Peptidyl-prolyl cis-trans isomerase

Overview
NamePeptidyl-prolyl cis-trans isomerase
Smed IDSMED30004117
Length (bp)2810
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidyl-prolyl cis-trans isomerase (SMED30004117) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidyl-prolyl cis-trans isomerase (SMED30004117) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidyl-prolyl cis-trans isomerase (SMED30004117) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidyl-prolyl cis-trans isomerase (SMED30004117) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004117

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30004117SMESG000070665.1 dd_Smed_v4_2064_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004117SMESG000070665.1 dd_Smed_v4_2064_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004117SMESG000070665.1 dd_Smed_v4_2064_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004117SMESG000070665.1 dd_Smed_v4_2064_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004117SMESG000070665.1 dd_Smed_v4_2064_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIG (peptidylprolyl isomerase G [Source:HGNC Symbol;Acc:HGNC:14650])

HSP 1 Score: 224.172 bits (570), Expect = 3.179e-61
Identity = 106/173 (61.27%), Postives = 129/173 (74.57%), Query Frame = 1
Query:   46 RPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIP 564
            RPRCFFDI I + PAGR++FEL+ D+CPKT ENF  LCTG+ G  +S+ K LHY   +FHRV+K FM+QGGDF  G+G GGESIYGG F DE+  + H+K FLLSMAN G +TNGSQFFITTKP  HLDG HVVFG V+SG+ ++  IEN   +A +KP  E  I +CG LIP
Sbjct:    7 RPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIP 179          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIG (peptidylprolyl isomerase G [Source:HGNC Symbol;Acc:HGNC:14650])

HSP 1 Score: 224.172 bits (570), Expect = 3.179e-61
Identity = 106/173 (61.27%), Postives = 129/173 (74.57%), Query Frame = 1
Query:   46 RPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIP 564
            RPRCFFDI I + PAGR++FEL+ D+CPKT ENF  LCTG+ G  +S+ K LHY   +FHRV+K FM+QGGDF  G+G GGESIYGG F DE+  + H+K FLLSMAN G +TNGSQFFITTKP  HLDG HVVFG V+SG+ ++  IEN   +A +KP  E  I +CG LIP
Sbjct:    7 RPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIP 179          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIG (peptidylprolyl isomerase G [Source:HGNC Symbol;Acc:HGNC:14650])

HSP 1 Score: 207.223 bits (526), Expect = 3.274e-60
Identity = 106/173 (61.27%), Postives = 129/173 (74.57%), Query Frame = 1
Query:   46 RPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIP 564
            RPRCFFDI I + PAGR++FEL+ D+CPKT ENF  LCTG+ G  +S+ K LHY   +FHRV+K FM+QGGDF  G+G GGESIYGG F DE+  + H+K FLLSMAN G +TNGSQFFITTKP  HLDG HVVFG V+SG+ ++  IEN   +A +KP  E  I +CG LIP
Sbjct:    7 RPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIP 179          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIG (peptidylprolyl isomerase G [Source:HGNC Symbol;Acc:HGNC:14650])

HSP 1 Score: 207.223 bits (526), Expect = 7.076e-59
Identity = 106/173 (61.27%), Postives = 129/173 (74.57%), Query Frame = 1
Query:   46 RPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIP 564
            RPRCFFDI I + PAGR++FEL+ D+CPKT ENF  LCTG+ G  +S+ K LHY   +FHRV+K FM+QGGDF  G+G GGESIYGG F DE+  + H+K FLLSMAN G +TNGSQFFITTKP  HLDG HVVFG V+SG+ ++  IEN   +A +KP  E  I +CG LIP
Sbjct:    7 RPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIP 179          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: NKTR (natural killer cell triggering receptor [Source:HGNC Symbol;Acc:HGNC:7833])

HSP 1 Score: 221.476 bits (563), Expect = 9.512e-59
Identity = 107/177 (60.45%), Postives = 134/177 (75.71%), Query Frame = 1
Query:   31 MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLI 561
            M ++ RP+C FDI+I   P GRI+F+L+ DICPKT +NF+ LC+G+ G+ +++GKKL Y  S FHRV+K FMIQGGDF  G+G GGESIYGG F DEN  L HD+ FLLSMAN G +TNGSQFFITTKPA HLDG HVVFG V+SG  +IE IENL  +A ++P  +  + +CGVL 
Sbjct:    1 MGAQDRPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLA 177          

HSP 2 Score: 51.6026 bits (122), Expect = 8.791e-6
Identity = 33/92 (35.87%), Postives = 48/92 (52.17%), Query Frame = 1
Query:  730 VRPDEIPEVPKPFFLYRGNLXXXXXXXXXXXXXXXXXQYVSKDIIGRSGRLIKGRGQLRYYSKSPRDR----------HDTPPHWKKETYKV 975
            VRP+EIP VP+  FL R ++    +E       +       K  + +SGR IKGRG +RY++  PR R           +TPPHWK+E  ++
Sbjct:  282 VRPEEIPPVPENRFLLRRDMPVVTAEPEPKIPDVAPIVSDQKPSVSKSGRKIKGRGTIRYHT-PPRSRSCSESDDDDSSETPPHWKEEMQRL 372          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-8 (Peptidyl-prolyl cis-trans isomerase 8 [Source:UniProtKB/Swiss-Prot;Acc:P52016])

HSP 1 Score: 186.422 bits (472), Expect = 6.032e-51
Identity = 96/170 (56.47%), Postives = 122/170 (71.76%), Query Frame = 1
Query:   52 RCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLI 561
            R FFDI I   PAGRI+F L++  CP+T ENF   CTG+ G  + +G    Y  S+FHRVIKGFMIQGGD  +G+GTGG SIYG  F+DENL L H KP+LLSMAN GP+TNGSQFFIT++   HLDGKH VFG V+ G  ++++IENL     +KPV +  I++CG ++
Sbjct:   10 RAFFDISINGEPAGRIVFSLWNHCCPRTVENFRAFCTGELG--KMNGHYASYQGSVFHRVIKGFMIQGGDITHGNGTGGYSIYGRTFDDENLALKHKKPYLLSMANRGPDTNGSQFFITSEEVPHLDGKHCVFGEVIKGVEVVKAIENLETGNEDKPVCKVEITHCGEMV 177          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-8 (Peptidyl-prolyl cis-trans isomerase 8 [Source:UniProtKB/Swiss-Prot;Acc:P52016])

HSP 1 Score: 186.422 bits (472), Expect = 6.032e-51
Identity = 96/170 (56.47%), Postives = 122/170 (71.76%), Query Frame = 1
Query:   52 RCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLI 561
            R FFDI I   PAGRI+F L++  CP+T ENF   CTG+ G  + +G    Y  S+FHRVIKGFMIQGGD  +G+GTGG SIYG  F+DENL L H KP+LLSMAN GP+TNGSQFFIT++   HLDGKH VFG V+ G  ++++IENL     +KPV +  I++CG ++
Sbjct:   10 RAFFDISINGEPAGRIVFSLWNHCCPRTVENFRAFCTGELG--KMNGHYASYQGSVFHRVIKGFMIQGGDITHGNGTGGYSIYGRTFDDENLALKHKKPYLLSMANRGPDTNGSQFFITSEEVPHLDGKHCVFGEVIKGVEVVKAIENLETGNEDKPVCKVEITHCGEMV 177          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-8 (Peptidyl-prolyl cis-trans isomerase 8 [Source:UniProtKB/Swiss-Prot;Acc:P52016])

HSP 1 Score: 186.422 bits (472), Expect = 9.951e-51
Identity = 96/170 (56.47%), Postives = 122/170 (71.76%), Query Frame = 1
Query:   52 RCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLI 561
            R FFDI I   PAGRI+F L++  CP+T ENF   CTG+ G  + +G    Y  S+FHRVIKGFMIQGGD  +G+GTGG SIYG  F+DENL L H KP+LLSMAN GP+TNGSQFFIT++   HLDGKH VFG V+ G  ++++IENL     +KPV +  I++CG ++
Sbjct:   10 RAFFDISINGEPAGRIVFSLWNHCCPRTVENFRAFCTGELG--KMNGHYASYQGSVFHRVIKGFMIQGGDITHGNGTGGYSIYGRTFDDENLALKHKKPYLLSMANRGPDTNGSQFFITSEEVPHLDGKHCVFGEVIKGVEVVKAIENLETGNEDKPVCKVEITHCGEMV 177          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-9 (Peptidyl-prolyl cis-trans isomerase 9 [Source:UniProtKB/Swiss-Prot;Acc:Q09637])

HSP 1 Score: 176.407 bits (446), Expect = 5.362e-49
Identity = 92/170 (54.12%), Postives = 120/170 (70.59%), Query Frame = 1
Query:   52 RCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLI 561
            R F DI +  +  GRI   L+ +  PKT ENF  LCTG+ GM+ ++  +LHY Q+ FHR++K FMIQGGD   GDG GG SIYG  F+DE  +L H +P+LLSMAN GPN+N SQFFITT  A H +GKHVVFG VV G+N+++ I+NL V+  +KP+ +  ISNCG L+
Sbjct:    6 RVFLDISVDENLIGRIEIRLFVEDAPKTCENFRALCTGEVGMTPNNKARLHYKQNEFHRIVKKFMIQGGDITEGDGRGGFSIYGRYFDDEKFKLKHSRPYLLSMANKGPNSNSSQFFITTAAAPHCNGKHVVFGEVVKGQNVVDYIDNLAVDDKSKPLAKVLISNCGELV 175          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-1 (Peptidyl-prolyl cis-trans isomerase 1 [Source:UniProtKB/Swiss-Prot;Acc:P52009])

HSP 1 Score: 169.859 bits (429), Expect = 4.132e-48
Identity = 94/171 (54.97%), Postives = 116/171 (67.84%), Query Frame = 1
Query:   46 RPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVL 558
            RP+ FFD+ IG  PAGR+  EL++D+ PKTAENF  LCTG+ G+ E  G  LH+  S FHR+I  FMIQGGDF   +GTGGESIYG +F DEN +L H  P  LSMAN GPNTNGSQFFI T     LDG HVVFG V  G ++++ IE +  + +  P    TI++CG L
Sbjct:   21 RPKVFFDVSIGEEPAGRVTMELFNDVVPKTAENFRALCTGEKGVGEQ-GVALHFKGSKFHRIIPEFMIQGGDFTRHNGTGGESIYGNKFKDENFDLKHTGPGCLSMANAGPNTNGSQFFICTVDTPWLDGGHVVFGQVTDGMSVVKKIEKMG-SRSGAPAKTVTIADCGEL 189          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: Moca-cyp (gene:FBgn0039581 transcript:FBtr0085286)

HSP 1 Score: 235.343 bits (599), Expect = 2.855e-64
Identity = 110/183 (60.11%), Postives = 136/183 (74.32%), Query Frame = 1
Query:   19 MIINMK--SKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLI 561
            M +N +     RPRCFFDI +G    GRI+FEL++D+ PKTAENF  LCTG+ G    +GKKL Y   IFHRV+K FM+Q GDF  G+GTGGESIYGG F DE+ E  HD+PFLLSMAN G NTNGSQFFITT+PA HLD  HVVFG V+SG+ L+  +E LPV+ N++P+ +A I+NCG L+
Sbjct:    1 MTVNKRDAGATRPRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHVVFGQVISGQELVRQLEGLPVDRNSRPLQDAAIANCGELV 183          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG17266 (gene:FBgn0033089 transcript:FBtr0307502)

HSP 1 Score: 162.54 bits (410), Expect = 1.457e-45
Identity = 96/176 (54.55%), Postives = 113/176 (64.20%), Query Frame = 1
Query:   31 MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVL 558
            ++S   P  FFDI +G +  GR+IFEL+ D  P+TAENF + CTG+       G  + Y  + FHRVIK FMIQGGDFV GDGTG  SIYG  F DEN  L HD P LLSMAN G  TNG QFFIT      LDGKHVVFG V+ G  ++  IEN+P   NNKP +  TIS CG +
Sbjct:   11 LRSSNNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGE---YRPDGVPIGYKGASFHRVIKDFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG17266 (gene:FBgn0033089 transcript:FBtr0086144)

HSP 1 Score: 162.54 bits (410), Expect = 1.457e-45
Identity = 96/176 (54.55%), Postives = 113/176 (64.20%), Query Frame = 1
Query:   31 MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVL 558
            ++S   P  FFDI +G +  GR+IFEL+ D  P+TAENF + CTG+       G  + Y  + FHRVIK FMIQGGDFV GDGTG  SIYG  F DEN  L HD P LLSMAN G  TNG QFFIT      LDGKHVVFG V+ G  ++  IEN+P   NNKP +  TIS CG +
Sbjct:   11 LRSSNNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGE---YRPDGVPIGYKGASFHRVIKDFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG2852 (gene:FBgn0034753 transcript:FBtr0071933)

HSP 1 Score: 151.754 bits (382), Expect = 1.865e-41
Identity = 91/173 (52.60%), Postives = 108/173 (62.43%), Query Frame = 1
Query:   40 KLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVL 558
            K+  + FFDI IG  PAGRI   L+    PKT ENF +L     G          Y  S FHR+IK FMIQGGDF  GDGTGG SIYG RF DEN +L H     LSMAN G +TNGSQFFITTK    LDG+HVVFG ++SG N++  IEN   +A ++PV +  I+N G L
Sbjct:   26 KVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEG--------YKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTL 190          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG2852 (gene:FBgn0034753 transcript:FBtr0345504)

HSP 1 Score: 151.754 bits (382), Expect = 1.865e-41
Identity = 91/173 (52.60%), Postives = 108/173 (62.43%), Query Frame = 1
Query:   40 KLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVL 558
            K+  + FFDI IG  PAGRI   L+    PKT ENF +L     G          Y  S FHR+IK FMIQGGDF  GDGTGG SIYG RF DEN +L H     LSMAN G +TNGSQFFITTK    LDG+HVVFG ++SG N++  IEN   +A ++PV +  I+N G L
Sbjct:   26 KVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEG--------YKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTL 190          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppig (peptidylprolyl isomerase G (cyclophilin G) [Source:ZFIN;Acc:ZDB-GENE-040426-2822])

HSP 1 Score: 219.935 bits (559), Expect = 2.363e-60
Identity = 101/173 (58.38%), Postives = 129/173 (74.57%), Query Frame = 1
Query:   46 RPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIP 564
            RPRCFFDI I + PAGR++ EL+ D+CPKT ENF  LCTG+ G+ +++ K LHY  + FHR++K FMIQGGDF  G+G GGESIYGG F DE+  + H K FLLSMAN G +TNGSQFFITTKP  HLDG HVVFG V++G+++I  IE+   + N++P  E  + NCG L+P
Sbjct:    7 RPRCFFDIGISNVPAGRVVIELFSDVCPKTCENFRCLCTGEKGVGKTTQKPLHYKGTPFHRIVKDFMIQGGDFSEGNGRGGESIYGGFFEDESFSMKHTKEFLLSMANRGKDTNGSQFFITTKPTPHLDGIHVVFGQVITGQDVIRMIESQKTDTNSRPYAEVKVLNCGELVP 179          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: nktr (natural killer cell triggering receptor [Source:ZFIN;Acc:ZDB-GENE-030131-1725])

HSP 1 Score: 212.231 bits (539), Expect = 6.119e-56
Identity = 103/177 (58.19%), Postives = 133/177 (75.14%), Query Frame = 1
Query:   31 MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLI 561
            M  K RP+C+FD++I   P GRI+F+L+ DICPKT++NF+ LCTG+ G  +++GKKL Y  S FHRV+K FMIQGGDF  G+G GGESI+GG F DEN  L HD+ FLLSMAN G +TNGSQFFITTK A HLDG HVVFG V+SG  +I++IE L  ++ ++P  +  + +CG LI
Sbjct:    1 MGVKDRPQCYFDVEINREPVGRIVFQLFSDICPKTSKNFLCLCTGEKGSGKATGKKLCYKGSTFHRVVKNFMIQGGDFTEGNGRGGESIFGGFFEDENFTLKHDRAFLLSMANRGKDTNGSQFFITTKTAPHLDGVHVVFGLVISGFEVIKNIEGLKTDSASRPYADVRVIDCGQLI 177          

HSP 2 Score: 54.299 bits (129), Expect = 8.678e-7
Identity = 31/92 (33.70%), Postives = 49/92 (53.26%), Query Frame = 1
Query:  730 VRPDEIPEVPKPFFLYRGNLXXXXXXXXXXXXXXXXXQYVSKDIIGRSGRLIKGRGQLRYY----------SKSPRDRHDTPPHWKKETYKV 975
            VRP+EIP VP+  FL R ++  ++     + +  +     +K  + +SGR IKGRG +RY+          S+  R   +TPPHWK+E  + 
Sbjct:  276 VRPEEIPPVPENRFLLRRDMPTQEEAIKIDVQDTDIVPNDTKPAVTKSGRKIKGRGTMRYHTPPRSKSRSESECERGSSETPPHWKEEMQRT 367          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppid (peptidylprolyl isomerase D [Source:ZFIN;Acc:ZDB-GENE-040625-34])

HSP 1 Score: 186.037 bits (471), Expect = 2.298e-51
Identity = 98/168 (58.33%), Postives = 121/168 (72.02%), Query Frame = 1
Query:   49 PRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCG 552
            PR FFD++IG    GR++FEL+ D+ PKTAENF  LCTG+ G+ +S+GK LH+    FHR+IK FMIQGGDF N +GTGGESIYG +F DEN    HD+  LLSMAN GPNTNGSQFFITT P  HLDGKHVVFG V+ G  +++ +E +    +N PV    I+ CG
Sbjct:   16 PRVFFDVEIGAERVGRVVFELFADVVPKTAENFRALCTGEKGVGKSTGKPLHFKGCPFHRIIKSFMIQGGDFSNQNGTGGESIYGDKFEDENFHYKHDREGLLSMANAGPNTNGSQFFITTVPTPHLDGKHVVFGQVLKGMGVVKMLEAMETKEDN-PVKPCVIAECG 182          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppih (peptidylprolyl isomerase H (cyclophilin H) [Source:ZFIN;Acc:ZDB-GENE-040625-127])

HSP 1 Score: 152.91 bits (385), Expect = 3.397e-42
Identity = 94/168 (55.95%), Postives = 107/168 (63.69%), Query Frame = 1
Query:   49 PRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCG 552
            P  FFD+ IG    GR+  EL+ DI PKTAENF + CTG+    +  G  + Y    FHRVIK FMIQGGDFVNGDGTG  SIY G F DEN  + H  P LLSMAN GP TNG QFFIT      LDGKHVVFG VV G  ++  IEN+P   NNKP +   +S CG
Sbjct:   11 PIVFFDVSIGGQEVGRMKIELFADIVPKTAENFRQFCTGE---FKKDGVPVGYKGCTFHRVIKDFMIQGGDFVNGDGTGICSIYRGPFADENFRMKHSGPGLLSMANSGPGTNGCQFFITCTKCDWLDGKHVVFGKVVDGLLVMRKIENVPTGPNNKPKLPIVVSQCG 175          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppih (peptidylprolyl isomerase H (cyclophilin H) [Source:ZFIN;Acc:ZDB-GENE-040625-127])

HSP 1 Score: 152.91 bits (385), Expect = 3.397e-42
Identity = 94/168 (55.95%), Postives = 107/168 (63.69%), Query Frame = 1
Query:   49 PRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCG 552
            P  FFD+ IG    GR+  EL+ DI PKTAENF + CTG+    +  G  + Y    FHRVIK FMIQGGDFVNGDGTG  SIY G F DEN  + H  P LLSMAN GP TNG QFFIT      LDGKHVVFG VV G  ++  IEN+P   NNKP +   +S CG
Sbjct:   11 PIVFFDVSIGGQEVGRMKIELFADIVPKTAENFRQFCTGE---FKKDGVPVGYKGCTFHRVIKDFMIQGGDFVNGDGTGICSIYRGPFADENFRMKHSGPGLLSMANSGPGTNGCQFFITCTKCDWLDGKHVVFGKVVDGLLVMRKIENVPTGPNNKPKLPIVVSQCG 175          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: ppig (peptidylprolyl isomerase G (cyclophilin G) [Source:NCBI gene;Acc:407915])

HSP 1 Score: 234.958 bits (598), Expect = 3.288e-65
Identity = 107/172 (62.21%), Postives = 133/172 (77.33%), Query Frame = 1
Query:   46 RPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLI 561
            R RCFFDI I ++PAGR++FEL+ D+CPKT ENF  LCTG+ G+ +S+ K LHY   +FHRV+K FMIQGGDF  G+G GGESIYGG F DEN  + H+K FLLSMAN G +TNGSQFFITTKP  HLDG HVVFG V+SG++L+  IEN   +A++KP V+ +I NCG L+
Sbjct:    7 RTRCFFDIAINNAPAGRVVFELFSDVCPKTCENFRSLCTGERGIGKSTQKPLHYKNCMFHRVVKDFMIQGGDFSEGNGRGGESIYGGFFEDENFSIQHNKEFLLSMANRGKDTNGSQFFITTKPTPHLDGLHVVFGQVISGQDLVREIENQKTDASSKPSVDVSIQNCGELV 178          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: ppig (peptidylprolyl isomerase G (cyclophilin G) [Source:NCBI gene;Acc:407915])

HSP 1 Score: 219.55 bits (558), Expect = 6.023e-60
Identity = 95/173 (54.91%), Postives = 121/173 (69.94%), Query Frame = 1
Query:   46 RPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFN-DENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLI 561
            R RCFFDI I ++PAGR++FEL+ D+CPKT ENF  LCTG+ G+ +S+ K LHY   +FHRV+K FMIQ                GG F+ DEN  + H+K FLLSMAN G +TNGSQFFITTKP  HLDG HVVFG V+SG++L+  IEN   +A++KP V+ +I NCG L+
Sbjct:    7 RTRCFFDIAINNAPAGRVVFELFSDVCPKTCENFRSLCTGERGIGKSTQKPLHYKNCMFHRVVKDFMIQ----------------GGDFSEDENFSIQHNKEFLLSMANRGKDTNGSQFFITTKPTPHLDGLHVVFGQVISGQDLVREIENQKTDASSKPSVDVSIQNCGELV 163          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: pcsk6 (proprotein convertase subtilisin/kexin type 6 [Source:Xenbase;Acc:XB-GENE-979058])

HSP 1 Score: 220.32 bits (560), Expect = 2.236e-58
Identity = 105/177 (59.32%), Postives = 132/177 (74.58%), Query Frame = 1
Query:   31 MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLI 561
            M  K RP+C+FD++I   P GRI+F+L+ D+CPKT  NF+ LCTG+ G+ + +GKKL Y  S FHRV+K FMIQGGDF  G+G GGESIYGG F DEN  L HD+ FLLSMAN G NTNGSQFFITTK A HLDG HVVFG V+SG  +IE IE+L  +A ++P  +  + +CG+L+
Sbjct:    1 MGEKARPQCYFDVEINREPVGRIVFQLFSDVCPKTCMNFLCLCTGEKGIGKVTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKNTNGSQFFITTKAAPHLDGVHVVFGLVISGFEVIEQIESLKTDAASRPYADVRVIDCGLLV 177          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: ppig (peptidylprolyl isomerase G (cyclophilin G) [Source:NCBI gene;Acc:407915])

HSP 1 Score: 209.534 bits (532), Expect = 1.883e-56
Identity = 98/172 (56.98%), Postives = 125/172 (72.67%), Query Frame = 1
Query:   46 RPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLI 561
            R RCFFDI I ++PAGR++FEL+ D+CPKT ENF  LCTG+ G+ +S+ K LHY   +FHRV+K FMIQGGDF  G+G GGESIYGG F DEN  + H+K FLLSMAN G +TNGSQFF+           HVVFG V+SG++L+  IEN   +A++KP V+ +I NCG L+
Sbjct:    7 RTRCFFDIAINNAPAGRVVFELFSDVCPKTCENFRSLCTGERGIGKSTQKPLHYKNCMFHRVVKDFMIQGGDFSEGNGRGGESIYGGFFEDENFSIQHNKEFLLSMANRGKDTNGSQFFML----------HVVFGQVISGQDLVREIENQKTDASSKPSVDVSIQNCGELV 168          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: pcsk6 (proprotein convertase subtilisin/kexin type 6 [Source:Xenbase;Acc:XB-GENE-979058])

HSP 1 Score: 196.438 bits (498), Expect = 7.746e-51
Identity = 99/166 (59.64%), Postives = 122/166 (73.49%), Query Frame = 1
Query:   73 IGHSPA---GRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLI 561
            I H P    GRI+F+L+ D+CPKT  NF+ LCTG+ G+ + +GKKL Y  S FHRV+K FMIQGGDF  G+G GGESIYGG F DEN  L HD+ FLLSMAN G NTNGSQFFITTK A HLDG HVVFG V+SG  +IE IE+L  +A ++P  +  + +CG+L+
Sbjct:    3 ILHFPGCHIGRIVFQLFSDVCPKTCMNFLCLCTGEKGIGKVTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKNTNGSQFFITTKAAPHLDGVHVVFGLVISGFEVIEQIESLKTDAASRPYADVRVIDCGLLV 168          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppig (peptidyl-prolyl isomerase G (cyclophilin G) [Source:MGI Symbol;Acc:MGI:2445173])

HSP 1 Score: 224.557 bits (571), Expect = 1.299e-61
Identity = 106/173 (61.27%), Postives = 129/173 (74.57%), Query Frame = 1
Query:   46 RPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIP 564
            RPRCFFDI I + PAGR++FEL+ D+CPKT ENF  LCTG+ G  +S+ K LHY   +FHRV+K FM+QGGDF  G+G GGESIYGG F DE+  + H+K FLLSMAN G +TNGSQFFITTKP  HLDG HVVFG V+SG+ ++  IEN   +A +KP  E  I +CG LIP
Sbjct:    7 RPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIP 179          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppig (peptidyl-prolyl isomerase G (cyclophilin G) [Source:MGI Symbol;Acc:MGI:2445173])

HSP 1 Score: 224.557 bits (571), Expect = 1.299e-61
Identity = 106/173 (61.27%), Postives = 129/173 (74.57%), Query Frame = 1
Query:   46 RPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIP 564
            RPRCFFDI I + PAGR++FEL+ D+CPKT ENF  LCTG+ G  +S+ K LHY   +FHRV+K FM+QGGDF  G+G GGESIYGG F DE+  + H+K FLLSMAN G +TNGSQFFITTKP  HLDG HVVFG V+SG+ ++  IEN   +A +KP  E  I +CG LIP
Sbjct:    7 RPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIP 179          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Nktr (natural killer tumor recognition sequence [Source:MGI Symbol;Acc:MGI:97346])

HSP 1 Score: 219.935 bits (559), Expect = 5.481e-59
Identity = 107/177 (60.45%), Postives = 134/177 (75.71%), Query Frame = 1
Query:   31 MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLI 561
            M ++ RP+C FDI+I   P GRI+F+L+ DICPKT +NF+ LC+G+ G+ +++GKKL Y  S FHRV+K FMIQGGDF  G+G GGESIYGG F DEN  L HD+ FLLSMAN G +TNGSQFFITTKPA HLDG HVVFG V+SG  +IE IENL  +A ++P  +  + +CGVL 
Sbjct:    1 MGAQDRPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLA 177          

HSP 2 Score: 51.6026 bits (122), Expect = 5.988e-6
Identity = 34/92 (36.96%), Postives = 49/92 (53.26%), Query Frame = 1
Query:  730 VRPDEIPEVPKPFFLYRGNLXXXXXXXXXXXXXXXXXQYVSKDIIGRSGRLIKGRGQLRYYSKSPRDR----------HDTPPHWKKETYKV 975
            VRP+EIP VP+  FL R ++     E  +N   +       K  + +SGR IKGRG +RY++  PR R           +TPPHWK+E  ++
Sbjct:  257 VRPEEIPPVPENRFLLRRDMPAITVEPEQNIPDVAPVVSDQKPSVSKSGRKIKGRGTIRYHT-PPRSRSHSESKDDDSSETPPHWKEEMQRL 347          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Nktr (natural killer tumor recognition sequence [Source:MGI Symbol;Acc:MGI:97346])

HSP 1 Score: 220.705 bits (561), Expect = 1.203e-58
Identity = 107/177 (60.45%), Postives = 134/177 (75.71%), Query Frame = 1
Query:   31 MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLI 561
            M ++ RP+C FDI+I   P GRI+F+L+ DICPKT +NF+ LC+G+ G+ +++GKKL Y  S FHRV+K FMIQGGDF  G+G GGESIYGG F DEN  L HD+ FLLSMAN G +TNGSQFFITTKPA HLDG HVVFG V+SG  +IE IENL  +A ++P  +  + +CGVL 
Sbjct:    1 MGAQDRPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLA 177          

HSP 2 Score: 51.9878 bits (123), Expect = 4.370e-6
Identity = 34/92 (36.96%), Postives = 49/92 (53.26%), Query Frame = 1
Query:  730 VRPDEIPEVPKPFFLYRGNLXXXXXXXXXXXXXXXXXQYVSKDIIGRSGRLIKGRGQLRYYSKSPRDR----------HDTPPHWKKETYKV 975
            VRP+EIP VP+  FL R ++     E  +N   +       K  + +SGR IKGRG +RY++  PR R           +TPPHWK+E  ++
Sbjct:  282 VRPEEIPPVPENRFLLRRDMPAITVEPEQNIPDVAPVVSDQKPSVSKSGRKIKGRGTIRYHT-PPRSRSHSESKDDDSSETPPHWKEEMQRL 372          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppid (peptidylprolyl isomerase D (cyclophilin D) [Source:MGI Symbol;Acc:MGI:1914988])

HSP 1 Score: 188.348 bits (477), Expect = 3.317e-52
Identity = 102/170 (60.00%), Postives = 119/170 (70.00%), Query Frame = 1
Query:   49 PRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVL 558
            PR FFD+DIG    GRI+ EL+ DI PKTAENF  LCTG+ G   ++GK LH+    FHR+IK FMIQGGDF N +GTGGESIYG +F DEN    HD+  LLSMAN GPNTNGSQFFITT P  HLDGKHVVFG V+ G  +  ++EN+ VN   KP     I+ CG L
Sbjct:   16 PRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGSTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGPNTNGSQFFITTVPTPHLDGKHVVFGQVIKGLGVARTLENVEVNG-EKPAKLCVIAECGEL 184          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|A2AR02|PPIG_MOUSE (Peptidyl-prolyl cis-trans isomerase G OS=Mus musculus OX=10090 GN=Ppig PE=1 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 9.085e-61
Identity = 106/173 (61.27%), Postives = 129/173 (74.57%), Query Frame = 1
Query:   46 RPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIP 564
            RPRCFFDI I + PAGR++FEL+ D+CPKT ENF  LCTG+ G  +S+ K LHY   +FHRV+K FM+QGGDF  G+G GGESIYGG F DE+  + H+K FLLSMAN G +TNGSQFFITTKP  HLDG HVVFG V+SG+ ++  IEN   +A +KP  E  I +CG LIP
Sbjct:    7 RPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIP 179          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|Q5B4E7|PPID_EMENI (Peptidyl-prolyl cis-trans isomerase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cpr6 PE=3 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 1.142e-60
Identity = 112/176 (63.64%), Postives = 131/176 (74.43%), Query Frame = 1
Query:   31 MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVL 558
            M    RPR FFDI IG    GRI FEL++D+ PKTAENF  LCTG+ GM +  GK LH+  SIFHRVIK FMIQGGDF   +GTGGESIYG +F DEN EL HD+PFLLSMAN GP TNGSQFFITT P  HLDGKHVVFG V++G++++  IEN+P  A +KP  + TI+ CG L
Sbjct:    1 MAESKRPRVFFDIQIGQQQTGRIAFELFNDVVPKTAENFRALCTGEKGMGKQ-GKPLHFKGSIFHRVIKQFMIQGGDFTAFNGTGGESIYGEKFPDENFELKHDRPFLLSMANSGPGTNGSQFFITTVPTPHLDGKHVVFGEVINGKSVVRKIENMPTQA-DKPTTDVTIAECGEL 174          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|Q13427|PPIG_HUMAN (Peptidyl-prolyl cis-trans isomerase G OS=Homo sapiens OX=9606 GN=PPIG PE=1 SV=2)

HSP 1 Score: 224.172 bits (570), Expect = 1.527e-60
Identity = 106/173 (61.27%), Postives = 129/173 (74.57%), Query Frame = 1
Query:   46 RPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIP 564
            RPRCFFDI I + PAGR++FEL+ D+CPKT ENF  LCTG+ G  +S+ K LHY   +FHRV+K FM+QGGDF  G+G GGESIYGG F DE+  + H+K FLLSMAN G +TNGSQFFITTKP  HLDG HVVFG V+SG+ ++  IEN   +A +KP  E  I +CG LIP
Sbjct:    7 RPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIP 179          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|O55035|PPIG_RAT (Peptidyl-prolyl cis-trans isomerase G OS=Rattus norvegicus OX=10116 GN=Ppig PE=1 SV=2)

HSP 1 Score: 224.172 bits (570), Expect = 1.617e-60
Identity = 105/173 (60.69%), Postives = 129/173 (74.57%), Query Frame = 1
Query:   46 RPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIP 564
            RPRCFFDI I + PAGR++FEL+ D+CPKT ENF  LCTG+ G  +S+ K LHY   +FHRV+K FM+QGGDF  G+G GGESIYGG F DE+  + H+K FLLSMAN G +TNGSQFFITTKP  HLDG HVVFG V+SG+ ++  IEN   +A +KP  E  I +CG L+P
Sbjct:    7 RPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELVP 179          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|Q6BXZ7|PPID_DEBHA (Peptidyl-prolyl cis-trans isomerase D OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=CPR6 PE=3 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 2.190e-60
Identity = 113/184 (61.41%), Postives = 136/184 (73.91%), Query Frame = 1
Query:   31 MKSKL-RPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVL----IPV 567
            M  KL RP+ FFDI     P GR++FELY+D+ PKTAENF  LCTG+ G SESSGK+LHY  SIFHR+IK FM QGGDF +G G GGESIYG +F DEN +L+HDKPFLLSMAN G NTNGSQFFITT P  HL+GKHVVFG V+ G++++  +E      N+KPV +  IS+CG L    +PV
Sbjct:    1 MSDKLNRPKVFFDISADGKPKGRVVFELYNDVVPKTAENFRALCTGEKGASESSGKQLHYKGSIFHRIIKDFMCQGGDFTHGSGIGGESIYGEKFEDENFQLTHDKPFLLSMANAGANTNGSQFFITTVPTPHLNGKHVVFGEVIQGKSIVRQLERCDKGENDKPVEDWIISDCGELPSDYVPV 184          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A443SUJ2 (Peptidyl-prolyl cis-trans isomerase cyp11-like isoform X1 OS=Leptotrombidium deliense OX=299467 GN=B4U80_06580 PE=4 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 1.023e-71
Identity = 147/320 (45.94%), Postives = 193/320 (60.31%), Query Frame = 1
Query:   40 KLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXX-----------XXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIPVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDETETLYPKCSVRPDEIPEVPKPFFLYRGNLXXXXXXXXXXXXXXXXXQYVSKDIIGRSGRLIKGRGQLRYYSKSPRD---RHDTPPHWK 957
            K+R RCFFDI+I + P GRI+ EL++D+CP TAENF  LCTG+ G+ +++ K LHY   IFHRV+K FMIQGGDF             G+G GGESI+GG F DEN E+ H++PFLLSMAN G +TNGSQFFITTKPA HLDG HVVFGHV+SG+ ++  IEN  ++ N+KP+V   I+NCG L+P                        K K+  K     ++K     D+ E    +C+++P+EIPE+P   FL R     E  +     +     +  S+    RSGR +KGRG  RY + SP D   R +TPPHWK
Sbjct:    6 KMRKRCFFDIEIDNKPVGRIVLELFNDVCPVTAENFRALCTGEMGLGKTTEKPLHYKNVIFHRVVKNFMIQGGDFSMGPKLFLHFDDAGNGRGGESIFGGTFKDENFEMKHNEPFLLSMANRGKDTNGSQFFITTKPAPHLDGVHVVFGHVISGQEVVSEIENQAIDKNSKPLVNVLIANCGELVP----------------------QIKPKEKDKGDKEEEKKENVEVDQAEV---ECTIKPEEIPEIPANRFLMR---DVEAKDAANKAKGTRDERIRSRTQTTRSGRKVKGRGFRRYRTPSPGDRKARSETPPHWK 297          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A3Q0KHB7 (Putative cyclophilin-like protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 1.694e-70
Identity = 160/323 (49.54%), Postives = 203/323 (62.85%), Query Frame = 1
Query:   34 KSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNAN--NKPVVEATISNCGVLIPVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDETETLYPKCSVRPDEIPEVPKPFFLYRGNLXXXXXXXXXXXXXXXXXQYVSKDII------GRSGRLIKGRGQLRYYSKSPR----DRHDTPPHWKKET 966
            K K + RC+ DI I   PAGRI+FEL++DICPK AENF KLC G CG+   +GK L Y  S+FHRVIKGFM+QGGDF N DGTGGESIYGG F DE L   HD+PFLLSMAN GPNTNGSQFFITT PA HL+GKH+VFGHV+SGE+++  IE +P++    ++PV    I +CG LIPV+            S      K  KK K  KKK R   + +   D    +  +CSVR +E+PEVP P FLYRGN   ++ E      +       S++         RSGR++KGRG++ Y S + R    +R  TPPHW++ +
Sbjct:    3 KHKFKTRCYLDIKIDSQPAGRIVFELFNDICPKAAENFKKLCQGVCGLGLKTGKPLTYQGSVFHRVIKGFMVQGGDFSNKDGTGGESIYGGTFADECLTTEHDRPFLLSMANRGPNTNGSQFFITTAPAPHLNGKHMVFGHVISGEDVVRKIEAVPISDTKAHRPVKSIVIESCGELIPVK-----------KSKVMGEEKKSKKAKKAKKKKRKLSEGEEFSDSESDMDNECSVRKEEVPEVPPPKFLYRGNYDEDQLELQNKVNLSPRHDIDSRESARTRYQEDRSGRVVKGRGRICYQSPNSRSGSPERSTTPPHWRQAS 314          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A4Z2CRR0 (Peptidyl-prolyl cis-trans isomerase D OS=Schistosoma japonicum OX=6182 GN=EWB00_008228 PE=4 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 4.745e-68
Identity = 165/336 (49.11%), Postives = 204/336 (60.71%), Query Frame = 1
Query:   34 KSKLRPRCFFDIDIGHSPA------------GRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVN--ANNKPVVEATISNCGVLIPVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDETETLYPKCSVRPDEIPEVPKPFFLYRGNLXXXXXXXXXXXXXXXXXQYVSKDII------GRSGRLIKGRGQLRYYSKSPR----DRHDTPPHWKKETY 969
            K K + RC+FDI I   P             GRI+FEL++D+CPK AENF KLC G CG+   +GK L Y  SIFHRVIKGFM+QGGDF N DGTGGESIYGG F DE L   HD+PFLLSMAN GPNTNGSQFFITT PA HL+GKHVVFGHV+SGE+++  IE +P++    ++PV    I  CG LIPV+            S      K  KK K  KKK R   + +   D    L  +CSVR +EIPEVP P FLYRGN + ++ E  +           S++         RSGR+IKGRG++ Y S + R    +R  TPPHW++ T+
Sbjct:    3 KHKFKTRCYFDIKIDSQPGNPDYNTNRWHVVGRIVFELFNDVCPKAAENFKKLCQGVCGLGLKTGKPLTYQGSIFHRVIKGFMVQGGDFSNKDGTGGESIYGGTFADECLTTEHDRPFLLSMANRGPNTNGSQFFITTAPAPHLNGKHVVFGHVISGEDVVRKIEAVPISDTKAHRPVKPIVIECCGELIPVK-----------KSKVVGGEKKSKKTKKAKKKKRKLSEGEESSDSESVLDNECSVRKEEIPEVPPPKFLYRGNYEEDQLELQKKMNHSPRHNTDSRESARSRYQEDRSGRVIKGRGRICYQSPNSRSGSPERSTTPPHWRQATF 327          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A026WBG0 (NK-tumor recognition protein OS=Ooceraea biroi OX=2015173 GN=DMN91_002376 PE=4 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 4.128e-67
Identity = 158/322 (49.07%), Postives = 203/322 (63.04%), Query Frame = 1
Query:   43 LRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIPVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXD---------ETETLYPKCSVR---PDEIPEVPKPFFLYRGNLXXXXXXXXXXXXXXXXXQYVSKDII---GRSGRLIKGRGQLRYYSKS-PRDRHDTPPHWKK 960
            +  R FFD+++G  P GRI FEL+ D CP T ENF  LCTG+ G+ + +GK LHY+  IFHRV+K FMIQGGDF  G+GTGGESIYGG F DEN  L H+KPFLLSMANCG +TNGSQFFITT+PA HLD  HVVFG VVSG+ +I  IE LPV+  ++P+ +A + NCG L+   K K KK++ +++S++ S S     K  KKKK +  +K    +D         + + L P  SV    PDEIPEVP   FLYR         +  N       Q+  +D I    ++GR+ KGRG  RY++ S  R R  TPPHWK+
Sbjct:    4 VNARVFFDVEVGGLPMGRITFELFSDTCPITCENFRALCTGERGLGKITGKPLHYIGIIFHRVVKDFMIQGGDFSVGNGTGGESIYGGTFADENFILKHNKPFLLSMANCGRDTNGSQFFITTQPAPHLDNVHVVFGEVVSGQEIITHIEGLPVDRMSRPLQDAKVVNCGELVLKLKAKAKKRETRQSSSEDSDSDSYADKAKKKKKSKKSKKRAKSEDGEVRDSNEEDNKQLNPLVSVTKIDPDEIPEVPANKFLYRAG-------STNNANQKEFRQHYGRDRIRSHRKTGRVFKGRGIFRYHTPSRSRSRSITPPHWKQ 318          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: G4VIP0 (Putative cyclophilin-like protein OS=Schistosoma mansoni OX=6183 GN=Smp_069160.2 PE=4 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 3.441e-66
Identity = 155/323 (47.99%), Postives = 198/323 (61.30%), Query Frame = 1
Query:   34 KSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNAN--NKPVVEATISNCGVLIPVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDETETLYPKCSVRPDEIPEVPKPFFLYRGNLXXXXXXXXXXXXXXXXXQYVSKDII------GRSGRLIKGRGQLRYYSKSPR----DRHDTPPHWKKET 966
            K K + RC+ DI I   PAGRI+FEL++DICPK AENF KLC G CG+   +GK L Y  S+FHRVIKGFM+QGGDF N DGTGGESIYGG F DE L   HD+PFLLSMAN GPNTNGSQFFITT PA HL+GKH+VFGHV+SGE+++  IE +P++    ++PV    I +C                 + S      K  KK K  KKK R   + +   D    +  +CSVR +E+PEVP P FLYRGN   ++ E      +       S++         RSGR++KGRG++ Y S + R    +R  TPPHW++ +
Sbjct:    3 KHKFKTRCYLDIKIDSQPAGRIVFELFNDICPKAAENFKKLCQGVCGLGLKTGKPLTYQGSVFHRVIKGFMVQGGDFSNKDGTGGESIYGGTFADECLTTEHDRPFLLSMANRGPNTNGSQFFITTAPAPHLNGKHMVFGHVISGEDVVRKIEAVPISDTKAHRPVKSIVIESC----------------VKKSKVMGEEKKSKKAKKAKKKKRKLSEGEEFSDSESDMDNECSVRKEEVPEVPPPKFLYRGNYDEDQLELQNKVNLSPRHDIDSRESARTRYQEDRSGRVVKGRGRICYQSPNSRSGSPERSTTPPHWRQAS 309          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppig (peptidylprolyl isomerase G (cyclophilin G) [Source:ZFIN;Acc:ZDB-GENE-040426-2822])

HSP 1 Score: 218.779 bits (556), Expect = 5.082e-60
Identity = 103/173 (59.54%), Postives = 132/173 (76.30%), Query Frame = 1
Query:   46 RPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIP 564
            RPRCFFDI I ++ AGR++ EL+ D+CPKT ENF  LCTG+ G+ +++ K LHY   +FHR++K FMIQGGDF  G+G GGESIYGG F DE+  + H+K FLLSMAN G +TNGSQFFITTKP  HLDG HVVFG V+SG+++I+ IE+   +AN++P  E  + NCG LIP
Sbjct:    7 RPRCFFDIGISNTLAGRVVIELFADVCPKTCENFRCLCTGERGVGKTTQKPLHYKGCLFHRIVKDFMIQGGDFSEGNGRGGESIYGGFFEDESFSVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLDGIHVVFGQVISGQDVIQVIESQKTDANSRPYAEVKVLNCGELIP 179          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppid (peptidylprolyl isomerase D [Source:ZFIN;Acc:ZDB-GENE-040625-34])

HSP 1 Score: 185.267 bits (469), Expect = 3.285e-51
Identity = 98/168 (58.33%), Postives = 120/168 (71.43%), Query Frame = 1
Query:   49 PRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCG 552
            PR +FD+DIG    GR++FEL+ D+ PKTAENF  LCTG+ G  +S+GK LH+    FHR+IK FM+QGGDF N +GTGGESIYG +F DEN    HDK  LLSMAN GPNTNGSQFFITT P  HLDGKHVVFG V+ G  +++ +E +  N  + PV    I+ CG
Sbjct:   16 PRVYFDVDIGGERVGRVVFELFADVVPKTAENFRALCTGEKGTGKSTGKPLHFKGCPFHRIIKKFMVQGGDFSNQNGTGGESIYGDKFEDENFHYKHDKEGLLSMANAGPNTNGSQFFITTVPTPHLDGKHVVFGQVLKGMGVVKILEGIETN-EDTPVKPCVIAECG 182          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: nktr (natural killer cell triggering receptor [Source:ZFIN;Acc:ZDB-GENE-030131-1725])

HSP 1 Score: 187.578 bits (475), Expect = 3.522e-48
Identity = 96/172 (55.81%), Postives = 124/172 (72.09%), Query Frame = 1
Query:   46 RPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLI 561
            RP C+          GRI+F+L+ D+CPKT++NF+ LCTG+ G  +S+GKKL +  S FHRV+K FMIQGGDF  G+G GGESI+GG F DEN  L HD+ FLLSMAN G +TNGSQFFITTK A HLDG HVVFG V+SG  +I+ IE+L  ++ ++P  +  + +CG LI
Sbjct:    6 RPPCYM--------FGRIVFQLFSDVCPKTSKNFLCLCTGEKGTGKSTGKKLCFKGSTFHRVVKNFMIQGGDFTEGNGRGGESIFGGYFEDENFILKHDRAFLLSMANRGKDTNGSQFFITTKTAPHLDGVHVVFGLVISGFEVIKRIESLKTDSASRPYADVRVIDCGQLI 169          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppifb (peptidyl-prolyl cis-trans isomerase A-like [Source:NCBI gene;Acc:103040813])

HSP 1 Score: 142.895 bits (359), Expect = 1.559e-38
Identity = 88/175 (50.29%), Postives = 111/175 (63.43%), Query Frame = 1
Query:   34 KSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVL 558
            ++   P  +FDI   + P GR+ FEL  D+ PKTAENF  LCTG+ G          Y  SIFHRVI  FM QGGDF + +GTGG+SIYG RF+DEN +L H  P +LSMAN GPNTNGSQFFI T     LDG+HVVFG V  G ++++ +E    + + K     TI++CG L
Sbjct:   28 QANANPVVYFDIAADNQPLGRVTFELNADVVPKTAENFRALCTGEHGYG--------YKGSIFHRVIPQFMCQGGDFTHHNGTGGKSIYGPRFHDENFKLRHTGPGILSMANAGPNTNGSQFFICTVKTEWLDGRHVVFGSVKDGLDVVKQVEAFG-SRSGKTSKRITITDCGEL 193          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppic (peptidylprolyl isomerase C [Source:NCBI gene;Acc:103037994])

HSP 1 Score: 143.28 bits (360), Expect = 1.991e-38
Identity = 87/181 (48.07%), Postives = 110/181 (60.77%), Query Frame = 1
Query:   22 IINMKSKLRPRC----FFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCG 552
            +++ K+++ P+     FFDI +G    GRI+  L+ ++ P T  NF+ L TG+ G          Y  S FHRVIK FMIQGGDF  GDGTGG+SIYG  F DEN +L H     +SMAN GP+TNGSQFFIT+  A  LDGKHVVFG V+ G  ++ +IE    N  N P  E  I N G
Sbjct:   22 VVDSKARIGPKVTDKVFFDITVGGHEVGRIVIGLFGEVVPLTVNNFVALATGEKGYG--------YKGSKFHRVIKDFMIQGGDFTAGDGTGGKSIYGKTFADENFKLKHQGTGWVSMANAGPDTNGSQFFITSARAPWLDGKHVVFGKVLEGMTVVHTIELQDTNDRNMPYTECVIVNSG 194          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ppig (peptidylprolyl isomerase G (cyclophilin G) [Source:ZFIN;Acc:ZDB-GENE-040426-2822])

HSP 1 Score: 213.386 bits (542), Expect = 8.153e-59
Identity = 105/174 (60.34%), Postives = 132/174 (75.86%), Query Frame = 1
Query:   31 MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCG 552
            M  K RPRCFFDI I   PAGRI+FEL+ D+CPKT ENF  LCTG+ G+ + + K LH+  + FHR++K FM+QGGDF  G+G GGESIYGG F DEN +L HD+ FLLSMAN G +TNGSQFFITTKPA HLDG+HVVFG V+SG++L++ IEN   +AN+ P  +  + +CG
Sbjct:    1 MGVKQRPRCFFDIAINRIPAGRIVFELFFDVCPKTCENFRCLCTGERGIGKITRKPLHFRSTSFHRIVKNFMVQGGDFSEGNGRGGESIYGGFFEDENFQLKHDQEFLLSMANRGKDTNGSQFFITTKPAPHLDGEHVVFGRVLSGQDLLKEIENQKTDANSLPYADIRVVHCG 174          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010135.1 (pep scaffold:Pmarinus_7.0:GL476417:32947:40880:1 gene:ENSPMAG00000009125.1 transcript:ENSPMAT00000010135.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 143.665 bits (361), Expect = 6.651e-40
Identity = 85/169 (50.30%), Postives = 108/169 (63.91%), Query Frame = 1
Query:   52 RCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVL 558
            + FFD+    +  GR++ EL  D+ PKTAENF  LCTG+        K   Y  S FHRVI  FM QGGDF  G+GTGG+SIYG +F DEN  L H+ P +LSMAN GPNTNGSQFFI T     LD KHVVFG V+SG ++I+ +E+    A+ K   +  +++CG L
Sbjct:    5 QVFFDLTADGASVGRVVMELRGDVVPKTAENFRALCTGE--------KGFGYKGSTFHRVIPDFMCQGGDFTKGNGTGGKSIYGNKFEDENFTLKHEGPGILSMANAGPNTNGSQFFICTAKTAWLDNKHVVFGKVISGLDVIKKVESYGA-ASGKTSKKIVVADCGEL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004873.1 (pep scaffold:Pmarinus_7.0:GL486356:449:3367:-1 gene:ENSPMAG00000004429.1 transcript:ENSPMAT00000004873.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.502 bits (345), Expect = 2.928e-38
Identity = 78/126 (61.90%), Postives = 96/126 (76.19%), Query Frame = 1
Query:   31 MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCT-GDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFI 405
            M  K RPRCFFDI I + PAGRI+ EL+ D+CPKT ENF  LCT G+ G+ +++ K LHY  + FHR++K FMIQGGDF  G+G GGESIYGG FNDE+  + HD+ FLLSMAN G +TNGSQFF+
Sbjct:    1 MGVKNRPRCFFDIAINNIPAGRIVMELFSDVCPKTCENFRCLCTAGERGVGKTTLKPLHYKGTPFHRIVKEFMIQGGDFSEGNGKGGESIYGGFFNDESFAVKHDEDFLLSMANRGKDTNGSQFFM 126          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ppifb (peptidylprolyl isomerase Fb [Source:ZFIN;Acc:ZDB-GENE-051030-126])

HSP 1 Score: 137.117 bits (344), Expect = 1.867e-37
Identity = 87/169 (51.48%), Postives = 104/169 (61.54%), Query Frame = 1
Query:   49 PRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANN-KPVVEATISNCG 552
            P  F D+     P GRI  +L  D+ PKTAENF  LCTG+ G          Y  SIFHR+I  FM QGGDF   +GTGG SIYG  F DEN  L H  P +LSMAN G NTNGSQFFI T+    LDGKHVVFGHV SG ++++ +E L  +  + K  VE  I++CG
Sbjct:   14 PVVFMDVSADSGPLGRITLKLRADVVPKTAENFRALCTGEHGFG--------YKGSIFHRIIPNFMCQGGDFTRNNGTGGVSIYGTTFRDENFILKHTGPGILSMANAGKNTNGSQFFICTELTNWLDGKHVVFGHVTSGMDIVKKMEKLGSSKGDVKGRVE--ITDCG 172          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004654.1 (pep scaffold:Pmarinus_7.0:GL489343:42315:43690:-1 gene:ENSPMAG00000004243.1 transcript:ENSPMAT00000004654.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.094 bits (305), Expect = 1.401e-31
Identity = 75/164 (45.73%), Postives = 97/164 (59.15%), Query Frame = 1
Query:   25 INMKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANN 516
            + + S+  P  F D+     P GRI  EL+ ++ P+TAENF  LCT + G          Y  S  HRVI GFM QGGDF N +GTGG SIY   F DE+ ++ H +  +LSMAN G NTN SQFFIT +   HLD KHV FG V SG +++ ++E L   + N
Sbjct:   48 LEVSSETNPTVFLDVAADDEPLGRISIELFANVVPRTAENFRALCTHEHGFG--------YRNSTIHRVIPGFMCQGGDFTNHNGTGGRSIYEKPFEDESFKILHSRAGILSMANSGRNTNTSQFFITLRATSHLDHKHVAFGAVRSGMSIVRAMEELGSQSGN 203          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR6 (Peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; plays a role in determining prion variants; binds to Hsp82p and contributes to chaperone activity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004206])

HSP 1 Score: 197.208 bits (500), Expect = 2.664e-56
Identity = 107/173 (61.85%), Postives = 126/173 (72.83%), Query Frame = 1
Query:   46 RPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESS-GKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNA-NNKPVVEATISNCGVL 558
            RP+ FFDI IG  P GRI+FELY+DI PKTAENF+KLC G+ GM+++     L Y  SIFHRVIK FM Q GDF N +GTGGESIY  +F DEN  + HDKPFLLSMAN GPNTNGSQ FIT  P  HLDGKHVVFG V+ G+ ++  IEN   +  NNKP+ +  I +CGVL
Sbjct:    3 RPKTFFDISIGGKPQGRIVFELYNDIVPKTAENFLKLCEGNAGMAKTKPDVPLSYKGSIFHRVIKDFMCQFGDFTNFNGTGGESIYDEKFEDENFTVKHDKPFLLSMANAGPNTNGSQAFITCVPTPHLDGKHVVFGEVIQGKRIVRLIENQQCDQENNKPLRDVKIDDCGVL 175          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR1 (Cytoplasmic peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; binds the drug cyclosporin A; N-terminally propionylated in vivo; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000002562])

HSP 1 Score: 158.688 bits (400), Expect = 2.464e-45
Identity = 91/163 (55.83%), Postives = 113/163 (69.33%), Query Frame = 1
Query:   52 RCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENL--PVNANNKPVVEA 534
            + +FD++    P GR++F+LY+DI PKTAENF  LCTG+        K   Y  S FHRVI  FM+QGGDF  G+GTGG+SIYGG+F DEN +  HD+P LLSMAN GPNTNGSQFFITT P   LDGKHVVFG VV G ++++ +E+L  P  A    +V A
Sbjct:    3 QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGE--------KGFGYAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLGSPSGATKARIVVA 157          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR3 (Mitochondrial peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; involved in protein refolding after import into mitochondria [Source:SGD;Acc:S000004543])

HSP 1 Score: 155.606 bits (392), Expect = 5.718e-44
Identity = 92/180 (51.11%), Postives = 111/180 (61.67%), Query Frame = 1
Query:   19 MIINMKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVL 558
            +  N  S+L  + FFD  +  +  GRI FELYD++ PKTAENF  LCTG+ G          Y    FHR+I  FMIQGGD    +G GG+SIYG +F DEN    HDK  LLSMAN GPNTNGSQFFITT P   LDGKHVVFG V  G +++++IE+    A+ KP  E  I   G L
Sbjct:   12 LFSNSASRLGKKVFFDPAVNGTKIGRIEFELYDNVVPKTAENFRALCTGEKGWG--------YKGVPFHRIIPDFMIQGGDTDLTNGFGGKSIYGSKFADENFVKKHDKAGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVTKGMDIVKAIESYG-TASGKPRAEIVIEEAGEL 182          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR2 (Peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; potential role in the secretory pathway; seamless-GFP and mCherry fusion proteins localize to the vacuole, while SWAT-GFP fusion localizes to both the endoplasmic reticulum and vacuole; suppresses toxicity of slow-folding human Z-type alpha1-antitrypsin variant associated with liver cirrhosis and emphysema [Source:SGD;Acc:S000001099])

HSP 1 Score: 146.747 bits (369), Expect = 1.491e-40
Identity = 87/175 (49.71%), Postives = 113/175 (64.57%), Query Frame = 1
Query:   43 LRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFI-TTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIP 564
            +  + FFDI+ G    GRI+  LY  +CPKTA+NF KL T       ++  K  ++ S FHRVI  FM+QGGDF +G G GG+SIYG  F DEN  L HD+   LSMAN G +TNGSQFFI TT+ A  LDGKHVVFG VV G +++  I+++  +AN+KP+    I+ CG   P
Sbjct:   34 ITQKVFFDIEHGEEKVGRIVIGLYGKVCPKTAKNFYKLST-------TTNSKKGFIGSTFHRVIPNFMVQGGDFTDGTGVGGKSIYGDTFPDENFTLKHDRKGRLSMANRGKDTNGSQFFITTTEEASWLDGKHVVFGQVVDGMDVVNYIQHVSRDANDKPLEAVKIAKCGEWTP 201          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR5 (Peptidyl-prolyl cis-trans isomerase (cyclophilin) of the ER; catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; transcriptionally induced in response to unfolded proteins in the ER; CPR5 has a paralog, CPR2, that arose from the whole genome duplication [Source:SGD;Acc:S000002712])

HSP 1 Score: 144.821 bits (364), Expect = 1.163e-39
Identity = 87/173 (50.29%), Postives = 108/173 (62.43%), Query Frame = 1
Query:   40 KLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVL 558
            ++  + +FDI+ G    GRI+  LY    P+T ENF +L         S   K+ YL SIFHRVI  FMIQGGDF +  G GG+SI+G  F DEN ++ HDKP  LSMAN G NTNGSQFFITT P   LDGKHVVFG V+ G +++  IEN+  ++ N PV E  I   G L
Sbjct:   31 EITHKVYFDINHGDKQIGRIVMGLYGLTTPQTVENFYQLTI-------SRDPKMGYLNSIFHRVIPNFMIQGGDFTHRSGIGGKSIFGNTFKDENFDVKHDKPGRLSMANRGKNTNGSQFFITTVPCPWLDGKHVVFGEVLDGMDVVHYIENVKTDSRNMPVKEVIIVESGEL 196          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO48915 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7RHU5])

HSP 1 Score: 225.713 bits (574), Expect = 1.072e-67
Identity = 114/173 (65.90%), Postives = 135/173 (78.03%), Query Frame = 1
Query:   46 RPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIP 564
            RPRCFFD+ +   PAGRIIFEL+ D+CPKT ENF  LCTG+CG+ +++GK LHY  S FHRV+K FMIQGGDF +G+GTGGESIYGG F DE  E  H++P LLSMAN GPNTNGSQFFITT+PA HLD  HVVFGHV+ GE L+  IE+LP N  N+P  +  +SNCG LIP
Sbjct:   10 RPRCFFDVAVSDGPAGRIIFELFADVCPKTCENFRALCTGECGVGKNTGKPLHYKGSPFHRVVKDFMIQGGDFSSGNGTGGESIYGGTFGDECFEFKHERPMLLSMANRGPNTNGSQFFITTQPAPHLDNIHVVFGHVIQGEELVRQIESLPTNEKNRPNADVKVSNCGELIP 182          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO41747 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3C4])

HSP 1 Score: 190.274 bits (482), Expect = 1.847e-53
Identity = 102/175 (58.29%), Postives = 123/175 (70.29%), Query Frame = 1
Query:   40 KLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIP 564
            K  PRCFFD+ IG    GR++FEL+ D  PKTAENF  LCTG+ G+  S+GK LHY    FHR+IK FM+QGGDF N +GTGGESIYG +F DE+    HDKP LLSMAN GPNTNGSQFFITT P  HLDG+HVVFG V+ G +++  +E  PV+ ++ P     I  CG L P
Sbjct:   13 KPNPRCFFDVTIGGEKVGRVLFELFADKVPKTAENFRALCTGEKGIGPSTGKPLHYKGCPFHRIIKDFMVQGGDFSNKNGTGGESIYGEKFADEDFTYKHDKPGLLSMANSGPNTNGSQFFITTVPTPHLDGRHVVFGKVLKGMDVVRELEATPVD-DSSPKSPCIIEECGELAP 186          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO31539 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7SXN2])

HSP 1 Score: 151.369 bits (381), Expect = 2.632e-42
Identity = 90/167 (53.89%), Postives = 110/167 (65.87%), Query Frame = 1
Query:   58 FFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVL 558
            +FDI+IG +PAGRI+ EL DD+ PKTAENF  LCTG+        K   Y  S FHRVI GFM QGGDF  GDGTGG+SIYG +F DEN  L H  P +LSMAN GP TNGSQFF+ T     LDGKHVVFG V  G ++++ IE +  ++  K   +  I++ G L
Sbjct:    6 YFDIEIGGAPAGRIVMELRDDVVPKTAENFRALCTGE--------KGFGYKGSSFHRVIPGFMCQGGDFTRGDGTGGKSIYGAKFADENFNLKHTGPGILSMANAGPGTNGSQFFLCTAKTSWLDGKHVVFGSVKDGMDVVKKIEKVGSDS-GKTSKKVVIADSGEL 163          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO42412 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7S1Q9])

HSP 1 Score: 146.747 bits (369), Expect = 1.413e-40
Identity = 91/169 (53.85%), Postives = 107/169 (63.31%), Query Frame = 1
Query:   49 PRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYG-GRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCG 552
            P  FFDI IG    GR+  EL+ D  PKTAENF + CTG+      +G  + Y   +FHRVIK FMIQGGDFV GDGTG  SIYG   F DE+ +L HD    LSMAN G N+NG QFFIT      LDGKHVVFG V+ G  ++  IEN+PV  NN+P +   IS CG
Sbjct:    7 PIVFFDITIGGQEVGRMKMELFADAVPKTAENFRQFCTGE---YRKNGVPVGYKGCVFHRVIKDFMIQGGDFVKGDGTGVMSIYGESAFADESFKLKHDGAGYLSMANSGINSNGCQFFITCAKCDFLDGKHVVFGKVIDGLLVMRKIENVPVGPNNRPKLNVVISQCG 172          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO34613 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7SNV5])

HSP 1 Score: 145.591 bits (366), Expect = 8.026e-40
Identity = 87/172 (50.58%), Postives = 108/172 (62.79%), Query Frame = 1
Query:   43 LRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVL 558
            +  + FFDI IG   AGRI   L+    PKTAENF +L TG+ G          Y  SIFHRVI+ FMIQGGDF  GDGTGG+SIYG +F DEN +L H     LSMAN G +TNGSQFFITT     LDG+HVVFG V+ G +++  IE    +  ++PV E  +++ G L
Sbjct:   25 VTKKVFFDITIGGEKAGRIEIGLFGKAVPKTAENFFQLATGEKGFG--------YKNSIFHRVIQDFMIQGGDFTKGDGTGGKSIYGQKFADENFKLQHYGAGWLSMANAGKDTNGSQFFITTVKTPWLDGRHVVFGKVLKGMDVVRKIEKSKTDHGDRPVKEVKVADSGSL 188          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: PPIG (peptidylprolyl isomerase G [Source:NCBI gene;Acc:101158399])

HSP 1 Score: 216.853 bits (551), Expect = 1.845e-59
Identity = 102/178 (57.30%), Postives = 131/178 (73.60%), Query Frame = 1
Query:   31 MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIP 564
            M  K+RPRCF DI I +   GR++ EL+ D+CPKT ENF  LCTG+ G+ + + K LHY  S+FHR++K FMIQGGDF  G+G GGESIYGG F DE+  + H+K  LLSMAN G +TNGSQFFITTKPA HLDG HVVFG VVSG+ +++++EN   + +++P  E  I NCG L+P
Sbjct:    1 MGIKVRPRCFLDIGISNVLVGRVVVELFSDVCPKTCENFRCLCTGEKGIGKGTQKPLHYKGSVFHRIVKDFMIQGGDFSEGNGRGGESIYGGFFEDESFAMKHNKDLLLSMANRGKDTNGSQFFITTKPAPHLDGVHVVFGQVVSGQEVVQTMENQKTDPSSRPYAEVKILNCGELVP 178          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: nktr (natural killer cell triggering receptor [Source:NCBI gene;Acc:101155392])

HSP 1 Score: 213.386 bits (542), Expect = 2.192e-56
Identity = 104/177 (58.76%), Postives = 131/177 (74.01%), Query Frame = 1
Query:   31 MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLI 561
            M+ K RP+C+FD+++   P GRI+F+LY DICPKT++NF+ LCTG+ G  + +GKKL Y  S FHRV+K FMIQGGDF  G G GGESIYGG F DEN  L HD+ FLLSMAN G +TNGSQFFITTK A HLDG HVVFG V+SG  +I+ IE L  ++ ++P  +  + +CG LI
Sbjct:    1 MRVKDRPQCYFDVELNRDPVGRIVFQLYSDICPKTSKNFLCLCTGERGSGKVTGKKLCYKGSTFHRVVKNFMIQGGDFTEGTGRGGESIYGGYFKDENFILKHDRAFLLSMANRGKDTNGSQFFITTKTAPHLDGVHVVFGLVISGFEIIKKIEGLKTDSASRPYADVRVVDCGQLI 177          

HSP 2 Score: 52.7582 bits (125), Expect = 2.094e-6
Identity = 29/88 (32.95%), Postives = 50/88 (56.82%), Query Frame = 1
Query:  730 VRPDEIPEVPKPFFLYRGNLXXXXXXXXXXXXXXXXXQYVSKDIIGRSGRLIKGRGQLRYYS-------KSPRDRH---DTPPHWKKE 963
            VRP+EIP VP+  FL R ++ +++ +    ++   +     K  + +SGR I+GRG +RY++        +  + H   +TPPHWK+E
Sbjct:  283 VRPEEIPPVPENRFLLRRDMPSQQVKTEIVEKKETTVSAEQKPAVSKSGRTIRGRGTIRYHTPTRSKSRSASVEEHGSSETPPHWKEE 370          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ppid (peptidylprolyl isomerase D [Source:NCBI gene;Acc:101167275])

HSP 1 Score: 183.341 bits (464), Expect = 1.348e-50
Identity = 97/168 (57.74%), Postives = 120/168 (71.43%), Query Frame = 1
Query:   49 PRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCG 552
            PR FFD+DIG   AGRI+ EL+ D+ P+TA NF+ LCTG+ G+  S+GK LH+    FHR+IK FMIQGGDF N +GTGGESIYG +F DEN    HDK  LLSMAN GPNTNGSQFFITT    HLDGKHVVFG V+ G  +++++E +     + PV    I++CG
Sbjct:   16 PRVFFDVDIGGERAGRIVLELFADVTPRTAANFLALCTGEKGIGSSTGKPLHFKGCPFHRIIKKFMIQGGDFSNHNGTGGESIYGDKFEDENFHYKHDKVGLLSMANAGPNTNGSQFFITTVATPHLDGKHVVFGQVLKGMGVVKTLEAVETE-EDAPVKPCVIADCG 182          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ppid (peptidylprolyl isomerase D [Source:NCBI gene;Acc:101167275])

HSP 1 Score: 183.341 bits (464), Expect = 1.533e-50
Identity = 97/168 (57.74%), Postives = 120/168 (71.43%), Query Frame = 1
Query:   49 PRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCG 552
            PR FFD+DIG   AGRI+ EL+ D+ P+TA NF+ LCTG+ G+  S+GK LH+    FHR+IK FMIQGGDF N +GTGGESIYG +F DEN    HDK  LLSMAN GPNTNGSQFFITT    HLDGKHVVFG V+ G  +++++E +     + PV    I++CG
Sbjct:   16 PRVFFDVDIGGERAGRIVLELFADVTPRTAANFLALCTGEKGIGSSTGKPLHFKGCPFHRIIKKFMIQGGDFSNHNGTGGESIYGDKFEDENFHYKHDKVGLLSMANAGPNTNGSQFFITTVATPHLDGKHVVFGQVLKGMGVVKTLEAVETE-EDAPVKPCVIADCG 182          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ppid (peptidylprolyl isomerase D [Source:NCBI gene;Acc:101167275])

HSP 1 Score: 182.57 bits (462), Expect = 4.183e-50
Identity = 97/168 (57.74%), Postives = 120/168 (71.43%), Query Frame = 1
Query:   49 PRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCG 552
            PR FFD+DIG   AGRI+ EL+ D+ P+TA NF+ LCTG+ G+  S+GK LH+    FHR+IK FMIQGGDF N +GTGGESIYG +F DEN    HDK  LLSMAN GPNTNGSQFFITT    HLDGKHVVFG V+ G  +++++E +     + PV    I++CG
Sbjct:   16 PRVFFDVDIGGERAGRIVLELFADVTPRTAANFLALCTGEKGIGSSTGKPLHFKGCPFHRIIKKFMIQGGDFSNHNGTGGESIYGDKFEDENFHYKHDKVGLLSMANAGPNTNGSQFFITTVATPHLDGKHVVFGQVLKGMGVVKTLEAVETE-EDAPVKPCVIADCG 182          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000070665.1 (SMESG000070665.1)

HSP 1 Score: 1228.77 bits (3178), Expect = 0.000e+0
Identity = 801/801 (100.00%), Postives = 801/801 (100.00%), Query Frame = 1
Query:   31 MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIPVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDETETLYPKCSVRPDEIPEVPKPFFLYRGNLXXXXXXXXXXXXXXXXXQYVSKDIIGRSGRLIKGRGQLRYYSKSPRDRHDTPPHWKKETYKVSDNIDNQGSIKRKSPSSSPNKEIQTSRQRKDNQSPRQSFRNNDSNNIRNTEKQDSVGREKRKRYDIWKDAPDKSDGKIKRSRRREELEDYGDIDKLDKENLSQKNYNRKRSNSLDRIKPLDREKTNAKSIKSKNNLPDAQQDKVDKHESKSIIYPYNDESDESLKQKRLENPVDNKVIDYKSRNPHRDLSDXXXXXXXXXXXXXYHXXXXXXXXXXXXXXXYRQKSKSPIETKRTTHSPPAHLVAKWQNRREKIMIRRSSLSKSNERQXXXXXXXXXXXXXXXXXXXNSERNKNESKHYGERNVSDNVCKISIGKXXXXXXXXXXXXXXXXXXXXXXNRPCRIDSELSDAEKTVNTQCWINHSAANPVVEGNKEKKSDIPPMTLDKPKDEIKTNENSIEKEAIMVIKPPEKTWLTNQWKTXXXXXXXXXXXXXXXXXXXXLREXXXXXXXXXXXXXXXXTNHGESHQGVKKLQSPISQSISKYRSA 2433
            MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQGGDFVNGDGTGGESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIPVRKKKIKKQKVKEASADSSSSKGKKKKKSKKKKHRNKRKTKTVKDETETLYPKCSVRPDEIPEVPKPFFLYRGNLKNEKSENNENKEIINSSQYVSKDIIGRSGRLIKGRGQLRYYSKSPRDRHDTPPHWKKETYKVSDNIDNQGSIKRKSPSSSPNKEIQTSRQRKDNQSPRQSFRNNDSNNIRNTEKQDSVGREKRKRYDIWKDAPDKSDGKIKRSRRREELEDYGDIDKLDKENLSQKNYNRKRSNSLDRIKPLDREKTNAKSIKSKNNLPDAQQDKVDKHESKSIIYPYNDESDESLKQKRLENPVDNKVIDYKSRNPHRDLSDKNEEIKKKSNKNNYHDDSKIDRKRSSSFDDYRQKSKSPIETKRTTHSPPAHLVAKWQNRREKIMIRRSSLSKSNERQPSRSRYSPRKRSSRYSKSPNSERNKNESKHYGERNVSDNVCKISIGKSKDRSSSGTMDSSLSSAGSSVSNRPCRIDSELSDAEKTVNTQCWINHSAANPVVEGNKEKKSDIPPMTLDKPKDEIKTNENSIEKEAIMVIKPPEKTWLTNQWKTEEEEANKKIAKIANNSILAKLREDDQKKKSKEKTDKPFDTNHGESHQGVKKLQSPISQSISKYRSA
Sbjct:    1 MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQGGDFVNGDGTGGESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIPVRKKKIKKQKVKEASADSSSSKGKKKKKSKKKKHRNKRKTKTVKDETETLYPKCSVRPDEIPEVPKPFFLYRGNLKNEKSENNENKEIINSSQYVSKDIIGRSGRLIKGRGQLRYYSKSPRDRHDTPPHWKKETYKVSDNIDNQGSIKRKSPSSSPNKEIQTSRQRKDNQSPRQSFRNNDSNNIRNTEKQDSVGREKRKRYDIWKDAPDKSDGKIKRSRRREELEDYGDIDKLDKENLSQKNYNRKRSNSLDRIKPLDREKTNAKSIKSKNNLPDAQQDKVDKHESKSIIYPYNDESDESLKQKRLENPVDNKVIDYKSRNPHRDLSDKNEEIKKKSNKNNYHDDSKIDRKRSSSFDDYRQKSKSPIETKRTTHSPPAHLVAKWQNRREKIMIRRSSLSKSNERQPSRSRYSPRKRSSRYSKSPNSERNKNESKHYGERNVSDNVCKISIGKSKDRSSSGTMDSSLSSAGSSVSNRPCRIDSELSDAEKTVNTQCWINHSAANPVVEGNKEKKSDIPPMTLDKPKDEIKTNENSIEKEAIMVIKPPEKTWLTNQWKTEEEEANKKIAKIANNSILAKLREDDQKKKSKEKTDKPFDTNHGESHQGVKKLQSPISQSISKYRSA 801          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000070665.1 (SMESG000070665.1)

HSP 1 Score: 1210.28 bits (3130), Expect = 0.000e+0
Identity = 795/801 (99.25%), Postives = 795/801 (99.25%), Query Frame = 1
Query:   31 MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIPVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDETETLYPKCSVRPDEIPEVPKPFFLYRGNLXXXXXXXXXXXXXXXXXQYVSKDIIGRSGRLIKGRGQLRYYSKSPRDRHDTPPHWKKETYKVSDNIDNQGSIKRKSPSSSPNKEIQTSRQRKDNQSPRQSFRNNDSNNIRNTEKQDSVGREKRKRYDIWKDAPDKSDGKIKRSRRREELEDYGDIDKLDKENLSQKNYNRKRSNSLDRIKPLDREKTNAKSIKSKNNLPDAQQDKVDKHESKSIIYPYNDESDESLKQKRLENPVDNKVIDYKSRNPHRDLSDXXXXXXXXXXXXXYHXXXXXXXXXXXXXXXYRQKSKSPIETKRTTHSPPAHLVAKWQNRREKIMIRRSSLSKSNERQXXXXXXXXXXXXXXXXXXXNSERNKNESKHYGERNVSDNVCKISIGKXXXXXXXXXXXXXXXXXXXXXXNRPCRIDSELSDAEKTVNTQCWINHSAANPVVEGNKEKKSDIPPMTLDKPKDEIKTNENSIEKEAIMVIKPPEKTWLTNQWKTXXXXXXXXXXXXXXXXXXXXLREXXXXXXXXXXXXXXXXTNHGESHQGVKKLQSPISQSISKYRSA 2433
            MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQGGDFVNGDGTGGESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIPVRKKKIKKQKVKEASADSSSSKGKKKKKSKKKKHRNKRKTKTVKDETETLYPKCSVRPDEIPEVPKPFFLYRGNLKNEKSENNENKEIINSSQYVSKDIIGRSGRLIKGRGQLRYYSKSPRDRHDTPPHWKKETYKVSDNIDNQGSIKRKSPSSSPNKEIQTSRQRKDNQSPRQSFRNNDSNNIRNTEKQDSVGREKRKRYDIWKDAPDKSDGKIKRSRRREELEDYGDIDKLDKENLSQKNYNRKRSNSLDRIKPLDREKTNAKSIKSKNNLPDAQQDKVDKHESKSIIYPYNDESDESLKQKRLENPVDNKVIDYKSRNPHRDLSDKNEEIKKKSNKNNYHDDSKIDRKRSSSFDDYRQKSKSPIETKRTTHSPPAHLVAKWQNRREKIMIRRSSLSKSNERQPSRSRYSPRKRSSRYSKSPNSERNKNESKHYGERNVSDNVCKISIGKSKDRSSSGTMDSSLSSAGSSV      IDSELSDAEKTVNTQCWINHSAANPVVEGNKEKKSDIPPMTLDKPKDEIKTNENSIEKEAIMVIKPPEKTWLTNQWKTEEEEANKKIAKIANNSILAKLREDDQKKKSKEKTDKPFDTNHGESHQGVKKLQSPISQSISKYRSA
Sbjct:    1 MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQGGDFVNGDGTGGESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIPVRKKKIKKQKVKEASADSSSSKGKKKKKSKKKKHRNKRKTKTVKDETETLYPKCSVRPDEIPEVPKPFFLYRGNLKNEKSENNENKEIINSSQYVSKDIIGRSGRLIKGRGQLRYYSKSPRDRHDTPPHWKKETYKVSDNIDNQGSIKRKSPSSSPNKEIQTSRQRKDNQSPRQSFRNNDSNNIRNTEKQDSVGREKRKRYDIWKDAPDKSDGKIKRSRRREELEDYGDIDKLDKENLSQKNYNRKRSNSLDRIKPLDREKTNAKSIKSKNNLPDAQQDKVDKHESKSIIYPYNDESDESLKQKRLENPVDNKVIDYKSRNPHRDLSDKNEEIKKKSNKNNYHDDSKIDRKRSSSFDDYRQKSKSPIETKRTTHSPPAHLVAKWQNRREKIMIRRSSLSKSNERQPSRSRYSPRKRSSRYSKSPNSERNKNESKHYGERNVSDNVCKISIGKSKDRSSSGTMDSSLSSAGSSV------IDSELSDAEKTVNTQCWINHSAANPVVEGNKEKKSDIPPMTLDKPKDEIKTNENSIEKEAIMVIKPPEKTWLTNQWKTEEEEANKKIAKIANNSILAKLREDDQKKKSKEKTDKPFDTNHGESHQGVKKLQSPISQSISKYRSA 795          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000070665.1 (SMESG000070665.1)

HSP 1 Score: 1174.07 bits (3036), Expect = 0.000e+0
Identity = 763/801 (95.26%), Postives = 765/801 (95.51%), Query Frame = 1
Query:   31 MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIPVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDETETLYPKCSVRPDEIPEVPKPFFLYRGNLXXXXXXXXXXXXXXXXXQYVSKDIIGRSGRLIKGRGQLRYYSKSPRDRHDTPPHWKKETYKVSDNIDNQGSIKRKSPSSSPNKEIQTSRQRKDNQSPRQSFRNNDSNNIRNTEKQDSVGREKRKRYDIWKDAPDKSDGKIKRSRRREELEDYGDIDKLDKENLSQKNYNRKRSNSLDRIKPLDREKTNAKSIKSKNNLPDAQQDKVDKHESKSIIYPYNDESDESLKQKRLENPVDNKVIDYKSRNPHRDLSDXXXXXXXXXXXXXYHXXXXXXXXXXXXXXXYRQKSKSPIETKRTTHSPPAHLVAKWQNRREKIMIRRSSLSKSNERQXXXXXXXXXXXXXXXXXXXNSERNKNESKHYGERNVSDNVCKISIGKXXXXXXXXXXXXXXXXXXXXXXNRPCRIDSELSDAEKTVNTQCWINHSAANPVVEGNKEKKSDIPPMTLDKPKDEIKTNENSIEKEAIMVIKPPEKTWLTNQWKTXXXXXXXXXXXXXXXXXXXXLREXXXXXXXXXXXXXXXXTNHGESHQGVKKLQSPISQSISKYRSA 2433
            MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQGGDFVNGDGTGGESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIPVRKKKIKKQKVKEASADSSSSKGKKKKKSKKKKHRNKRKTKTVKDETETLYPKCSVRPDEIPEVPKPFFLYRGNLKNEKSENNENKEIINSSQYVSKDIIGRSGRLIKGRGQLRYYSKSPRDRHDTPPHWKKETYKVSDNIDNQGSIKRKSPSSSPNKEIQTSRQRKDNQSPRQSFRNNDSNNIRNTEKQDSVGREKRKRYDIWKDAPDKSDGKIKRSRRREELEDYGDIDKLDKENLSQKNYNRKRSNSLDRIKPLDREKTNAKSIKSKNNLPDAQQDKVDKHESKSIIYPYNDESDESLKQKRLENPVDNKVIDYKSRNPHRDLSDKNEEIKKKSNKNNYHDDSKIDRKRSSSFDDYRQKSKSPIETKRTTHSPPAHLVAKWQNRREKIMIRRSSLSKSNERQPSRSRYSPRKRSSRYSKSPNSERNKNESKHYGERNVSDNVCKISIGKSKD                       R  S   D+  +      INHSAANPVVEGNKEKKSDIPPMTLDKPKDEIKTNENSIEKEAIMVIKPPEKTWLTNQWKTEEEEANKKIAKIANNSILAKLREDDQKKKSKEKTDKPFDTNHGESHQGVKKLQSPISQSISKYRSA
Sbjct:    1 MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQGGDFVNGDGTGGESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIPVRKKKIKKQKVKEASADSSSSKGKKKKKSKKKKHRNKRKTKTVKDETETLYPKCSVRPDEIPEVPKPFFLYRGNLKNEKSENNENKEIINSSQYVSKDIIGRSGRLIKGRGQLRYYSKSPRDRHDTPPHWKKETYKVSDNIDNQGSIKRKSPSSSPNKEIQTSRQRKDNQSPRQSFRNNDSNNIRNTEKQDSVGREKRKRYDIWKDAPDKSDGKIKRSRRREELEDYGDIDKLDKENLSQKNYNRKRSNSLDRIKPLDREKTNAKSIKSKNNLPDAQQDKVDKHESKSIIYPYNDESDESLKQKRLENPVDNKVIDYKSRNPHRDLSDKNEEIKKKSNKNNYHDDSKIDRKRSSSFDDYRQKSKSPIETKRTTHSPPAHLVAKWQNRREKIMIRRSSLSKSNERQPSRSRYSPRKRSSRYSKSPNSERNKNESKHYGERNVSDNVCKISIGKSKD-----------------------RSSSGTMDSSLSSAGSSVINHSAANPVVEGNKEKKSDIPPMTLDKPKDEIKTNENSIEKEAIMVIKPPEKTWLTNQWKTEEEEANKKIAKIANNSILAKLREDDQKKKSKEKTDKPFDTNHGESHQGVKKLQSPISQSISKYRSA 778          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000070665.1 (SMESG000070665.1)

HSP 1 Score: 1167.53 bits (3019), Expect = 0.000e+0
Identity = 763/803 (95.02%), Postives = 765/803 (95.27%), Query Frame = 1
Query:   31 MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIPVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDETETLYPKCSVRPDEIPEVPKPFFLYRGNLXXXXXXXXXXXXXXXXXQYVSKDIIGRSGRLIKGRGQLRYYSKSPRDRHDTPPHWKKETYKVSDNIDNQGSIKRKSPSSSPNKEIQTSRQRKDNQSPRQSFRNNDSNNIRNTEKQDSVGREKRKRYDIWKDAPDKSDGKIKRSRRREELEDYGDIDKLDKENLSQKNYNRKRSNSLDRIKPLDREKTNAKSIKSKNNLPDAQQDKVDKHESKSIIYPYNDESDESLKQKRLENPVDNKVIDYKSRNPHRDLSDXXXX--XXXXXXXXXYHXXXXXXXXXXXXXXXYRQKSKSPIETKRTTHSPPAHLVAKWQNRREKIMIRRSSLSKSNERQXXXXXXXXXXXXXXXXXXXNSERNKNESKHYGERNVSDNVCKISIGKXXXXXXXXXXXXXXXXXXXXXXNRPCRIDSELSDAEKTVNTQCWINHSAANPVVEGNKEKKSDIPPMTLDKPKDEIKTNENSIEKEAIMVIKPPEKTWLTNQWKTXXXXXXXXXXXXXXXXXXXXLREXXXXXXXXXXXXXXXXTNHGESHQGVKKLQSPISQSISKYRSA 2433
            MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQGGDFVNGDGTGGESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIPVRKKKIKKQKVKEASADSSSSKGKKKKKSKKKKHRNKRKTKTVKDETETLYPKCSVRPDEIPEVPKPFFLYRGNLKNEKSENNENKEIINSSQYVSKDIIGRSGRLIKGRGQLRYYSKSPRDRHDTPPHWKKETYKVSDNIDNQGSIKRKSPSSSPNKEIQTSRQRKDNQSPRQSFRNNDSNNIRNTEKQDSVGREKRKRYDIWKDAPDKSDGKIKRSRRREELEDYGDIDKLDKENLSQKNYNRKRSNSLDRIKPLDREKTNAKSIKSKNNLPDAQQDKVDKHESKSIIYPYNDESDESLKQKRLENPVDNKVIDYKSRNPHRDLSDKNEE  IKKKSNKNNYHDDSKIDRKRSSSFDDYRQKSKSPIETKRTTHSPPAHLVAKWQNRREKIMIRRSSLSKSNERQPSRSRYSPRKRSSRYSKSPNSERNKNESKHYGERNVSDNVCKISIGKSKD                       R  S   D+  +      INHSAANPVVEGNKEKKSDIPPMTLDKPKDEIKTNENSIEKEAIMVIKPPEKTWLTNQWKTEEEEANKKIAKIANNSILAKLREDDQKKKSKEKTDKPFDTNHGESHQGVKKLQSPISQSISKYRSA
Sbjct:    1 MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQGGDFVNGDGTGGESIYGGRFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCGVLIPVRKKKIKKQKVKEASADSSSSKGKKKKKSKKKKHRNKRKTKTVKDETETLYPKCSVRPDEIPEVPKPFFLYRGNLKNEKSENNENKEIINSSQYVSKDIIGRSGRLIKGRGQLRYYSKSPRDRHDTPPHWKKETYKVSDNIDNQGSIKRKSPSSSPNKEIQTSRQRKDNQSPRQSFRNNDSNNIRNTEKQDSVGREKRKRYDIWKDAPDKSDGKIKRSRRREELEDYGDIDKLDKENLSQKNYNRKRSNSLDRIKPLDREKTNAKSIKSKNNLPDAQQDKVDKHESKSIIYPYNDESDESLKQKRLENPVDNKVIDYKSRNPHRDLSDKNEELKIKKKSNKNNYHDDSKIDRKRSSSFDDYRQKSKSPIETKRTTHSPPAHLVAKWQNRREKIMIRRSSLSKSNERQPSRSRYSPRKRSSRYSKSPNSERNKNESKHYGERNVSDNVCKISIGKSKD-----------------------RSSSGTMDSSLSSAGSSVINHSAANPVVEGNKEKKSDIPPMTLDKPKDEIKTNENSIEKEAIMVIKPPEKTWLTNQWKTEEEEANKKIAKIANNSILAKLREDDQKKKSKEKTDKPFDTNHGESHQGVKKLQSPISQSISKYRSA 780          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000025182.1 (SMESG000025182.1)

HSP 1 Score: 158.303 bits (399), Expect = 4.419e-44
Identity = 91/175 (52.00%), Postives = 115/175 (65.71%), Query Frame = 1
Query:   31 MKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGDCGMSESSGKKLHYLQSIFHRVIKGFMIQXXXXXXXXXXXXESIYGG-RFNDENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSGENLIESIENLPVNANNKPVVEATISNCG 552
            M++   P  FFD+ +G    GRI FEL+ DI PKTA+NF + CTG+       G  + Y  S FHR+IK FM+QGGDF+N DGTG  SIYGG  F+DEN E+ HD    LSMAN G ++NG QFFIT  P   LDGKHVVFG VV G  +++ IEN+P   NN+  ++  I+NCG
Sbjct:   14 MRNPTNPVVFFDVSVGGQDIGRIQFELFADIVPKTADNFRQFCTGE---YRKDGVPIGYKNSTFHRIIKEFMVQGGDFINNDGTGVFSIYGGSMFSDENFEMKHDSAGKLSMANSGKDSNGCQFFITCAPCEFLDGKHVVFGQVVDGMLVLKKIENVPTGPNNRAKIQVVITNCG 185          
The following BLAST results are available for this feature:
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPIG3.179e-6161.27peptidylprolyl isomerase G [Source:HGNC Symbol;Acc... [more]
PPIG3.179e-6161.27peptidylprolyl isomerase G [Source:HGNC Symbol;Acc... [more]
PPIG3.274e-6061.27peptidylprolyl isomerase G [Source:HGNC Symbol;Acc... [more]
PPIG7.076e-5961.27peptidylprolyl isomerase G [Source:HGNC Symbol;Acc... [more]
NKTR9.512e-5960.45natural killer cell triggering receptor [Source:HG... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyn-86.032e-5156.47Peptidyl-prolyl cis-trans isomerase 8 [Source:Uni... [more]
cyn-86.032e-5156.47Peptidyl-prolyl cis-trans isomerase 8 [Source:Uni... [more]
cyn-89.951e-5156.47Peptidyl-prolyl cis-trans isomerase 8 [Source:Uni... [more]
cyn-95.362e-4954.12Peptidyl-prolyl cis-trans isomerase 9 [Source:Uni... [more]
cyn-14.132e-4854.97Peptidyl-prolyl cis-trans isomerase 1 [Source:Uni... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Moca-cyp2.855e-6460.11gene:FBgn0039581 transcript:FBtr0085286[more]
CG172661.457e-4554.55gene:FBgn0033089 transcript:FBtr0307502[more]
CG172661.457e-4554.55gene:FBgn0033089 transcript:FBtr0086144[more]
CG28521.865e-4152.60gene:FBgn0034753 transcript:FBtr0071933[more]
CG28521.865e-4152.60gene:FBgn0034753 transcript:FBtr0345504[more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppig2.363e-6058.38peptidylprolyl isomerase G (cyclophilin G) [Source... [more]
nktr6.119e-5658.19natural killer cell triggering receptor [Source:ZF... [more]
ppid2.298e-5158.33peptidylprolyl isomerase D [Source:ZFIN;Acc:ZDB-GE... [more]
ppih3.397e-4255.95peptidylprolyl isomerase H (cyclophilin H) [Source... [more]
ppih3.397e-4255.95peptidylprolyl isomerase H (cyclophilin H) [Source... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppig3.288e-6562.21peptidylprolyl isomerase G (cyclophilin G) [Source... [more]
ppig6.023e-6054.91peptidylprolyl isomerase G (cyclophilin G) [Source... [more]
pcsk62.236e-5859.32proprotein convertase subtilisin/kexin type 6 [Sou... [more]
ppig1.883e-5656.98peptidylprolyl isomerase G (cyclophilin G) [Source... [more]
pcsk67.746e-5159.64proprotein convertase subtilisin/kexin type 6 [Sou... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppig1.299e-6161.27peptidyl-prolyl isomerase G (cyclophilin G) [Sourc... [more]
Ppig1.299e-6161.27peptidyl-prolyl isomerase G (cyclophilin G) [Sourc... [more]
Nktr5.481e-5960.45natural killer tumor recognition sequence [Source:... [more]
Nktr1.203e-5860.45natural killer tumor recognition sequence [Source:... [more]
Ppid3.317e-5260.00peptidylprolyl isomerase D (cyclophilin D) [Source... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A2AR02|PPIG_MOUSE9.085e-6161.27Peptidyl-prolyl cis-trans isomerase G OS=Mus muscu... [more]
sp|Q5B4E7|PPID_EMENI1.142e-6063.64Peptidyl-prolyl cis-trans isomerase D OS=Emericell... [more]
sp|Q13427|PPIG_HUMAN1.527e-6061.27Peptidyl-prolyl cis-trans isomerase G OS=Homo sapi... [more]
sp|O55035|PPIG_RAT1.617e-6060.69Peptidyl-prolyl cis-trans isomerase G OS=Rattus no... [more]
sp|Q6BXZ7|PPID_DEBHA2.190e-6061.41Peptidyl-prolyl cis-trans isomerase D OS=Debaryomy... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A443SUJ21.023e-7145.94Peptidyl-prolyl cis-trans isomerase cyp11-like iso... [more]
A0A3Q0KHB71.694e-7049.54Putative cyclophilin-like protein OS=Schistosoma m... [more]
A0A4Z2CRR04.745e-6849.11Peptidyl-prolyl cis-trans isomerase D OS=Schistoso... [more]
A0A026WBG04.128e-6749.07NK-tumor recognition protein OS=Ooceraea biroi OX=... [more]
G4VIP03.441e-6647.99Putative cyclophilin-like protein OS=Schistosoma m... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppig5.082e-6059.54peptidylprolyl isomerase G (cyclophilin G) [Source... [more]
ppid3.285e-5158.33peptidylprolyl isomerase D [Source:ZFIN;Acc:ZDB-GE... [more]
nktr3.522e-4855.81natural killer cell triggering receptor [Source:ZF... [more]
ppifb1.559e-3850.29peptidyl-prolyl cis-trans isomerase A-like [Source... [more]
ppic1.991e-3848.07peptidylprolyl isomerase C [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppig8.153e-5960.34peptidylprolyl isomerase G (cyclophilin G) [Source... [more]
ENSPMAT00000010135.16.651e-4050.30pep scaffold:Pmarinus_7.0:GL476417:32947:40880:1 g... [more]
ENSPMAT00000004873.12.928e-3861.90pep scaffold:Pmarinus_7.0:GL486356:449:3367:-1 gen... [more]
ppifb1.867e-3751.48peptidylprolyl isomerase Fb [Source:ZFIN;Acc:ZDB-G... [more]
ENSPMAT00000004654.11.401e-3145.73pep scaffold:Pmarinus_7.0:GL489343:42315:43690:-1 ... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CPR62.664e-5661.85Peptidyl-prolyl cis-trans isomerase (cyclophilin);... [more]
CPR12.464e-4555.83Cytoplasmic peptidyl-prolyl cis-trans isomerase (c... [more]
CPR35.718e-4451.11Mitochondrial peptidyl-prolyl cis-trans isomerase ... [more]
CPR21.491e-4049.71Peptidyl-prolyl cis-trans isomerase (cyclophilin);... [more]
CPR51.163e-3950.29Peptidyl-prolyl cis-trans isomerase (cyclophilin) ... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO489151.072e-6765.90Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
EDO417471.847e-5358.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315392.632e-4253.89Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
EDO424121.413e-4053.85Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
EDO346138.026e-4050.58Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPIG1.845e-5957.30peptidylprolyl isomerase G [Source:NCBI gene;Acc:1... [more]
nktr2.192e-5658.76natural killer cell triggering receptor [Source:NC... [more]
ppid1.348e-5057.74peptidylprolyl isomerase D [Source:NCBI gene;Acc:1... [more]
ppid1.533e-5057.74peptidylprolyl isomerase D [Source:NCBI gene;Acc:1... [more]
ppid4.183e-5057.74peptidylprolyl isomerase D [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070665.10.000e+0100.00SMESG000070665.1[more]
SMESG000070665.10.000e+099.25SMESG000070665.1[more]
SMESG000070665.10.000e+095.26SMESG000070665.1[more]
SMESG000070665.10.000e+095.02SMESG000070665.1[more]
SMESG000025182.14.419e-4452.00SMESG000025182.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004117 ID=SMED30004117|Name=Peptidyl-prolyl cis-trans isomerase|organism=Schmidtea mediterranea sexual|type=transcript|length=2810bp
CGTTTTATATAAAATTGAATGATAATAAACATGAAATCGAAGCTTAGACC
TAGGTGTTTTTTTGATATTGATATTGGACATTCTCCGGCTGGAAGAATTA
TATTTGAACTTTATGATGATATTTGCCCTAAAACTGCCGAAAACTTTATT
AAACTCTGTACAGGTGATTGTGGAATGAGTGAATCTTCTGGAAAAAAATT
ACATTATCTTCAATCTATCTTCCATCGAGTTATTAAAGGTTTTATGATAC
AAGGTGGTGATTTTGTAAATGGCGATGGAACAGGTGGAGAATCGATTTAT
GGCGGAAGATTCAATGATGAGAATCTAGAATTATCACACGATAAACCTTT
TTTGTTAAGTATGGCCAATTGTGGACCAAACACAAATGGGTCGCAATTTT
TTATAACAACAAAGCCAGCCATTCATTTAGATGGTAAACACGTTGTTTTC
GGGCATGTAGTTTCAGGGGAAAATTTAATTGAATCTATTGAAAATTTACC
TGTTAATGCAAATAATAAGCCTGTTGTAGAAGCCACTATATCAAATTGCG
GAGTGTTAATTCCTGTTCGTAAAAAGAAAATCAAGAAACAGAAAGTGAAA
GAAGCTAGCGCTGATTCATCGTCCAGTAAAGGAAAGAAGAAGAAGAAATC
TAAAAAGAAAAAACATCGAAATAAACGAAAAACGAAAACGGTTAAAGATG
AAACAGAAACTCTTTATCCGAAATGCAGTGTCAGGCCTGACGAAATCCCT
GAAGTACCGAAGCCGTTTTTCTTATATCGTGGAAATTTAAAAAATGAAAA
ATCTGAAAATAATGAAAATAAAGAAATAATAAATTCATCTCAATATGTTT
CTAAAGACATTATAGGCCGATCCGGAAGACTTATTAAAGGTCGAGGTCAA
TTGAGATATTATTCAAAATCCCCCCGTGATCGTCATGATACACCTCCTCA
TTGGAAAAAAGAAACATATAAAGTATCAGACAATATAGATAATCAGGGGA
GTATTAAAAGAAAAAGTCCATCAAGCAGTCCTAATAAAGAAATTCAAACA
AGCCGACAACGAAAAGACAATCAAAGTCCTAGACAGAGTTTCAGAAATAA
TGACAGTAACAATATTAGAAATACGGAAAAGCAAGATTCGGTTGGTCGCG
AAAAACGTAAAAGATATGATATCTGGAAAGATGCACCTGATAAAAGTGAT
GGTAAAATAAAAAGATCTCGGCGACGCGAAGAATTGGAGGACTATGGAGA
TATTGATAAACTTGATAAAGAAAATCTTAGCCAAAAAAATTACAACCGAA
AACGTTCCAATAGTTTGGATAGAATTAAGCCACTGGACCGCGAAAAAACT
AACGCTAAATCTATCAAGTCGAAAAACAATTTACCAGACGCACAGCAAGA
TAAAGTTGACAAACATGAATCTAAATCTATAATTTATCCATATAACGATG
AATCTGATGAGTCTTTGAAACAGAAAAGATTAGAAAACCCAGTCGACAAC
AAAGTCATTGATTATAAATCTAGAAATCCTCATAGAGATTTAAGCGATAA
AAATGAAGAGATTAAAAAGAAATCCAATAAAAATAATTACCATGACGATT
CTAAAATCGATAGAAAAAGATCGTCATCGTTTGATGATTACAGGCAAAAG
TCCAAATCTCCAATAGAAACCAAACGCACTACTCATAGTCCTCCGGCCCA
TTTAGTAGCAAAGTGGCAAAATCGAAGAGAAAAAATAATGATTCGTCGAT
CGTCTTTGTCTAAGTCTAACGAAAGACAACCGTCTCGTTCTAGATATTCA
CCGAGAAAACGTTCATCTAGGTATTCAAAATCTCCCAATAGCGAAAGAAA
TAAAAATGAAAGTAAGCACTATGGTGAGCGGAACGTTTCCGATAATGTTT
GTAAGATCTCGATTGGTAAATCTAAAGATAGAAGCAGTTCAGGAACTATG
GATTCGTCTTTATCAAGTGCCGGTTCATCTGTATCTAATAGACCATGTAG
GATTGATTCTGAATTGTCTGATGCGGAAAAAACTGTTAATACCCAGTGTT
GGATAAACCATTCTGCAGCAAATCCGGTCGTTGAGGGAAACAAAGAAAAG
AAATCCGATATTCCTCCTATGACACTAGATAAACCTAAAGATGAAATAAA
AACAAATGAAAATTCAATAGAAAAAGAAGCTATTATGGTTATAAAGCCTC
CGGAAAAAACCTGGCTGACAAATCAATGGAAAACCGAAGAAGAAGAAGCA
AACAAAAAGATAGCAAAAATTGCAAACAACTCAATATTGGCGAAATTAAG
AGAAGATGATCAAAAGAAGAAATCTAAAGAAAAAACAGATAAGCCATTTG
ATACTAATCACGGGGAAAGTCACCAAGGCGTTAAAAAACTTCAAAGTCCT
ATTTCTCAAAGTATATCGAAGTATAGAAGTGCTAGTGGAACAAAATCGTC
TGACAATGAATCGTCTGGCTCCTCTAGTTCATCATCAAGGTCTTATAGTA
GAAAACGGTCTATTAGTCGTTCAAAAAGCCGATCGAGGTCTTTTTATCGT
CGTAGATATCGCAGTCCACGTTATTTACGCAGATCCAGGCGTTCTACAAG
TAGGTCTGGTAGGAGATACCGTTCAAGGTCATACTCTAGAAATTCAAGGC
GGGTTGGCGGCTCCAGATCCAGTTCAACATCACGCAGTTCTCATTATCGT
TCATCACGGCGTAATTATCGTGGGTTAGGGTTCCGTCGTCCTTCTGGCTC
TCCTCGGCCAAGGAAATGATTTACAGAATGTTTTAATTGCAGTTAATAAA
ATTATTAAAT
back to top

protein sequence of SMED30004117-orf-1

>SMED30004117-orf-1 ID=SMED30004117-orf-1|Name=SMED30004117-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=917bp
MIINMKSKLRPRCFFDIDIGHSPAGRIIFELYDDICPKTAENFIKLCTGD
CGMSESSGKKLHYLQSIFHRVIKGFMIQGGDFVNGDGTGGESIYGGRFND
ENLELSHDKPFLLSMANCGPNTNGSQFFITTKPAIHLDGKHVVFGHVVSG
ENLIESIENLPVNANNKPVVEATISNCGVLIPVRKKKIKKQKVKEASADS
SSSKGKKKKKSKKKKHRNKRKTKTVKDETETLYPKCSVRPDEIPEVPKPF
FLYRGNLKNEKSENNENKEIINSSQYVSKDIIGRSGRLIKGRGQLRYYSK
SPRDRHDTPPHWKKETYKVSDNIDNQGSIKRKSPSSSPNKEIQTSRQRKD
NQSPRQSFRNNDSNNIRNTEKQDSVGREKRKRYDIWKDAPDKSDGKIKRS
RRREELEDYGDIDKLDKENLSQKNYNRKRSNSLDRIKPLDREKTNAKSIK
SKNNLPDAQQDKVDKHESKSIIYPYNDESDESLKQKRLENPVDNKVIDYK
SRNPHRDLSDKNEEIKKKSNKNNYHDDSKIDRKRSSSFDDYRQKSKSPIE
TKRTTHSPPAHLVAKWQNRREKIMIRRSSLSKSNERQPSRSRYSPRKRSS
RYSKSPNSERNKNESKHYGERNVSDNVCKISIGKSKDRSSSGTMDSSLSS
AGSSVSNRPCRIDSELSDAEKTVNTQCWINHSAANPVVEGNKEKKSDIPP
MTLDKPKDEIKTNENSIEKEAIMVIKPPEKTWLTNQWKTEEEEANKKIAK
IANNSILAKLREDDQKKKSKEKTDKPFDTNHGESHQGVKKLQSPISQSIS
KYRSASGTKSSDNESSGSSSSSSRSYSRKRSISRSKSRSRSFYRRRYRSP
RYLRRSRRSTSRSGRRYRSRSYSRNSRRVGGSRSSSTSRSSHYRSSRRNY
RGLGFRRPSGSPRPRK*
back to top

protein sequence of SMED30004117-orf-2

>SMED30004117-orf-2 ID=SMED30004117-orf-2|Name=SMED30004117-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=141bp
MIKRRNLKKKQISHLILITGKVTKALKNFKVLFLKVYRSIEVLVEQNRLT
MNRLAPLVHHQGLIVENGLLVVQKADRGLFIVVDIAVHVIYADPGVLQVG
LVGDTVQGHTLEIQGGLAAPDPVQHHAVLIIVHHGVIIVG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR002130Cyclophilin-type_PPIase_dom
IPR029000Cyclophilin-like_dom_sf
IPR020892Cyclophilin-type_PPIase_CS
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
GO:0000413protein peptidyl-prolyl isomerization
Vocabulary: molecular function
TermDefinition
GO:0003755peptidyl-prolyl cis-trans isomerase activity
GO:0016853isomerase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 915..915
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 756..784
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 632..658
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 370..447
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 873..892
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 687..714
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 456..550
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 828..872
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 320..341
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 564..578
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 355..369
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 204..221
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 601..622
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 750..915
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 292..658
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 785..827
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 189..228
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 296..319
NoneNo IPR availablePANTHERPTHR11071:SF328MOCA-CYP, ISOFORM Acoord: 3..448
NoneNo IPR availablePANTHERPTHR11071PEPTIDYL-PROLYL CIS-TRANS ISOMERASEcoord: 3..448
IPR002130Cyclophilin-type peptidyl-prolyl cis-trans isomerase domainPRINTSPR00153CSAPPISMRASEcoord: 67..79
score: 79.25
coord: 110..125
score: 75.0
coord: 125..137
score: 58.08
coord: 138..153
score: 55.77
coord: 30..45
score: 56.59
IPR002130Cyclophilin-type peptidyl-prolyl cis-trans isomerase domainPFAMPF00160Pro_isomerasecoord: 15..178
e-value: 2.2E-45
score: 154.8
IPR002130Cyclophilin-type peptidyl-prolyl cis-trans isomerase domainPROSITEPS50072CSA_PPIASE_2coord: 13..178
score: 42.612
IPR029000Cyclophilin-like domain superfamilyGENE3DG3DSA:2.40.100.10coord: 2..180
e-value: 3.0E-79
score: 266.9
IPR029000Cyclophilin-like domain superfamilySUPERFAMILYSSF50891Cyclophilin-likecoord: 6..179
IPR020892Cyclophilin-type peptidyl-prolyl cis-trans isomerase, conserved sitePROSITEPS00170CSA_PPIASE_1coord: 62..79