AKL+EQAERY++M  AM+ V +M  EL+ EERNLLSVAYKNV+G+RR++WR+++SIEQK E  +  ++     YR ++E EL  +C D++ LL +++  L   SG  E++VFFLKM+GDYYRYL+E      +    +NSL AY  AT+ A S L  THPIRLGLALNFSVFYYEI N+   AC+LAK AFDDAI ++D+L E+SYKDSTLIMQLLRDNLTLWTSD   D+
Sbjct:    4 RETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHM--LVAASG-GEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDE 238          
The following BLAST results are available for this feature:
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
YWHAZ1.014e-10470.42tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
YWHAZ1.014e-10470.42tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
YWHAZ1.014e-10470.42tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
YWHAZ1.014e-10470.42tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
YWHAZ1.014e-10470.42tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
par-53.735e-10672.2714-3-3-like protein 1 [Source:UniProtKB/Swiss-Pro... [more]
par-53.735e-10672.2714-3-3-like protein 1 [Source:UniProtKB/Swiss-Pro... [more]
par-53.735e-10672.2714-3-3-like protein 1 [Source:UniProtKB/Swiss-Pro... [more]
ftt-22.488e-10569.2614-3-3-like protein 2 [Source:UniProtKB/Swiss-Pro... [more]
ftt-22.488e-10569.2614-3-3-like protein 2 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
14-3-3zeta8.316e-10269.04gene:FBgn0004907 transcript:FBtr0088413[more]
14-3-3zeta8.316e-10269.04gene:FBgn0004907 transcript:FBtr0088418[more]
14-3-3zeta8.316e-10269.04gene:FBgn0004907 transcript:FBtr0088417[more]
14-3-3zeta8.316e-10269.04gene:FBgn0004907 transcript:FBtr0088412[more]
14-3-3zeta8.316e-10269.04gene:FBgn0004907 transcript:FBtr0100182[more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ywhaba1.495e-10570.42tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhabb3.245e-10370.46tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhabl1.403e-10270.34tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhabl1.403e-10270.34tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhabl1.403e-10270.34tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
edf14.059e-10269.87endothelial differentiation related factor 1 [Sour... [more]
ywhab4.759e-10168.35tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
insm14.846e-9666.95insulinoma associated 1 [Source:Xenbase;Acc:XB-GEN... [more]
ywhab2.049e-9567.97tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
edf11.257e-9468.83endothelial differentiation related factor 1 [Sour... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ywhaz3.132e-10470.00tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
Ywhaz3.132e-10470.00tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
Ywhaz3.132e-10470.00tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
Ywhab3.265e-10370.00tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
Ywhag7.827e-9767.36tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2F637|1433Z_BOMMO3.311e-10570.2914-3-3 protein zeta OS=Bombyx mori OX=7091 GN=14-3... [more]
sp|P41932|14331_CAEEL4.751e-10572.2714-3-3-like protein 1 OS=Caenorhabditis elegans OX... [more]
sp|Q5PRD0|143BA_DANRE1.129e-10470.4214-3-3 protein beta/alpha-A OS=Danio rerio OX=7955... [more]
sp|Q5ZKC9|1433Z_CHICK2.151e-10470.4214-3-3 protein zeta OS=Gallus gallus OX=9031 GN=YW... [more]
sp|Q20655|14332_CAEEL3.164e-10469.2614-3-3-like protein 2 OS=Caenorhabditis elegans OX... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1V0M3W34.530e-10872.1814-3-3 alpha protein OS=Dugesia japonica OX=6161 P... [more]
A0A4U5UCS26.289e-10671.0714-3-3 protein beta/alpha-1 OS=Collichthys lucidus... [more]
A0A0F8BQG86.289e-10671.0714-3-3 protein beta/alpha-1 OS=Larimichthys crocea... [more]
A0A0F8AX466.557e-10671.0714-3-3 protein beta/alpha-1 OS=Larimichthys crocea... [more]
A0A4U5UBF78.330e-10671.0714-3-3 protein beta/alpha-1 OS=Collichthys lucidus... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ywhabb4.308e-10671.7314-3-3 protein beta/alpha-A-like [Source:NCBI gene... [more]
ywhaba1.634e-10571.31tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhaba2.070e-10570.42tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhabl2.414e-10271.3714-3-3 protein beta/alpha-A-like [Source:NCBI gene... [more]
ywhaqa1.608e-9969.53tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ywhaqb4.992e-9868.78tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ENSPMAT00000005915.12.714e-9666.53pep scaffold:Pmarinus_7.0:GL476980:154455:158510:1... [more]
ENSPMAT00000007337.16.061e-9062.66pep scaffold:Pmarinus_7.0:GL477279:15491:28515:1 g... [more]
ENSPMAT00000011016.11.446e-8565.60pep scaffold:Pmarinus_7.0:GL483328:5531:6205:1 gen... [more]
ENSPMAT00000006708.19.005e-8060.54pep scaffold:Pmarinus_7.0:GL478275:1612:6605:-1 ge... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
BMH21.317e-8560.3414-3-3 protein, minor isoform; controls proteome a... [more]
BMH14.737e-8561.0214-3-3 protein, major isoform; controls proteome a... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO428591.499e-9363.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421751.097e-8758.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413729.667e-8460.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428211.829e-4439.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000024336.22.050e-10469.0114-3-3 protein beta/alpha-1 [Source:NCBI gene;Acc:... [more]
YWHAB2.475e-10269.4214-3-3 protein beta/alpha-1 [Source:NCBI gene;Acc:... [more]
ENSORLT00000027323.11.288e-9967.7714-3-3 protein zeta [Source:NCBI gene;Acc:10116351... [more]
ENSORLT00000032209.11.317e-9967.7714-3-3 protein zeta [Source:NCBI gene;Acc:10116351... [more]
ENSORLT00000003300.25.082e-9968.9114-3-3 protein zeta [Source:NCBI gene;Acc:10116351... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055903.10.000e+0100.00SMESG000055903.1[more]
SMESG000067831.13.620e-11071.49SMESG000067831.1[more]
SMESG000075252.18.185e-8459.66SMESG000075252.1[more]
SMESG000075252.11.085e-8359.66SMESG000075252.1[more]
SMESG000047644.14.897e-8057.56SMESG000047644.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004124 ID=SMED30004124|Name=14-3-3 protein beta/alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=1130bp
AGAAAATGGAATGTTTTATTAAACGGGTGGTGTTTTCGTTTTGAAAACTG
AGGATAAACATTTATTTTTATACTATATGACCTTGAATGTGTGCTTGGAA
TTATTAAGTATATAAAATGATTTCGAGTTGTATTTTCTACAAATCATGAC
ATTGATATCATCGCCTTGGATTGAAGAGCAATTTAAGTCTCGTGAAGAAC
TTGTTCATATTGCAAAGTTATCAGAACAAGCAGAAAGATATGAAGATATG
GCATGTGCTATGAAAAAAGTGACAGAAATGGGAGAAGAATTAAGCAACGA
AGAACGAAATTTGTTATCGGTAGCTTATAAAAATGTAGTAGGAGCTCGAA
GATCTGCATGGCGAGTAATTACTAGTATTGAACAAAAGACGGAAGGAAGT
GAGAAAAAACAAATGTTCGCAAATGAATATCGTTTAAAAATTGAATCTGA
ACTGAATGCTATCTGCAATGATGTTTTAAAGCTTTTAATCGATTACTTAA
TACCTTTGGCAACTAAAAGTGGACAAGCCGAAAGTGAAGTATTCTTTCTT
AAGATGCAAGGAGATTATTATCGGTATCTGGCTGAAGTGGCTTCAAGCCA
AAATAAATCCGATATTGTTAAAAATAGCTTAAATGCATATTTAAATGCAA
CATCAAGCGCGTCGAAACTCCATACCACTCACCCTATTCGGCTGGGATTA
GCTTTAAATTTCTCCGTCTTCTATTATGAAATTAAAAACAACCGTGCAGA
AGCTTGCAAATTGGCCAAAACCGCATTTGATGACGCCATCGCAGATATTG
ATCATCTCCAAGAAGATTCATATAAAGATAGTACATTGATTATGCAGTTA
TTGAGAGATAATTTAACTTTATGGACTTCTGATGATCAAGGGGACGATAA
TGAAGGAGTCGACACTTAAATTAGTAATTGACTAGTCATCTATATTTGTA
TTAGTTATGAATAAAATATTTCCATATACGCTGATTTTATTTGTGTAATG
AATTTGCAACAAAGTTTCAACATTTCAAATTTAACTTATGAATCAGTGTG
ATTGTTCGTCATGCCCAACATGTTTATAATTTGCTTTTGTCAATTTTTTT
TACAGTTTGTTTATGAAATAGACTTAGACT
back to top

protein sequence of SMED30004124-orf-1

>SMED30004124-orf-1 ID=SMED30004124-orf-1|Name=SMED30004124-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=258bp
MTLISSPWIEEQFKSREELVHIAKLSEQAERYEDMACAMKKVTEMGEELS
NEERNLLSVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIE
SELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVAS
SQNKSDIVKNSLNAYLNATSSASKLHTTHPIRLGLALNFSVFYYEIKNNR
AEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGD
DNEGVDT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0042470melanosome
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0045744negative regulation of G-protein coupled receptor protein signaling pathway
GO:0006911phagocytosis, engulfment
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000012neural progenitor cell
PLANA:0000020protonephridia
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000484secretory system
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR03681514-3-3_dom_sf
IPR00030814-3-3
IPR02341014-3-3_domain
IPR02340914-3-3_CS
Vocabulary: molecular function
TermDefinition
GO:0019904protein domain specific binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR00030814-3-3 proteinPRINTSPR003051433ZETAcoord: 48..77
score: 78.88
coord: 163..189
score: 48.39
coord: 190..216
score: 69.48
coord: 217..246
score: 82.64
coord: 129..151
score: 68.38
IPR00030814-3-3 proteinPIRSFPIRSF00086814-3-3coord: 10..255
e-value: 8.1E-108
score: 356.9
IPR00030814-3-3 proteinPANTHERPTHR1886014-3-3 PROTEINcoord: 16..253
IPR02341014-3-3 domainSMARTSM001011433_4coord: 16..257
e-value: 1.7E-123
score: 426.2
IPR02341014-3-3 domainPFAMPF0024414-3-3coord: 23..244
e-value: 2.8E-96
score: 321.3
IPR03681514-3-3 domain superfamilyGENE3DG3DSA:1.20.190.20coord: 12..257
e-value: 6.1E-111
score: 371.4
IPR03681514-3-3 domain superfamilySUPERFAMILYSSF4844514-3-3 proteincoord: 15..246
NoneNo IPR availablePANTHERPTHR18860:SF64TYROSINE 3-MONOOXYGENASE/TRYPTOPHAN 5-MONOOXYGENASE ACTIVATION PROTEIN, BETA POLYPEPTIDE-LIKE-RELATEDcoord: 16..253
IPR02340914-3-3 protein, conserved sitePROSITEPS007961433_1coord: 54..64
IPR02340914-3-3 protein, conserved sitePROSITEPS007971433_2coord: 226..245