Exosome complex component Rrp41

Overview
NameExosome complex component Rrp41
Smed IDSMED30004115
Length (bp)813
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Exosome complex component Rrp41 (SMED30004115) t-SNE clustered cells

Violin plots show distribution of expression levels for Exosome complex component Rrp41 (SMED30004115) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Exosome complex component Rrp41 (SMED30004115) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Exosome complex component Rrp41 (SMED30004115) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004115

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30004115h1SMcG0011394 dd_Smed_v4_4086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004115h1SMcG0011394 dd_Smed_v4_4086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30004115h1SMcG0011394 dd_Smed_v4_4086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Exosome complex component Rrp41 vs. Ensembl Human
Match: EXOSC4 (exosome component 4 [Source:HGNC Symbol;Acc:HGNC:18189])

HSP 1 Score: 141.354 bits (355), Expect = 2.351e-40
Identity = 88/238 (36.97%), Postives = 128/238 (53.78%), Query Frame = 2
Query:   41 ENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECR-NHSEAKHDVAIISCKYSKCPTANFNAGRR----HGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPNNIDHISQVNTLYVAAESVCETVYKELNKQIKLYV 739
            + +R DGRR   +R I +R+GV A +  DG   +EQGNTK +A +YGPHE R + + A  D A+++C+YS   +A F+ G R    HG R +        ++   E  I    +  SQIDI + VLQ+DG   A  +NA +LA++DAGI M+DFV A + G  D T LADL+  EE     P L + LLP S            + DH+ +V     AA      V+  L++ ++ +V
Sbjct:   10 QGYRVDGRRAGELRKIQARMGVFAQA--DGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYS---SATFSTGERKRRPHGDRKSCE--MGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGG-PQLALALLPASGQIALLEMDARLHEDHLERV---LEAAAQAARDVHTLLDRVVRQHV 236          
BLAST of Exosome complex component Rrp41 vs. Ensembl Human
Match: EXOSC4 (exosome component 4 [Source:HGNC Symbol;Acc:HGNC:18189])

HSP 1 Score: 90.1225 bits (222), Expect = 9.318e-21
Identity = 62/185 (33.51%), Postives = 93/185 (50.27%), Query Frame = 2
Query:  197 NHSEAKHDVAIISCKYSKCPTANFNAGRR----HGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPNNIDHISQVNTLYVAAESVCETVYKELNKQIKLYV 739
            + + A  D A+++C+YS   +A F+ G R    HG R +        ++   E  I    +  SQIDI + VLQ+DG   A  +NA +LA++DAGI M+DFV A + G  D T LADL+  EE     P L + LLP S            + DH+ +V     AA      V+  L++ ++ +V
Sbjct:   84 SRARALPDRALVNCQYS---SATFSTGERKRRPHGDRKSCE--MGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGG-PQLALALLPASGQIALLEMDARLHEDHLERV---LEAAAQAARDVHTLLDRVVRQHV 259          
BLAST of Exosome complex component Rrp41 vs. Ensembl Human
Match: EXOSC4 (exosome component 4 [Source:HGNC Symbol;Acc:HGNC:18189])

HSP 1 Score: 67.781 bits (164), Expect = 1.910e-13
Identity = 35/80 (43.75%), Postives = 52/80 (65.00%), Query Frame = 2
Query:   41 ENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECR-NHSEAKHDVAIISCKYSKCPTANFNAG 277
            + +R DGRR   +R I +R+GV A +  DG   +EQGNTK +A +YGPHE R + + A  D A+++C+YS   +A F+ G
Sbjct:   10 QGYRVDGRRAGELRKIQARMGVFAQA--DGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYS---SATFSTG 84          
BLAST of Exosome complex component Rrp41 vs. Ensembl Human
Match: EXOSC6 (exosome component 6 [Source:HGNC Symbol;Acc:HGNC:19055])

HSP 1 Score: 52.7582 bits (125), Expect = 1.888e-7
Identity = 50/193 (25.91%), Postives = 84/193 (43.52%), Query Frame = 2
Query:   62 RRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAI-----------ISCKYSKCPTANFNAGRRHGKRDNISDLN-ADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFD---QTILADLNGFEENQSSLPSLTMVLLP 595
            R P  +R + +R G+ + +    Y  LE G TKV+ ++ GP +                        + C + + P   F   RR        +   A  ++  +E  + L  Y  +Q++++ L+L+  GS LA  + A +LAL DAG+ M D V    + L      T L D    EE +++   LT+ L+P
Sbjct:   31 RDPTRLRPVYARAGLLSQAKGSAY--LEAGGTKVLCAVSGPRQAEGGERGGGPAGAGGEAPAALRGRLLCDFRRAP---FAGRRRRAPPGGCEERELALALQEALEPAVRLGRYPRAQLEVSALLLEDGGSALAAALTAAALALADAGVEMYDLVVGCGLSLAPGPAPTWLLDPTRLEEERAAA-GLTVALMP 217          
BLAST of Exosome complex component Rrp41 vs. Ensembl Celegans
Match: exos-4.1 (Putative exosome complex component RRP41 [Source:UniProtKB/Swiss-Prot;Acc:Q17533])

HSP 1 Score: 124.405 bits (311), Expect = 2.581e-34
Identity = 87/236 (36.86%), Postives = 125/236 (52.97%), Query Frame = 2
Query:   17 NLMSEILYENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANF---NAGRRHGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPNNIDHISQVNTLYVAAESVCETVYKEL 715
            N++SE     FR DGRRP  IR+I +R+G++ N+  +G   LE GNTKV+ ++YGP+E ++    +   AI+ C+YS    +     N  R   K   IS L    ++   E VI    +  SQ+DI   V+Q DGS LA  +NA SLAL DAGI MK   +A T G+ D   + DL   EE    LP +T+  +      E       N + HI  ++T+  AA++ C  VY+ L
Sbjct:    2 NIISE---HGFRIDGRRPAQIRNINTRLGLNRNA--EGSCYLEHGNTKVLCAVYGPYEGKSSKRIEDKCAIV-CQYSATKFSGLERKNRTRGDRKSTEISRL----LEKAFESVILTEAFPRSQLDIFCEVIQGDGSNLAACVNATSLALADAGIPMKGIASAATCGVVDGKPIVDLTSREETD-LLPRVTLATICG--RDEVILVELQNRL-HIDHLSTVMDAAKATCADVYECL 223          
BLAST of Exosome complex component Rrp41 vs. Ensembl Fly
Match: Ski6 (gene:FBgn0032487 transcript:FBtr0334755)

HSP 1 Score: 125.946 bits (315), Expect = 9.761e-35
Identity = 89/248 (35.89%), Postives = 133/248 (53.63%), Query Frame = 2
Query:   17 NLMSEILYENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECR-NHSEAKHDVAIISCKYSKCPTANFN-AGRRHGKRDNISDLNADC-VKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTI-LADLNGFEENQSSLPSLTMVLLPNSPS------SERFTRMFPNNIDHISQVNTLYVAAESVCETVYKELNKQIK 730
            +L+SE   +  R DGRRP+ +R I  ++GV      DG   +EQGNTKV+A++YGPH+ + N +E+     +I+C+YS+   A F+ A R++  R +   L     ++  +   I+   Y  SQIDI + VLQ DG+  AV +NA +LAL+DAGI + +F+ A T  L    I L D++ FEE  S  P LT+  LP +        SERF         HI  + T+   A + C  +   L   +K
Sbjct:    6 DLLSE---QGLRLDGRRPHELRRIKCKLGVFEQP--DGSAYMEQGNTKVLAAVYGPHQAKGNQTES-----VINCQYSQ---ATFSTAERKNRPRGDRKSLEFKLYLQQALSAAIKSELYPRSQIDIYVEVLQDDGANYAVALNAATLALIDAGICLNEFIVACTASLSKSNIPLTDISQFEE-VSGGPKLTVAALPTAEKIAFLEMSERF---------HIDHLETVIETAMAGCREIRDILEAAVK 230          
BLAST of Exosome complex component Rrp41 vs. Ensembl Fly
Match: Ski6 (gene:FBgn0032487 transcript:FBtr0080483)

HSP 1 Score: 125.946 bits (315), Expect = 9.761e-35
Identity = 89/248 (35.89%), Postives = 133/248 (53.63%), Query Frame = 2
Query:   17 NLMSEILYENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECR-NHSEAKHDVAIISCKYSKCPTANFN-AGRRHGKRDNISDLNADC-VKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTI-LADLNGFEENQSSLPSLTMVLLPNSPS------SERFTRMFPNNIDHISQVNTLYVAAESVCETVYKELNKQIK 730
            +L+SE   +  R DGRRP+ +R I  ++GV      DG   +EQGNTKV+A++YGPH+ + N +E+     +I+C+YS+   A F+ A R++  R +   L     ++  +   I+   Y  SQIDI + VLQ DG+  AV +NA +LAL+DAGI + +F+ A T  L    I L D++ FEE  S  P LT+  LP +        SERF         HI  + T+   A + C  +   L   +K
Sbjct:    6 DLLSE---QGLRLDGRRPHELRRIKCKLGVFEQP--DGSAYMEQGNTKVLAAVYGPHQAKGNQTES-----VINCQYSQ---ATFSTAERKNRPRGDRKSLEFKLYLQQALSAAIKSELYPRSQIDIYVEVLQDDGANYAVALNAATLALIDAGICLNEFIVACTASLSKSNIPLTDISQFEE-VSGGPKLTVAALPTAEKIAFLEMSERF---------HIDHLETVIETAMAGCREIRDILEAAVK 230          
BLAST of Exosome complex component Rrp41 vs. Ensembl Fly
Match: Mtr3 (gene:FBgn0036916 transcript:FBtr0074918)

HSP 1 Score: 65.4698 bits (158), Expect = 5.026e-12
Identity = 47/165 (28.48%), Postives = 79/165 (47.88%), Query Frame = 2
Query:   26 SEILYENFRNDGRRPNNI--RSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRRHGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLF 514
            SE  +E+     R P  +  R+   R GV        Y  +E GNTKV+A +  P E    S  + ++ +++C  +    A F+ G      +    L++   K+ ME V+    +   Q+DI +L+L  DG  L+  IN   +AL++ GI   D +TA+T  ++
Sbjct:   28 SEDFFESLDKPSREPTQLAPRNTFIRAGVLTTVRGSAY--MEYGNTKVLAIVAPPKELIRASARRMNMGVLNCYVN---FAAFSTGDLDSVPERERHLSSMLTKA-MEPVVCRTEFLNFQLDIRVLILDDDGCLLSTAINCCGVALVECGISTYDLITASTACIY 186          
BLAST of Exosome complex component Rrp41 vs. Ensembl Zebrafish
Match: exosc4 (exosome component 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1702])

HSP 1 Score: 139.043 bits (349), Expect = 1.005e-39
Identity = 86/235 (36.60%), Postives = 133/235 (56.60%), Query Frame = 2
Query:   41 ENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECR-NHSEAKHDVAIISCKYSKCPTANFNAGRR-HGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPNNIDHISQVNTLYVAAESVCETVYKELNKQIKLYV 739
            + +R DGR+   +R + +R+ V A +  DG   LEQGNTK +A +YGPHE R + S++ HD AII+C+YS    +     RR HG R + S+++   +K   E  +    Y  SQIDI + +LQ+DG   +  +NA +LAL+DAGI M+D+V A + G  + T LADL   EE+     +L + LLP S +          + DH+   +TL  AA + C+   K L+  ++ ++
Sbjct:   10 QGYRLDGRKATELRKVQARMSVFAQA--DGSAYLEQGNTKALAVVYGPHEIRGSRSKSLHDRAIINCQYSMATFSTAERKRRPHGDRKS-SEMSLH-LKQTFEAAVLTELYPRSQIDIYVKILQADGGNYSACVNAATLALVDAGIPMRDYVCACSAGFVEDTPLADLCHAEESGGG-TALALALLPRSGNIALLQMDARLHQDHL---DTLMEAAMTACKEFSKVLDSVVRQHL 236          
BLAST of Exosome complex component Rrp41 vs. Ensembl Zebrafish
Match: exosc6 (exosome component 6 [Source:NCBI gene;Acc:326786])

HSP 1 Score: 92.4337 bits (228), Expect = 9.872e-22
Identity = 61/187 (32.62%), Postives = 92/187 (49.20%), Query Frame = 2
Query:   71 NNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRR-HGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLN----------GFEENQSSLPSLTMVLLPN 598
             ++R + +R G+ + +    Y+  E GNTK+I S+YGP E     E       + C +   P +    G    G  +   DL+A  ++S+   V  LH Y  SQID+N++VL++DGS LA  +   S+AL DAGI M D V   T+       L D +          G+ +NQ     +T+ LLPN
Sbjct:   40 GDVRPVFARCGLVSQAKGSAYI--EAGNTKIICSVYGPKETERRDETDMKTGRLVCDFRLAPFSCVKRGAWIQGSEER--DLSATLMESLRPGVC-LHRYPRSQIDVNVMVLENDGSVLAHAVTCASMALADAGIEMYDIVLGCTLRQSGNACLVDPSYAEECGSWQEGYGDNQG---CVTLALLPN 218          
BLAST of Exosome complex component Rrp41 vs. Ensembl Zebrafish
Match: exosc6 (exosome component 6 [Source:NCBI gene;Acc:326786])

HSP 1 Score: 92.4337 bits (228), Expect = 9.872e-22
Identity = 61/187 (32.62%), Postives = 92/187 (49.20%), Query Frame = 2
Query:   71 NNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRR-HGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLN----------GFEENQSSLPSLTMVLLPN 598
             ++R + +R G+ + +    Y+  E GNTK+I S+YGP E     E       + C +   P +    G    G  +   DL+A  ++S+   V  LH Y  SQID+N++VL++DGS LA  +   S+AL DAGI M D V   T+       L D +          G+ +NQ     +T+ LLPN
Sbjct:   40 GDVRPVFARCGLVSQAKGSAYI--EAGNTKIICSVYGPKETERRDETDMKTGRLVCDFRLAPFSCVKRGAWIQGSEER--DLSATLMESLRPGVC-LHRYPRSQIDVNVMVLENDGSVLAHAVTCASMALADAGIEMYDIVLGCTLRQSGNACLVDPSYAEECGSWQEGYGDNQG---CVTLALLPN 218          
BLAST of Exosome complex component Rrp41 vs. Ensembl Zebrafish
Match: exosc5 (exosome component 5 [Source:ZFIN;Acc:ZDB-GENE-060503-675])

HSP 1 Score: 57.7658 bits (138), Expect = 1.580e-9
Identity = 40/150 (26.67%), Postives = 66/150 (44.00%), Query Frame = 2
Query:  116 SGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRRHGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQ-TILADLNGFEENQS 562
            S  DG     QG+T ++A +YGP E +   E  +D A +       P     + R   +          CV+   E  + L  +  S + + + V+  DGS L+  +NA  +ALMDAG+ M     + T  +  +  I+ D    +E +S
Sbjct:   25 SRPDGSSTFVQGDTSILAGVYGPAEVKVSKEI-YDRATVEVLIQ--PKMGLPSVRERAREQ--------CVRETCEAALLLTLHPRSSLTVILQVVHDDGSLLSCCLNAACMALMDAGLPMSRLFCSVTCAISKEGQIITDPTARQEKES 163          
BLAST of Exosome complex component Rrp41 vs. Ensembl Zebrafish
Match: exosc5 (exosome component 5 [Source:ZFIN;Acc:ZDB-GENE-060503-675])

HSP 1 Score: 57.7658 bits (138), Expect = 1.580e-9
Identity = 40/150 (26.67%), Postives = 66/150 (44.00%), Query Frame = 2
Query:  116 SGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRRHGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQ-TILADLNGFEENQS 562
            S  DG     QG+T ++A +YGP E +   E  +D A +       P     + R   +          CV+   E  + L  +  S + + + V+  DGS L+  +NA  +ALMDAG+ M     + T  +  +  I+ D    +E +S
Sbjct:   25 SRPDGSSTFVQGDTSILAGVYGPAEVKVSKEI-YDRATVEVLIQ--PKMGLPSVRERAREQ--------CVRETCEAALLLTLHPRSSLTVILQVVHDDGSLLSCCLNAACMALMDAGLPMSRLFCSVTCAISKEGQIITDPTARQEKES 163          
BLAST of Exosome complex component Rrp41 vs. Ensembl Xenopus
Match: rab27a (RAB27A, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-490563])

HSP 1 Score: 96.2857 bits (238), Expect = 2.441e-23
Identity = 61/182 (33.52%), Postives = 98/182 (53.85%), Query Frame = 2
Query:  197 NHSEAKHDVAIISCKYSKCPTANFNAGRR----HGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPNNIDHISQVNTLYVAAESVCETVYKELNKQIK 730
            + S+  HD ++++C+YS    A F+ G R    HG R + S++    +K   E  I    Y  SQIDI + +LQ+DG      +NA +LA++DAGI M+D+V A++ G  + T LADL+  EE     P L + LLP    S++   +  N+  H   +  +  AA   C+ VY  L++ ++
Sbjct:   52 SRSKMLHDRSVVNCQYS---MATFSTGERKRRPHGDRKS-SEMTLH-LKQTFEAAILTQLYPRSQIDIYVQILQADGGNYCTCVNAATLAVIDAGIPMRDYVCASSAGFIEDTPLADLSYVEEAAGG-PQLALALLPK---SDQIALLEMNSRLHEDHLERVMDAASKACKDVYAVLDQVVR 224          
BLAST of Exosome complex component Rrp41 vs. Ensembl Xenopus
Match: ttyh1 (tweety family member 1 [Source:Xenbase;Acc:XB-GENE-940450])

HSP 1 Score: 63.929 bits (154), Expect = 2.054e-11
Identity = 54/204 (26.47%), Postives = 88/204 (43.14%), Query Frame = 2
Query:   26 SEILY----ENFRNDGRR---PNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCP---TANFNAGRRHGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLF---DQTILADLNGFEENQSSLPSLTMVLLPN 598
            S +LY    E  +  GRR   P+  R +  R G+ + +    Y+    G TKV+ +++GP E     E       + C     P      ++     G     + L    ++  +E  + L  Y  +++ + +LVL+  GS L   ++  SLAL DAGI M D   A   GL       +L D +  EE   S  ++++ LLP 
Sbjct:   16 SPLLYVLSEEGGKAAGRRGRGPSEPRPVFVRAGLLSQAKGSAYLEAGSGGTKVLCAVHGPRERGMGGERAETRGRLLCDLRWAPFSRRGPWSGSCPAGPSPRQAGLQ---LQESLEPAVRLDRYPRAEVIVWVLVLEDRGSALPAAVSCASLALADAGIEMFDL--ALGCGLSRGPGGELLLDPDDDEEEAGSGGTMSLSLLPT 214          
BLAST of Exosome complex component Rrp41 vs. Ensembl Xenopus
Match: EXOSC5 (exosome component 5 [Source:NCBI gene;Acc:100170617])

HSP 1 Score: 51.9878 bits (123), Expect = 1.836e-7
Identity = 53/201 (26.37%), Postives = 86/201 (42.79%), Query Frame = 2
Query:  116 SGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRRHGKRDNISDLNAD-CVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGL-FDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPN-NIDHISQVNTLYVAAESVCETVYK 709
            S  DG     QG+T V+A +YGP E +   E  H+ A +       P     A         I + N +  ++   E VI    +  + I I + ++   GS L+  +NA  + LMDAG+ M+      T  +  D TI  D N F + + S   LT  +     S+ER   M  N  +   +++     AA+   E +++
Sbjct:   19 SRPDGSATFLQGDTSVMAGVYGPAEIKVSREI-HNKATLEVILR--PKTGLPA---------IQEKNQEQLIRETCESVIIGSLHPRTSITIVLQIVSDAGSLLSCCLNAACMGLMDAGLPMRALFCGVTCAMDNDGTITLDPN-FRQQKESRAVLTFAI----ESTERKVLMMSNRGVYSATELQQCIAAAQIASEKLFQ 202          
BLAST of Exosome complex component Rrp41 vs. Ensembl Mouse
Match: Exosc4 (exosome component 4 [Source:MGI Symbol;Acc:MGI:1923576])

HSP 1 Score: 143.28 bits (360), Expect = 2.616e-41
Identity = 91/238 (38.24%), Postives = 127/238 (53.36%), Query Frame = 2
Query:   41 ENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECR-NHSEAKHDVAIISCKYSKCPTANFNAGRR----HGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPNNIDHISQVNTLYVAAESVCETVYKELNKQIKLYV 739
            + +R DGRR   +R I +R+GV A +  DG   +EQGNTK +A +YGPHE R + S A  D A+++C+YS   +A F+ G R    HG R +        ++   E  I    +  SQIDI + VLQ+DG   A  +NA +LA+MDAGI M+DFV A + G  D T LADL+  EE     P L + LLP S            + DH+ QV     AA      V+  L+  ++ +V
Sbjct:   10 QGYRIDGRRAGELRKIQARMGVFAQA--DGSAYIEQGNTKALAVVYGPHEIRGSRSRALPDRALVNCQYS---SATFSTGERKRRPHGDRKSCE--MGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVMDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGG-PQLALALLPASGQIALLEMDSRLHEDHLEQV---LEAAAQAARGVHTLLDLVVRQHV 236          
BLAST of Exosome complex component Rrp41 vs. Ensembl Mouse
Match: Exosc4 (exosome component 4 [Source:MGI Symbol;Acc:MGI:1923576])

HSP 1 Score: 56.6102 bits (135), Expect = 2.196e-10
Identity = 25/50 (50.00%), Postives = 34/50 (68.00%), Query Frame = 2
Query:   41 ENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHE 190
            + +R DGRR   +R I +R+GV A +  DG   +EQGNTK +A +YGPHE
Sbjct:   10 QGYRIDGRRAGELRKIQARMGVFAQA--DGSAYIEQGNTKALAVVYGPHE 57          
BLAST of Exosome complex component Rrp41 vs. Ensembl Mouse
Match: Exosc6 (exosome component 6 [Source:MGI Symbol;Acc:MGI:1919794])

HSP 1 Score: 50.0618 bits (118), Expect = 1.012e-6
Identity = 49/194 (25.26%), Postives = 83/194 (42.78%), Query Frame = 2
Query:   62 RRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAI-----------ISCKYSKCPTANFNAGRRHGKRDNISDLN--ADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLF---DQTILADLNGFEENQSSLPSLTMVLLP 595
            R P  +R + +R G+ + +    Y  LE G TKV+ ++ GP +                        + C + + P   F+  RR   +    +       ++  +E  + L  Y  +Q++++ L+L+  G  LA  + A +LAL DAG+ M D V    + L      T L D    EE  S+   LT+ L+P
Sbjct:   31 RDPTRLRPVYARAGLLSQAKGSAY--LEAGGTKVLCAVSGPRQAEGGERGSGPAGAGGEAPAALRGRLLCDFRRAP---FSGRRRRAPQGGGGEDRELGLALQEALEPAVRLGRYPRAQLEVSALLLEDGGCALAAALTAAALALADAGVEMYDLVVGCGLSLTPGPSPTWLLDPTRLEEEHSAA-GLTVALMP 218          
BLAST of Exosome complex component Rrp41 vs. UniProt/SwissProt
Match: sp|Q921I9|EXOS4_MOUSE (Exosome complex component RRP41 OS=Mus musculus OX=10090 GN=Exosc4 PE=1 SV=3)

HSP 1 Score: 143.28 bits (360), Expect = 1.830e-40
Identity = 91/238 (38.24%), Postives = 127/238 (53.36%), Query Frame = 2
Query:   41 ENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECR-NHSEAKHDVAIISCKYSKCPTANFNAGRR----HGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPNNIDHISQVNTLYVAAESVCETVYKELNKQIKLYV 739
            + +R DGRR   +R I +R+GV A +  DG   +EQGNTK +A +YGPHE R + S A  D A+++C+YS   +A F+ G R    HG R +        ++   E  I    +  SQIDI + VLQ+DG   A  +NA +LA+MDAGI M+DFV A + G  D T LADL+  EE     P L + LLP S            + DH+ QV     AA      V+  L+  ++ +V
Sbjct:   10 QGYRIDGRRAGELRKIQARMGVFAQA--DGSAYIEQGNTKALAVVYGPHEIRGSRSRALPDRALVNCQYS---SATFSTGERKRRPHGDRKSCE--MGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVMDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGG-PQLALALLPASGQIALLEMDSRLHEDHLEQV---LEAAAQAARGVHTLLDLVVRQHV 236          
BLAST of Exosome complex component Rrp41 vs. UniProt/SwissProt
Match: sp|Q7YRA3|EXOS4_BOVIN (Exosome complex component RRP41 OS=Bos taurus OX=9913 GN=EXOSC4 PE=2 SV=3)

HSP 1 Score: 142.51 bits (358), Expect = 3.554e-40
Identity = 89/238 (37.39%), Postives = 128/238 (53.78%), Query Frame = 2
Query:   41 ENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECR-NHSEAKHDVAIISCKYSKCPTANFNAGRR----HGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPNNIDHISQVNTLYVAAESVCETVYKELNKQIKLYV 739
            + +R DGRR   +R I +R+GV A +  DG   +EQGNTK +A +YGPHE R + + A  D A+++C+YS   +A F+ G R    HG R +        ++   E  I    +  SQIDI + VLQ+DG   A  +NA +LA++DAGI M+DFV A + G  D T LADL+  EE     P L + LLP S            + DH+ QV     AA      V+  L++ ++ +V
Sbjct:   10 QGYRVDGRRAGELRKIQARMGVFAQA--DGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYS---SATFSTGERKRRPHGDRKSCE--MGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGG-PQLALALLPASGQIALLEMDARLHEDHLEQV---LEAAARASRDVHTVLDRVVRQHV 236          
BLAST of Exosome complex component Rrp41 vs. UniProt/SwissProt
Match: sp|Q9NPD3|EXOS4_HUMAN (Exosome complex component RRP41 OS=Homo sapiens OX=9606 GN=EXOSC4 PE=1 SV=3)

HSP 1 Score: 141.354 bits (355), Expect = 1.129e-39
Identity = 88/238 (36.97%), Postives = 128/238 (53.78%), Query Frame = 2
Query:   41 ENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECR-NHSEAKHDVAIISCKYSKCPTANFNAGRR----HGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPNNIDHISQVNTLYVAAESVCETVYKELNKQIKLYV 739
            + +R DGRR   +R I +R+GV A +  DG   +EQGNTK +A +YGPHE R + + A  D A+++C+YS   +A F+ G R    HG R +        ++   E  I    +  SQIDI + VLQ+DG   A  +NA +LA++DAGI M+DFV A + G  D T LADL+  EE     P L + LLP S            + DH+ +V     AA      V+  L++ ++ +V
Sbjct:   10 QGYRVDGRRAGELRKIQARMGVFAQA--DGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYS---SATFSTGERKRRPHGDRKSCE--MGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGG-PQLALALLPASGQIALLEMDARLHEDHLERV---LEAAAQAARDVHTLLDRVVRQHV 236          
BLAST of Exosome complex component Rrp41 vs. UniProt/SwissProt
Match: sp|Q9SP08|RRP41_ARATH (Exosome complex component RRP41 homolog OS=Arabidopsis thaliana OX=3702 GN=RRP41 PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.581e-33
Identity = 76/188 (40.43%), Postives = 107/188 (56.91%), Query Frame = 2
Query:   41 ENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECRNHSE-AKHDVAIISCKYSKCPTANFNAG-RRHGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPN 598
            E  R DGRR N +R I + +GV + +  DG    E GNTKVIA++YGP E +N S+  K+D A++ C+YS    A F+ G RR  K D  S   +  ++  ME  I       SQIDI + VLQ+DG   +  INA +LAL DAGI M+D   + + G  + T L DLN + E+ +    +T+ +LP 
Sbjct:    7 EGLRLDGRRFNEMRQIVAEVGVVSKA--DGSAVFEMGNTKVIAAVYGPREIQNKSQQKKNDHAVVLCEYS---MAQFSTGDRRRQKFDRRSTELSLVIRQTMEACILTELMPHSQIDIFLQVLQADGGTRSACINAATLALADAGIPMRDLAVSCSAGYLNSTPLLDLN-YVEDSAGGADVTVGILPK 188          
BLAST of Exosome complex component Rrp41 vs. UniProt/SwissProt
Match: sp|Q17533|EXOS4_CAEEL (Putative exosome complex component RRP41 OS=Caenorhabditis elegans OX=6239 GN=exos-4.1 PE=3 SV=2)

HSP 1 Score: 124.405 bits (311), Expect = 3.283e-33
Identity = 87/236 (36.86%), Postives = 125/236 (52.97%), Query Frame = 2
Query:   17 NLMSEILYENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANF---NAGRRHGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPNNIDHISQVNTLYVAAESVCETVYKEL 715
            N++SE     FR DGRRP  IR+I +R+G++ N+  +G   LE GNTKV+ ++YGP+E ++    +   AI+ C+YS    +     N  R   K   IS L    ++   E VI    +  SQ+DI   V+Q DGS LA  +NA SLAL DAGI MK   +A T G+ D   + DL   EE    LP +T+  +      E       N + HI  ++T+  AA++ C  VY+ L
Sbjct:    2 NIISE---HGFRIDGRRPAQIRNINTRLGLNRNA--EGSCYLEHGNTKVLCAVYGPYEGKSSKRIEDKCAIV-CQYSATKFSGLERKNRTRGDRKSTEISRL----LEKAFESVILTEAFPRSQLDIFCEVIQGDGSNLAACVNATSLALADAGIPMKGIASAATCGVVDGKPIVDLTSREETD-LLPRVTLATICG--RDEVILVELQNRL-HIDHLSTVMDAAKATCADVYECL 223          
BLAST of Exosome complex component Rrp41 vs. TrEMBL
Match: A0A504YNB8 (Exosome component 4 OS=Fasciola gigantica OX=46835 GN=FGIG_06138 PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 1.047e-43
Identity = 92/191 (48.17%), Postives = 117/191 (61.26%), Query Frame = 2
Query:   23 MSEILYENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRRH-GKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLL 592
            M+E+ Y N R DGRR N +R++  +  +  NS  DG V L QGNTKV+AS+ GPH CR   + K D A+I CKYSK P ++ +  R+    RD  S   A  ++ I   V+ +  Y  SQIDI + VLQSDGSE A  +NA +LAL DAGI MK  V A TVG++   I ADL  FEEN   +P LTMV L
Sbjct:    1 MAELFYNNRRIDGRRANELRNVLCQFEI-GNS--DGIVLLHQGNTKVMASVVGPHPCRFRGDMKPDEALIVCKYSKPPFSSTSGERKKLSARDRSSSDFASAIEEIFTCVVRMDKYPMSQIDIFLEVLQSDGSEFACAVNAATLALTDAGIEMKHLVCAVTVGIWGSHIFADLCRFEEN-PRVPHLTMVSL 187          
BLAST of Exosome complex component Rrp41 vs. TrEMBL
Match: A0A4E0R3D5 (Exosome component 4 OS=Fasciola hepatica OX=6192 GN=D915_007218 PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 1.129e-43
Identity = 92/191 (48.17%), Postives = 117/191 (61.26%), Query Frame = 2
Query:   23 MSEILYENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRRH-GKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLL 592
            M+E+ Y N R DGRR N +R++  +  +  NS  DG V L QGNTKV+AS+ GPH CR   + K D A+I CKYSK P ++ +  R+    RD  S   A  ++ I   V+ +  Y  SQIDI + VLQSDGSE A  +NA +LAL DAGI MK  V A TVG++   I ADL  FEEN   +P LTMV L
Sbjct:    1 MAELFYNNRRIDGRRANELRNVLCQFEI-GNS--DGIVLLHQGNTKVMASVVGPHPCRFRGDMKPDEALIVCKYSKPPFSSTSGERKKLSARDRSSSDFASAIEEIFTCVVRMDKYPMSQIDIFLEVLQSDGSEFACAVNAATLALTDAGIEMKHLVCAVTVGIWGSHIFADLCRFEEN-PRVPHLTMVSL 187          
BLAST of Exosome complex component Rrp41 vs. TrEMBL
Match: A0A3B5KCX2 (Exosome component 4 OS=Takifugu rubripes OX=31033 GN=exosc4 PE=4 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 2.835e-42
Identity = 92/238 (38.66%), Postives = 140/238 (58.82%), Query Frame = 2
Query:   41 ENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECR-NHSEAKHDVAIISCKYSKCPTANFNAGRR-HGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPS---SERFTRMFPNNIDHISQVNTLYVAAESVCETVYKELNKQIKLYV 739
            + +R DGR+   +R I +R+GV A +  DG   LEQGNTKV+A +YGPHE R + S A+HD A+I+C+YS    +     RR HG R + ++++   +K   E  +    +  SQIDI + +LQSDG   +V +NA +LA++DAGI M+D+V A TVG  D+T LADL  + E    + SL + LLP S      +   R+  +N+D       L  AA + C+ V K L++ ++ ++
Sbjct:   10 QGYRIDGRKATELRKIQARMGVFAQA--DGSAYLEQGNTKVLAVVYGPHEMRGSRSRARHDRAVINCQYSMATFSTAERKRRPHGDRKS-TEMSLH-LKQTFEAAVMTQLFPRSQIDIYVKILQSDGGNYSVCVNAATLAVIDAGIPMRDYVCACTVGFVDETPLADLC-YAEEGGGVSSLGLALLPRSSQIALVQMDARLHQDNLD------ALMEAAMTACKGVSKVLDEVVRQHL 236          
BLAST of Exosome complex component Rrp41 vs. TrEMBL
Match: A0A1Z5LER8 (Uncharacterized protein (Fragment) OS=Ornithodoros moubata OX=6938 PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 9.300e-42
Identity = 94/245 (38.37%), Postives = 140/245 (57.14%), Query Frame = 2
Query:   17 NLMSEILYENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECR-NHSEAKHDVAIISCKYSKCPTANFNA--GRRHGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPNNIDHISQVNTLYVAAESVCETVYKELNKQIKLYVA 742
             L+SE   E +R DGR+P+  R I  R+GV   +  DG   LEQG+TKV+A++YGPHE R + ++A HD A+++C++S   TA F++   +R  + D  S      ++   E  I  H Y  SQIDI + VLQ+DG  L+  INA +LAL+DAGI +KD+V A  VGL D   L D++  EE     P LT+ LLP    +++   +   +  H   + ++  AAE  C  V+   +  +K +VA
Sbjct:    5 ELLSE---EGYRLDGRKPSEQRRIGCRLGVFLQA--DGSAYLEQGHTKVLAAVYGPHEVRGSRAKAMHDRALVNCQFS---TATFSSLERKRRPRGDRKSQEMTLHIQQTFEATILTHLYPRSQIDIFVEVLQADGGTLSACINAAALALIDAGIALKDYVCACAVGLVDGAPLVDISHLEETMGG-PVLTVALLPK---TQQIVLLEMTSKVHADYLESMLSAAEKGCTDVHAIFDSNVKEHVA 237          
BLAST of Exosome complex component Rrp41 vs. TrEMBL
Match: A0A3P9KKE3 (Uncharacterized protein OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 1.522e-41
Identity = 96/250 (38.40%), Postives = 140/250 (56.00%), Query Frame = 2
Query:   41 ENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECRN-HSEAKHDVAIISCKYSKCPTANFNAGRR-HGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPNNID---HISQVNTLYVAAESVCETVYKELNKQIKLYVASKLDKQHTIEG 775
            + +R DGR+   +R + +R+GV A +  DG   LEQGNTK +A +YGPHE R   S A HD AII+C+YS    +     RR HG R + ++++   +K   E  +    Y  SQIDI + +LQSDG   +V +NA +LA++DAGI M+D+V A TVG  D+T LADL  + E    + SL + LLP      R  ++    +D   H   ++TL  AA + C+ V K L++ +         +QH  EG
Sbjct:   10 QGYRLDGRKATELRKVQARMGVFAQA--DGSAYLEQGNTKALAVVYGPHEIRGARSRALHDRAIINCQYSMATFSTAERKRRPHGDRKS-TEMSLH-LKQTFEAAVLTQLYPRSQIDIYVKILQSDGGNYSVCVNAATLAVIDAGIPMRDYVCACTVGFVDETSLADLC-YAEESGGVSSLALALLP------RGGQIALVQMDARLHQDHLDTLIEAAMTACKGVSKVLDQVV---------RQHLQEG 239          
BLAST of Exosome complex component Rrp41 vs. Ensembl Cavefish
Match: exosc4 (exosome component 4 [Source:NCBI gene;Acc:103035194])

HSP 1 Score: 144.05 bits (362), Expect = 1.324e-41
Identity = 89/235 (37.87%), Postives = 132/235 (56.17%), Query Frame = 2
Query:   41 ENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECR-NHSEAKHDVAIISCKYSKCPTANFNAGRR-HGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPNNIDHISQVNTLYVAAESVCETVYKELNKQIKLYV 739
            + +R DGRR   +R + +R+GV A +  DG   LEQGNTK +A +YGPHE R + S   HD A+I+C+YS    +     RR HG R + S+++   +K   E  +    Y  SQIDI + +LQSDG   +  +NA +LAL+DAGI M+D+V A T G  + T LADL   EE+     +L + LLP S S          + DH+   + L  AA + C+ + K L+  ++ ++
Sbjct:   10 QGYRLDGRRAAELRKLQARMGVFAQA--DGSAYLEQGNTKALAVVYGPHEVRGSRSRTLHDRAVINCQYSMATFSTAERKRRPHGDRKS-SEMSLH-LKQTFEAAVLTQLYPRSQIDIYVKILQSDGGNYSACVNAATLALVDAGIPMRDYVCACTAGFVEDTPLADLCHAEESGGG-TTLALALLPRSESIALVQMDARLHQDHL---DPLMEAAMTACKGLSKVLDSVVRQHL 236          
BLAST of Exosome complex component Rrp41 vs. Ensembl Cavefish
Match: exosc6 (exosome component 6 [Source:NCBI gene;Acc:326786])

HSP 1 Score: 88.9669 bits (219), Expect = 1.317e-20
Identity = 69/229 (30.13%), Postives = 110/229 (48.03%), Query Frame = 2
Query:   59 GRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRRHG--KRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTV------GLFDQTILAD----LNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPNNIDHISQVNTLYVAAESVCETVYK 709
            GR    +R + +R G+ + +    Y  LE GNTK++ S+YGP E     EA      + C     P   F+ G+R    +     DL+    +S+   V  LH Y  +QI++N++VL++DGS LA  +   S+AL DAGI M D V  + +       L D  +  +    L G+EEN+     +T+ LLPN        ++   + D   + +TL  A  +  E+ +K
Sbjct:   36 GRGNGEVRPLFARCGLVSQAKGSSY--LEAGNTKILCSVYGPREPERRDEAGVRSGRLLCDLRLAP---FSCGKRGAWIQGSGERDLSLALSESLHPAVC-LHRYPRAQIEVNVMVLENDGSVLAHAVTCASMALADAGIEMYDVVLGSALRQDGGASLVDPDLAEERGNWLAGYEENRG---GVTLSLLPN------LNQVSGLHADGELRADTLSAAVRTCMESCHK 249          
BLAST of Exosome complex component Rrp41 vs. Ensembl Cavefish
Match: exosc5 (exosome component 5 [Source:NCBI gene;Acc:103039313])

HSP 1 Score: 58.151 bits (139), Expect = 8.239e-10
Identity = 42/150 (28.00%), Postives = 67/150 (44.67%), Query Frame = 2
Query:  116 SGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRRHGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGL-FDQTILADLNGFEENQS 562
            S  DG     QG+T V+A +YGP E + + E  +D A +       P    ++ R   +          CV+   E V+    +  S + + + V+  DGS L+  +NA  +ALMDAG+ M       T  +  D  I+ D    +E +S
Sbjct:   23 SKPDGSATFLQGDTSVLAGVYGPAEVKVNKEI-YDRATLEVVVQ--PKVGMSSVRERAREQ--------CVRETCEAVLLSTLHPRSSLTLILQVVHDDGSLLSCCLNAACMALMDAGLPMGRLFCGVTCAIDSDSQIITDPTAQQERES 161          
BLAST of Exosome complex component Rrp41 vs. Ensembl Sea Lamprey
Match: exosc4 (exosome component 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1702])

HSP 1 Score: 150.599 bits (379), Expect = 7.787e-45
Identity = 89/235 (37.87%), Postives = 132/235 (56.17%), Query Frame = 2
Query:   41 ENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECR-NHSEAKHDVAIISCKYSKCPTANFNAGRR----HGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPNNIDHISQVNTLYVAAESVCETVYKELNKQIK 730
            + +R DGR+ + +R I  R+GV A +  DG   +EQGNTK +A +YGPHE R N  +A HD A+++C+YS    A F+ G R    HG R +I    +  ++   E  I    Y  SQIDI + +LQSDG      +NA +LAL+DAGI +KD+V A +VG  D T L D++ F E  +  P L + LLP    SE+   +  N+  H   +  +  AA   C+ V+  L++ ++
Sbjct:   10 QGYRIDGRKASELRKIACRMGVFAQA--DGSAYVEQGNTKALAVVYGPHEMRGNRGKAMHDRALVNCQYS---MATFSTGERKRRPHGDRKSIE--MSMHLRQTFEAAIMTQQYPRSQIDIYVQILQSDGGNYCACVNAATLALVDAGIPLKDYVCACSVGFVDDTPLVDIS-FVEESAGGPELALALLPK---SEQIALLELNSRLHQDHLPAVLEAATRACKDVHAVLDRVVR 233          
BLAST of Exosome complex component Rrp41 vs. Ensembl Yeast
Match: SKI6 (Exosome non-catalytic core component; involved in 3'-5' RNA processing and degradation in both the nucleus and the cytoplasm; has similarity to E. coli RNase PH and to human hRrp41p (EXOSC4) [Source:SGD;Acc:S000003427])

HSP 1 Score: 111.309 bits (277), Expect = 4.950e-30
Identity = 76/239 (31.80%), Postives = 123/239 (51.46%), Query Frame = 2
Query:   41 ENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRR-HGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPNN---IDHISQVNTLYVA-AESVCETVYKELNKQIKLYVA 742
            E  R DGRR N +R   S I  H ++ D G   +EQGN K+I  + GP E R  S+     A+++   +    + F   +  H     + ++    V+ + EK + L+ Y  + IDI I VL+ DG  +  +IN ++LAL+DAGI M D+++  +VGL+D T L D N  EEN  S  +L +V       SE+ + +   +   +D +  V  + +A A  V + + +EL K  +  V+
Sbjct:   10 EGLRLDGRRWNELRRFESSINTHPHAAD-GSSYMEQGNNKIITLVKGPKEPRLKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQTSLVR-MFEKNVMLNIYPRTVIDIEIHVLEQDGGIMGSLINGITLALIDAGISMFDYISGISVGLYDTTPLLDTNSLEENAMSTVTLGVV-----GKSEKLSLLLVEDKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRVS 241          
BLAST of Exosome complex component Rrp41 vs. Ensembl Nematostella
Match: EDO42491 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1D9])

HSP 1 Score: 136.346 bits (342), Expect = 3.580e-39
Identity = 82/234 (35.04%), Postives = 131/234 (55.98%), Query Frame = 2
Query:   41 ENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRRHGKR--DNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERF---TRMFPNNIDHISQVNTLYVAAESVCETVYKELNKQI 727
            E  R DGR+ + +R +  ++GV + +  DG   +E GNTK +A++YGPHE +N ++A HD  +++ ++     A F+ G R  K   D  +   +  V+   E  I ++ Y  SQIDI + VLQ+DG      INAV+LAL++AGI +KD+V+A TV   + T L D+N  EE+    P LT+ +LP S     F   +R+  +N+D +  +      A   C+ +Y  L++ I
Sbjct:   10 EGLRIDGRKASELRKMVCKVGVLSQA--DGSAYIEMGNTKALATVYGPHEVQNKAKALHDRVLLNVQFG---MATFSTGERKKKPRGDRKATELSMMVRRTFEAAILINLYPRSQIDIYVQVLQADGGNHVACINAVTLALINAGIPLKDYVSACTVSFVNDTPLMDINYLEESTGG-PQLTLAILPKSDKIVLFQMDSRLHMDNMDKVLAL------AMKGCKDIYVLLHRTI 231          
BLAST of Exosome complex component Rrp41 vs. Ensembl Nematostella
Match: EDO46254 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ94])

HSP 1 Score: 93.2041 bits (230), Expect = 1.373e-22
Identity = 66/184 (35.87%), Postives = 95/184 (51.63%), Query Frame = 2
Query:   50 RNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRRHGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMV-LLPN 598
            R DGRRP+ +R +  R GV + +    Y+  E  NTKVI +IYGP E     E       ++C++   P +     RR   +D     N+  V   +E  + L  + ++Q+DI I VL++DGS L+  I   S+AL  AGI M D V+A T+   D  IL D    E + SS    TMV +LP+
Sbjct:   36 RQDGRRPDELRPMFLRAGVVSQAKGSAYI--EMKNTKVICAIYGPREAPRRQEFSMK-GRLTCEFKFAPFSCIY--RRKHIQDAEEKENSYLVVQALEPAVCLEKFPKAQVDIYITVLENDGSALSAGIICASVALAMAGIEMLDLVSACTMVQSDNHILMDPCEKEIHSSSASGHTMVAILPS 214          
BLAST of Exosome complex component Rrp41 vs. Ensembl Nematostella
Match: EDO26065 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCZ3])

HSP 1 Score: 67.0106 bits (162), Expect = 3.981e-14
Identity = 42/113 (37.17%), Postives = 64/113 (56.64%), Query Frame = 2
Query:  398 VLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERF---TRMFPNNIDHISQVNTLYVAAESVCETVYKELNKQI 727
            VLQ+DG      INAV+LAL++AGI +KD+V+A TV   + T L D+N  EE+    P LT+ +LP S     F   +R+  +N+D +  +      A   C+ +Y  L++ I
Sbjct:    1 VLQADGGNHVACINAVTLALINAGIPLKDYVSACTVSFVNDTPLMDINYLEESTGG-PQLTLAILPKSDKIVLFQMDSRLHMDNMDKVLAL------AMKGCKDIYVLLHRTI 106          
BLAST of Exosome complex component Rrp41 vs. Ensembl Nematostella
Match: EDO43013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZV7])

HSP 1 Score: 48.1358 bits (113), Expect = 9.361e-7
Identity = 39/155 (25.16%), Postives = 69/155 (44.52%), Query Frame = 2
Query:  125 DGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRRHGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVL 589
            DG     QG+T+V+A+ YGP E + + E   D A +   +            + G       L    +++  E ++    +  + + I + V+Q+ GS L+  +NA  LA+MDAG  M+  +   T  + +Q  L      E+ + +   LT V 
Sbjct:   29 DGSSKFAQGDTQVMAAAYGPVEVKLNKEL-IDRATLEVIFRP----------KIGIPGCSEKLVEGIIRNSCEPIVLTALHPRASLTIVVQVVQNSGSLLSCAVNAACLAMMDAGFPMRCMMCGITCAITEQDELVLDPTLEQERKATAVLTFVF 172          
BLAST of Exosome complex component Rrp41 vs. Ensembl Medaka
Match: exosc4 (exosome component 4 [Source:NCBI gene;Acc:101170622])

HSP 1 Score: 152.525 bits (384), Expect = 5.729e-45
Identity = 96/250 (38.40%), Postives = 140/250 (56.00%), Query Frame = 2
Query:   41 ENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECRN-HSEAKHDVAIISCKYSKCPTANFNAGRR-HGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPNNID---HISQVNTLYVAAESVCETVYKELNKQIKLYVASKLDKQHTIEG 775
            + +R DGR+   +R + +R+GV A +  DG   LEQGNTK +A +YGPHE R   S A HD AII+C+YS    +     RR HG R + ++++   +K   E  +    Y  SQIDI + +LQSDG   +V +NA +LA++DAGI M+D+V A TVG  D+T LADL  + E    + SL + LLP      R  ++    +D   H   ++TL  AA + C+ V K L++ +         +QH  EG
Sbjct:   10 QGYRLDGRKATELRKVQARMGVFAQA--DGSAYLEQGNTKALAVVYGPHEIRGARSRALHDRAIINCQYSMATFSTAERKRRPHGDRKS-TEMSLH-LKQTFEAAVLTQLYPRSQIDIYVKILQSDGGNYSVCVNAATLAVIDAGIPMRDYVCACTVGFVDETSLADLC-YAEESGGVSSLALALLP------RGGQIALVQMDARLHQDHLDTLIEAAMTACKGVSKVLDQVV---------RQHLQEG 239          
BLAST of Exosome complex component Rrp41 vs. Ensembl Medaka
Match: exosc6 (exosome component 6 [Source:NCBI gene;Acc:101155271])

HSP 1 Score: 72.7886 bits (177), Expect = 1.113e-14
Identity = 47/155 (30.32%), Postives = 76/155 (49.03%), Query Frame = 2
Query:   50 RNDGRRPN--NIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRRHGKRDNISDLNADC-VKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTV 505
            R DGR+ +  ++R +  R G+ + +    Y+  E G+TK++ S+YGP E     E       ++      P   F+   R        D N    ++  ++  + LH Y  SQI++N++VL++ GS  A  I   SLAL DAGI M D V   ++
Sbjct:   34 RADGRQRDQVDVRPVFVRCGLVSQAKGSAYI--EAGDTKLLCSVYGPRETERKDETDMKCGRLTTDMRFAP---FSCPERGSWIQGSQDKNFSLMLQESLQPALCLHKYPRSQIEVNVMVLENSGSVQAHAITCASLALADAGIEMYDLVLGCSI 183          
BLAST of Exosome complex component Rrp41 vs. Ensembl Medaka
Match: exosc5 (exosome component 5 [Source:NCBI gene;Acc:101161262])

HSP 1 Score: 57.3806 bits (137), Expect = 1.620e-9
Identity = 43/151 (28.48%), Postives = 67/151 (44.37%), Query Frame = 2
Query:  116 SGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRRHGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGL--FDQTILADLNGFEENQS 562
            S  DG     QG+T V+A +YGP E +   E  +D A +       P     + R   +          CV+   E+ + L  +  S + + + VL  DGS L+  +NA  +ALMDAG+ M       T  +  + Q I+ D    +E +S
Sbjct:   22 SRPDGSASFVQGDTSVMAGVYGPAEVKVSKEI-YDRATLEVLVQ--PKVGLPSVRERSQEQ--------CVRETCEEALLLTLHPRSSLTLVLQVLHDDGSLLSCCLNAACMALMDAGLPMSCLFCGVTCAISAYGQ-IITDPTSAQEKES 160          
BLAST of Exosome complex component Rrp41 vs. Planmine SMEST
Match: SMESG000040844.1 (SMESG000040844.1)

HSP 1 Score: 527.324 bits (1357), Expect = 0.000e+0
Identity = 253/254 (99.61%), Postives = 254/254 (100.00%), Query Frame = 2
Query:   23 MSEILYENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRRHGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPNNIDHISQVNTLYVAAESVCETVYKELNKQIKLYVASKLDKQHTIEGRSN 784
            MSEILYENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRR+GKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPNNIDHISQVNTLYVAAESVCETVYKELNKQIKLYVASKLDKQHTIEGRSN
Sbjct:    1 MSEILYENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRRYGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPNNIDHISQVNTLYVAAESVCETVYKELNKQIKLYVASKLDKQHTIEGRSN 254          
BLAST of Exosome complex component Rrp41 vs. Planmine SMEST
Match: SMESG000060406.1 (SMESG000060406.1)

HSP 1 Score: 111.309 bits (277), Expect = 1.008e-29
Identity = 52/63 (82.54%), Postives = 59/63 (93.65%), Query Frame = 2
Query:  470 IRMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFTRMFPNNIDHISQ 658
            ++M +FVTATT+GLFDQTILADLN  EENQSSLPSLTMVLL NSP++ERFTRMFPNNIDHI+Q
Sbjct:   32 LKMLNFVTATTIGLFDQTILADLNCKEENQSSLPSLTMVLLSNSPTNERFTRMFPNNIDHITQ 94          
BLAST of Exosome complex component Rrp41 vs. Planmine SMEST
Match: SMESG000021079.1 (SMESG000021079.1)

HSP 1 Score: 51.6026 bits (122), Expect = 1.421e-7
Identity = 35/130 (26.92%), Postives = 61/130 (46.92%), Query Frame = 2
Query:  116 SGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRRHGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFVTATTV 505
            S  DG   +E G TKV+ ++Y P E R+  +       ++ ++     A F+   R    ++     A  V+S +   I    +  S+I+I ++VL  DG   + +I   SLAL+DA + M D +    +
Sbjct:   37 SNADGSSFVEYGETKVVCTVYSPIELRSEEQLS-----VTVRF-----APFSQPSRLKYVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGVNI 156          
BLAST of Exosome complex component Rrp41 vs. Planmine SMEST
Match: SMESG000021079.1 (SMESG000021079.1)

HSP 1 Score: 49.6766 bits (117), Expect = 4.409e-7
Identity = 34/123 (27.64%), Postives = 60/123 (48.78%), Query Frame = 2
Query:  116 SGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRRHGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKD 484
            S  DG   +E G TKV+ ++Y P E R+  +       ++ ++     A F+   R    ++     A  V+S +   I    +  S+I+I ++VL  DG   + +I   SLAL+DA + M++
Sbjct:   37 SNADGSSFVEYGETKVVCTVYSPIELRSEEQLS-----VTVRF-----APFSQPSRLKYVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMEE 149          
The following BLAST results are available for this feature:
BLAST of Exosome complex component Rrp41 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
EXOSC42.351e-4036.97exosome component 4 [Source:HGNC Symbol;Acc:HGNC:1... [more]
EXOSC49.318e-2133.51exosome component 4 [Source:HGNC Symbol;Acc:HGNC:1... [more]
EXOSC41.910e-1343.75exosome component 4 [Source:HGNC Symbol;Acc:HGNC:1... [more]
EXOSC61.888e-725.91exosome component 6 [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of Exosome complex component Rrp41 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
exos-4.12.581e-3436.86Putative exosome complex component RRP41 [Source:... [more]
back to top
BLAST of Exosome complex component Rrp41 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ski69.761e-3535.89gene:FBgn0032487 transcript:FBtr0334755[more]
Ski69.761e-3535.89gene:FBgn0032487 transcript:FBtr0080483[more]
Mtr35.026e-1228.48gene:FBgn0036916 transcript:FBtr0074918[more]
back to top
BLAST of Exosome complex component Rrp41 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
exosc41.005e-3936.60exosome component 4 [Source:ZFIN;Acc:ZDB-GENE-0404... [more]
exosc69.872e-2232.62exosome component 6 [Source:NCBI gene;Acc:326786][more]
exosc69.872e-2232.62exosome component 6 [Source:NCBI gene;Acc:326786][more]
exosc51.580e-926.67exosome component 5 [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
exosc51.580e-926.67exosome component 5 [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
back to top
BLAST of Exosome complex component Rrp41 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rab27a2.441e-2333.52RAB27A, member RAS oncogene family [Source:Xenbase... [more]
ttyh12.054e-1126.47tweety family member 1 [Source:Xenbase;Acc:XB-GENE... [more]
EXOSC51.836e-726.37exosome component 5 [Source:NCBI gene;Acc:10017061... [more]
back to top
BLAST of Exosome complex component Rrp41 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Exosc42.616e-4138.24exosome component 4 [Source:MGI Symbol;Acc:MGI:192... [more]
Exosc42.196e-1050.00exosome component 4 [Source:MGI Symbol;Acc:MGI:192... [more]
Exosc61.012e-625.26exosome component 6 [Source:MGI Symbol;Acc:MGI:191... [more]
back to top
BLAST of Exosome complex component Rrp41 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q921I9|EXOS4_MOUSE1.830e-4038.24Exosome complex component RRP41 OS=Mus musculus OX... [more]
sp|Q7YRA3|EXOS4_BOVIN3.554e-4037.39Exosome complex component RRP41 OS=Bos taurus OX=9... [more]
sp|Q9NPD3|EXOS4_HUMAN1.129e-3936.97Exosome complex component RRP41 OS=Homo sapiens OX... [more]
sp|Q9SP08|RRP41_ARATH2.581e-3340.43Exosome complex component RRP41 homolog OS=Arabido... [more]
sp|Q17533|EXOS4_CAEEL3.283e-3336.86Putative exosome complex component RRP41 OS=Caenor... [more]
back to top
BLAST of Exosome complex component Rrp41 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YNB81.047e-4348.17Exosome component 4 OS=Fasciola gigantica OX=46835... [more]
A0A4E0R3D51.129e-4348.17Exosome component 4 OS=Fasciola hepatica OX=6192 G... [more]
A0A3B5KCX22.835e-4238.66Exosome component 4 OS=Takifugu rubripes OX=31033 ... [more]
A0A1Z5LER89.300e-4238.37Uncharacterized protein (Fragment) OS=Ornithodoros... [more]
A0A3P9KKE31.522e-4138.40Uncharacterized protein OS=Oryzias latipes OX=8090... [more]
back to top
BLAST of Exosome complex component Rrp41 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
exosc41.324e-4137.87exosome component 4 [Source:NCBI gene;Acc:10303519... [more]
exosc61.317e-2030.13exosome component 6 [Source:NCBI gene;Acc:326786][more]
exosc58.239e-1028.00exosome component 5 [Source:NCBI gene;Acc:10303931... [more]
back to top
BLAST of Exosome complex component Rrp41 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
exosc47.787e-4537.87exosome component 4 [Source:ZFIN;Acc:ZDB-GENE-0404... [more]
back to top
BLAST of Exosome complex component Rrp41 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SKI64.950e-3031.80Exosome non-catalytic core component; involved in ... [more]
back to top
BLAST of Exosome complex component Rrp41 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO424913.580e-3935.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462541.373e-2235.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO260653.981e-1437.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430139.361e-725.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Exosome complex component Rrp41 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
exosc45.729e-4538.40exosome component 4 [Source:NCBI gene;Acc:10117062... [more]
exosc61.113e-1430.32exosome component 6 [Source:NCBI gene;Acc:10115527... [more]
exosc51.620e-928.48exosome component 5 [Source:NCBI gene;Acc:10116126... [more]
back to top
BLAST of Exosome complex component Rrp41 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000040844.10.000e+099.61SMESG000040844.1[more]
SMESG000060406.11.008e-2982.54SMESG000060406.1[more]
SMESG000021079.11.421e-726.92SMESG000021079.1[more]
SMESG000021079.14.409e-727.64SMESG000021079.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004115 ID=SMED30004115|Name=Exosome complex component Rrp41|organism=Schmidtea mediterranea sexual|type=transcript|length=813bp
ATCTGACTTTTTTTAAAACTTGATGTCAGAGATATTGTATGAAAATTTTC
GAAATGATGGTCGACGCCCCAATAACATTAGATCGATAACATCTCGAATA
GGAGTACATGCTAATTCTGGTGATGATGGTTATGTATGTCTAGAACAAGG
CAATACGAAAGTTATTGCATCGATATATGGTCCACATGAATGTCGTAATC
ATTCTGAAGCCAAGCACGATGTAGCTATTATTAGCTGTAAATATTCCAAG
TGTCCTACTGCCAATTTCAATGCTGGTCGCAGACATGGAAAAAGAGATAA
TATTAGTGATTTGAATGCTGATTGCGTTAAGAGTATAATGGAAAAGGTTA
TTGAGTTACATTGGTACGGTGAATCTCAGATTGATATCAATATACTGGTG
TTACAATCTGATGGATCTGAGTTAGCTGTAGTTATTAATGCTGTTTCTTT
GGCTTTAATGGATGCTGGTATACGTATGAAAGATTTTGTCACTGCTACAA
CTGTTGGGTTATTTGATCAAACAATTCTTGCGGATTTAAATGGTTTTGAA
GAAAATCAATCTTCTTTACCTTCTCTAACCATGGTTCTACTCCCTAATTC
TCCAAGCAGTGAACGCTTTACTAGAATGTTTCCGAATAATATCGATCATA
TTTCTCAAGTAAACACGCTATATGTAGCTGCGGAAAGTGTATGTGAAACT
GTTTATAAAGAATTAAATAAACAAATCAAATTATATGTTGCATCAAAACT
GGATAAGCAACATACTATTGAAGGCCGTTCAAATTAATAAATTGTTTTCT
TTAATATATTTTG
back to top

protein sequence of SMED30004115-orf-1

>SMED30004115-orf-1 ID=SMED30004115-orf-1|Name=SMED30004115-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=255bp
MSEILYENFRNDGRRPNNIRSITSRIGVHANSGDDGYVCLEQGNTKVIAS
IYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRRHGKRDNISDLNAD
CVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGI
RMKDFVTATTVGLFDQTILADLNGFEENQSSLPSLTMVLLPNSPSSERFT
RMFPNNIDHISQVNTLYVAAESVCETVYKELNKQIKLYVASKLDKQHTIE
GRSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:00001753'-5'-exoribonuclease activity
GO:0004518nuclease activity
GO:0004527exonuclease activity
GO:0016787hydrolase activity
GO:0016896exoribonuclease activity, producing 5'-phosphomonoesters
GO:0003723RNA binding
GO:0005515protein binding
GO:0017091AU-rich element binding
Vocabulary: biological process
TermDefinition
GO:0006401RNA catabolic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
GO:0090503RNA phosphodiester bond hydrolysis, exonucleolytic
GO:0045006DNA deamination
GO:0051607defense response to virus
GO:0071028nuclear mRNA surveillance
GO:0071044histone mRNA catabolic process
GO:0071051polyadenylation-dependent snoRNA 3'-end processing
GO:0000460maturation of 5.8S rRNA
GO:0000956nuclear-transcribed mRNA catabolic process
GO:0006364rRNA processing
GO:0016075rRNA catabolic process
GO:0030307positive regulation of cell growth
GO:0031125rRNA 3'-end processing
GO:0034427nuclear-transcribed mRNA catabolic process, exonucleolytic, 3'-5'
GO:0034475U4 snRNA 3'-end processing
Vocabulary: INTERPRO
TermDefinition
IPR036345ExoRNase_PH_dom2_sf
IPR001247ExoRNase_PH_dom1
IPR027408PNPase/RNase_PH_dom_sf
IPR020568Ribosomal_S5_D2-typ_fold
IPR015847ExoRNase_PH_dom2
Vocabulary: cellular component
TermDefinition
GO:0045111intermediate filament cytoskeleton
GO:0000176nuclear exosome (RNase complex)
GO:0000177cytoplasmic exosome (RNase complex)
GO:0000178exosome (RNase complex)
GO:0005634nucleus
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0035327transcriptionally active chromatin
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001247Exoribonuclease, phosphorolytic domain 1PFAMPF01138RNase_PHcoord: 19..150
e-value: 3.2E-23
score: 82.7
IPR027408PNPase/RNase PH domain superfamilyGENE3DG3DSA:3.30.230.70coord: 1..247
e-value: 1.5E-52
score: 180.4
NoneNo IPR availablePANTHERPTHR11953:SF0EXOSOME COMPLEX COMPONENT RRP41coord: 7..237
NoneNo IPR availablePANTHERPTHR11953EXOSOME COMPLEX COMPONENTcoord: 7..237
IPR020568Ribosomal protein S5 domain 2-type foldSUPERFAMILYSSF54211Ribosomal protein S5 domain 2-likecoord: 3..177
IPR036345Exoribonuclease, PH domain 2 superfamilySUPERFAMILYSSF55666Ribonuclease PH domain 2-likecoord: 152..236