Dynein heavy chain 5, axonemal

Overview
NameDynein heavy chain 5, axonemal
Smed IDSMED30004112
Length (bp)15196
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein heavy chain 5, axonemal (SMED30004112) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein heavy chain 5, axonemal (SMED30004112) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein heavy chain 5, axonemal (SMED30004112) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein heavy chain 5, axonemal (SMED30004112) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004112

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 24

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30004112SMESG000012967.1 SmedASXL_003208SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30004112SMESG000012967.1 SmedASXL_004284SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30004112SMESG000012967.1 SmedASXL_003350SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30004112SMESG000012967.1 SmedASXL_018146SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30004112SMESG000012967.1 SmedASXL_018793SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30004112SMESG000012967.1 dd_Smed_v4_17773_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30004112SMESG000012967.1 dd_Smed_v4_17773_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30004112SMESG000012967.1 dd_Smed_v4_17773_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30004112SMESG000012967.1 dd_Smed_v4_4113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30004112SMESG000012967.1 dd_Smed_v4_4113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30004112SMESG000012967.1 dd_Smed_v4_4113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30004112SMESG000012967.1 dd_Smed_v4_4113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004112SMESG000012967.1 dd_Smed_v4_4113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30004112SMESG000012967.1 dd_Smed_v4_4113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30004112SMESG000012967.1 dd_Smed_v4_4113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30004112SMESG000012967.1 dd_Smed_v4_32529_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004112SMESG000012967.1 dd_Smed_v4_17773_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30004112SMESG000012967.1 dd_Smed_v4_17773_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30004112SMESG000012967.1 dd_Smed_v4_17773_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30004112SMESG000012967.1 dd_Smed_v4_17773_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004112SMESG000012967.1 dd_Smed_v4_4113_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30004112SMESG000012967.1 dd_Smed_v4_4113_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30004112SMESG000012967.1 dd_Smed_v4_4113_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30004112SMESG000012967.1 dd_Smed_v4_4113_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH8 (dynein axonemal heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:2952])

HSP 1 Score: 611.298 bits (1575), Expect = 3.124e-174
Identity = 538/2156 (24.95%), Postives = 975/2156 (45.22%), Query Frame = 3
Query: 3618 RLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDL--HTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYIS-TGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKF----NTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLA-----TLTCTHDLGY----EFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYS-DSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRR---VNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQN-HKELSINSVTIAFQNSLKVLSQMLVDNKEIGGEL---HIQRLFVFCFIWSLNSQISDLNKQAITTLLKRE--TLVLPD--DDNSICIFDYYVDESGEWDLWSSLLMDEGEYL---SLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFEC-HIDSIEN-----CQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATL-QAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGK----DSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKL---ETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFD-LIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            R      +++  ++  LW    D +  +E LA   +   ++ +I      +  +  L   I +  L + T+  +  L      W+    + L++E K+ +     +    +++L + + +L+ +   +  L  I D ++++D    PIE  Y  L  FE+ + + E   +  LR  ++ L   A S +  L+  +   F   L + ++ F  +VI F   ++ E P +    P E   +L+ F+  +     K  T  +  +LFGL V  +  L   +++L LL +LY LY         + + LW  VD++ +  +L EF + C  LP  LK+ +++ +LK +ID   +   +L  + +K ++ RHW ++ ++TG  F +E+ +F   ++   PLL++K +I+ IC  A KE ++E KL Q+ E WT Q L F +   +G ++L+   +  ++  +EDS ++L ++ ++R+  P K     W  KL   S++++ WL VQ LW+ LE VF+   I K L QE KRF+ +DKS+IK M+R +E  NV  CC+ +E +    L ++ + LE C  SL GYL +KR LF R +FV D  +L IL  ++D   I  HLP++   +N++  H     R    I  + S   E+IVL+N +  K  V  WL  L      S+ N+   A   IS +G  L      FP+Q+    + + W+++   A+   K D+K +    +KF    NT IS           ++T D ++   R +  ++    ++ RD   +L    I+   DFE  K               +F        T+    D+ +    EF G    +  TP T++  +TL  +L      +  G + +GK+   +++ R   +Y V  +C   M    L     G+A +G WG  D    ++   LS+A   I  +  A K++       + + + L      F T   P  +    LP N+  +FR VA+  PD   I++       +  +  LA + Y + K     + +       LR+I++ L                        T GS           +K   P  S                   E ++V+  + ++ L  +  E+E     ++ D F G   DS++         +L NA+  + ++           K VQLY       GL+  GP+ SGK+T + I + A                      E   P      +P+ +                  +MFG   T   D+ DG+F+ LWR+     + + I +++ DG +   W +NL S+LDD  TL L +G R+P + + K +FE++++++ASP  VSR G+VY  S+ + WR I   WL+ + + E      +++K+ +    Y+  N + ++ +       Q SL +L + L+ +KE GG     H+ +LFVF  +WSL + +   +++ +   L++    L LP+    ++  ++++YV + G+W+ W+  L  +  Y    S+     +LV  +  +R  + +D   +    V L G +G+ K++++  + +K D          +S  T+    +  +E+ ++ R G  YG    + +T+ I+D+N+P   E         NE++RQ++    + +   P +   + D  +I ++       + +  RL R F      +P  + +  I  G+  C + D   +     C++ ++    L+S  + L++   + ++   T  + H  FNLR ++ I  G+ +   +  +S P LL  + +   RV  D  I   D +WFNA L +A+ +N+  G  ++  +  E  F+ F  E       +   ++        PKI   M   +    +L  ++  +Q +F +     S++L+   + +  +I I R I +   G+ +L+G  GS    +  +A  IA   I ++    + N   L D +K++ +  G++GK    + T   +K    L+ LN+L+ SG+   LF  DEM  +   +   MKRE         FD L E F SR R++LH++LC  P  +       K+PG++S   ++W        L+A A+YF++
Sbjct: 1214 RKAAHEALQDFQKYKTLWTEDRD-VKVKEFLANNPSLTEIRSEILHYATFEQEIDELKPIIVVGALELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSYMIAFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYAILNRFEVEVTKEESEAVDTLRYSFNKLQSKAVSVQEDLVQVQPK-FKSNLLESVEVFREDVINFAEAYELEGPMVPNIPPQEASNRLQIFQASFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMSSISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDE-TMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDR----IMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLIS-----------QTTHD-LSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLK-------------QSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMN-PGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLR-----------------------TLGS-----------QKRARPEDS-------------------ELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTY-------AELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKA--------------------QTECGRPHREMRMNPKAITAP---------------QMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENI-FLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQ-SLNLL-EGLIPSKEEGGVSCVEHLHKLFVFGLMWSLGALLELESREKLEAFLRQHESKLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKL--QPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQIT---NEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIF-GIIGCGYFDPCRSFKPQICEMIVN----LVSVGRVLWQ--WTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENI--GSDAASCILPEPYFVDFLREMPEPTGDEPEDSV-----FEVPKIYELMPSFD----FLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISR-IIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHP--PTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLS 3212          

HSP 2 Score: 103.605 bits (257), Expect = 1.430e-20
Identity = 103/474 (21.73%), Postives = 206/474 (43.46%), Query Frame = 3
Query: 13776 PVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFES---HSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTI-ESIQERLKKVT-----NNFIYSKT--LMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGV 15164
            P+++  + L S ++ R  +  LG+     I    N ++    VQ + N  +       +SWN +RY + E+ YG +VT + D+  +      W +       F F    Y  P +  + +  F  I+      +P +F      H ++++  + N+   ++E I  +     +       +  T+ E  ++ + +++ SKLP   I   ++ RL K+      N F+  +   + + + +  S   ++   I+ T  +IM+E    + DA    + ++   ++P+ W  ++       G+    W + LL +       I   +  V  +W+  F  P+  L   ++EV+    R  +      V    E   + K+ I  PP +G+Y++GL++ G  +D+  G+L + + K + T LPV HI F +N    P++   Y CPI+          + +   +  ++   W+LRGV
Sbjct: 4265 PMLYTVAFLHSTVQERRKFGPLGW----NIPYEFNSADFSASVQFIQNHLDECDIKKGVSWNTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCF-YTGYKIP-LCKTLDQYFEYIQSLPSLDNPEVF----GLHPNADITYQSNTASAVLETITNI-----QPKESGGGVGETR-EAIVYRLSEDMLSKLPPDYIPHEVKSRLIKMGHLNSMNIFLRQEIDRMQRVISILRSSLSDLKLAIEGT--IIMSE---NLRDA----LDNMYDARIPQLW-KRVSWDSSTLGF----WFTELLERNAQFSTWIFEGRPNV--FWMTGFFNPQGFLTAMRQEVT----RAHKGWALDTVTIHNEVLRQTKEEITSPPGEGVYIYGLYMDGAAWDRRNGKLMESTPKVLFTQLPVLHI-FAINS-TAPKDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGV 4700          

HSP 3 Score: 97.8265 bits (242), Expect = 7.187e-19
Identity = 132/613 (21.53%), Postives = 279/613 (45.51%), Query Frame = 3
Query: 11412 KKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDE-RAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSK-IEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSDLHNR--LESCLASGQCMIIADCDIHQ---LAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSI----DNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSE-------RLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLI-SPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTV 13193
            + E   ++++++  + ++  +  +     +++     L++ +   + +W   SK+++ +   +    L+ + +L+Y GP N      F ++ +       L   +   ++ + +   L     I +     LP  +  I N   +   +    + L+ D   +  +W+       +  V S +  + R  LE  L+ G+ ++I D  IH+    A D ++ +       F+K   TFK+ +  + E +    F+L++ T          + + T ++ F  ++  L N+ L R I   K  ++ E  KLL +    KRK+ +LE+ +L  LS       S+ +  ++I  L+  ++  A + +K  + +  +  I    + +   A R + ++ + + M+ V   Y     ++L LFD  +  SE       R++N  II+ LT +   YS+  + + +KF+F LL++++I      V+  + + LI   +++ LK+ P              KP+ W+ + + +N+  L+  LP F +I+  + ++  E  WK  FD ++PE   I+   + +S+D   KL LIR+  PDR +  +  +I ++L  K+   V
Sbjct: 3536 QAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFN----QIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKAT---RYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIED--IHEELDPALDNVLEK------NFIKSGTTFKVKV-GDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSA---TKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITN--IIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACP-------------PKPYRWILDMTWLNLVELSK-LPQFAEIMNQISRN--EKGWKSWFDKDAPE-EEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPV 4110          

HSP 4 Score: 78.1814 bits (191), Expect = 5.564e-13
Identity = 55/283 (19.43%), Postives = 128/283 (45.23%), Query Frame = 3
Query: 2040 MNNFDKTFSIFLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAGM 2888
            +N  +     F+N  F + + + +AL ++ +F  L     +   I H I  +   + +++    + Y   K+       M  +   + W+++L   I  P+  F    ++    + +++++QYNK+S  L+  +  Y   W+  +      L+  L V      K+ +N    +L ++ ET+ MI+++  +   A  LLK E ++K     L   + Y++ + Q +    + L    +K V    + G + L+W+++ ++ F  +V  V+     ++ +++ +
Sbjct:  650 INGLEVQIQAFMNSSFGKILSSQQALQLLQRFQKLNI-PCLGLEINHTIERILQYYVAELDATKKLYHSQKDDPPLARNMPPIAGKILWVRQLYRRISEPINYFFKNSDILSSPDGKAVIRQYNKISYVLVEFEVVYHTAWIREISQLHYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKRLLKLESKLKADKLYLQGLLQYYDELCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLTLESFFQEVELVLDMFNQLLKKISDL 931          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH8 (dynein axonemal heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:2952])

HSP 1 Score: 609.757 bits (1571), Expect = 1.040e-173
Identity = 538/2156 (24.95%), Postives = 975/2156 (45.22%), Query Frame = 3
Query: 3618 RLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDL--HTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYIS-TGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKF----NTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLA-----TLTCTHDLGY----EFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYS-DSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRR---VNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQN-HKELSINSVTIAFQNSLKVLSQMLVDNKEIGGEL---HIQRLFVFCFIWSLNSQISDLNKQAITTLLKRE--TLVLPD--DDNSICIFDYYVDESGEWDLWSSLLMDEGEYL---SLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFEC-HIDSIEN-----CQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATL-QAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGK----DSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKL---ETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFD-LIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            R      +++  ++  LW    D +  +E LA   +   ++ +I      +  +  L   I +  L + T+  +  L      W+    + L++E K+ +     +    +++L + + +L+ +   +  L  I D ++++D    PIE  Y  L  FE+ + + E   +  LR  ++ L   A S +  L+  +   F   L + ++ F  +VI F   ++ E P +    P E   +L+ F+  +     K  T  +  +LFGL V  +  L   +++L LL +LY LY         + + LW  VD++ +  +L EF + C  LP  LK+ +++ +LK +ID   +   +L  + +K ++ RHW ++ ++TG  F +E+ +F   ++   PLL++K +I+ IC  A KE ++E KL Q+ E WT Q L F +   +G ++L+   +  ++  +EDS ++L ++ ++R+  P K     W  KL   S++++ WL VQ LW+ LE VF+   I K L QE KRF+ +DKS+IK M+R +E  NV  CC+ +E +    L ++ + LE C  SL GYL +KR LF R +FV D  +L IL  ++D   I  HLP++   +N++  H     R    I  + S   E+IVL+N +  K  V  WL  L      S+ N+   A   IS +G  L      FP+Q+    + + W+++   A+   K D+K +    +KF    NT IS           ++T D ++   R +  ++    ++ RD   +L    I+   DFE  K               +F        T+    D+ +    EF G    +  TP T++  +TL  +L      +  G + +GK+   +++ R   +Y V  +C   M    L     G+A +G WG  D    ++   LS+A   I  +  A K++       + + + L      F T   P  +    LP N+  +FR VA+  PD   I++       +  +  LA + Y + K     + +       LR+I++ L                        T GS           +K   P  S                   E ++V+  + ++ L  +  E+E     ++ D F G   DS++         +L NA+  + ++           K VQLY       GL+  GP+ SGK+T + I + A                      E   P      +P+ +                  +MFG   T   D+ DG+F+ LWR+     + + I +++ DG +   W +NL S+LDD  TL L +G R+P + + K +FE++++++ASP  VSR G+VY  S+ + WR I   WL+ + + E      +++K+ +    Y+  N + ++ +       Q SL +L + L+ +KE GG     H+ +LFVF  +WSL + +   +++ +   L++    L LP+    ++  ++++YV + G+W+ W+  L  +  Y    S+     +LV  +  +R  + +D   +    V L G +G+ K++++  + +K D          +S  T+    +  +E+ ++ R G  YG    + +T+ I+D+N+P   E         NE++RQ++    + +   P +   + D  +I ++       + +  RL R F      +P  + +  I  G+  C + D   +     C++ ++    L+S  + L++   + ++   T  + H  FNLR ++ I  G+ +   +  +S P LL  + +   RV  D  I   D +WFNA L +A+ +N+  G  ++  +  E  F+ F  E       +   ++        PKI   M   +    +L  ++  +Q +F +     S++L+   + +  +I I R I +   G+ +L+G  GS    +  +A  IA   I ++    + N   L D +K++ +  G++GK    + T   +K    L+ LN+L+ SG+   LF  DEM  +   +   MKRE         FD L E F SR R++LH++LC  P  +       K+PG++S   ++W        L+A A+YF++
Sbjct:  997 RKAAHEALQDFQKYKTLWTEDRD-VKVKEFLANNPSLTEIRSEILHYATFEQEIDELKPIIVVGALELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSYMIAFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYAILNRFEVEVTKEESEAVDTLRYSFNKLQSKAVSVQEDLVQVQPK-FKSNLLESVEVFREDVINFAEAYELEGPMVPNIPPQEASNRLQIFQASFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMSSISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDE-TMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDR----IMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLIS-----------QTTHD-LSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLK-------------QSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMN-PGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLR-----------------------TLGS-----------QKRARPEDS-------------------ELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTY-------AELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKA--------------------QTECGRPHREMRMNPKAITAP---------------QMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENI-FLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQ-SLNLL-EGLIPSKEEGGVSCVEHLHKLFVFGLMWSLGALLELESREKLEAFLRQHESKLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKL--QPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQIT---NEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIF-GIIGCGYFDPCRSFKPQICEMIVN----LVSVGRVLWQ--WTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENI--GSDAASCILPEPYFVDFLREMPEPTGDEPEDSV-----FEVPKIYELMPSFD----FLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISR-IIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHP--PTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLS 2995          

HSP 2 Score: 103.219 bits (256), Expect = 1.710e-20
Identity = 103/474 (21.73%), Postives = 206/474 (43.46%), Query Frame = 3
Query: 13776 PVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFES---HSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTI-ESIQERLKKVT-----NNFIYSKT--LMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGV 15164
            P+++  + L S ++ R  +  LG+     I    N ++    VQ + N  +       +SWN +RY + E+ YG +VT + D+  +      W +       F F    Y  P +  + +  F  I+      +P +F      H ++++  + N+   ++E I  +     +       +  T+ E  ++ + +++ SKLP   I   ++ RL K+      N F+  +   + + + +  S   ++   I+ T  +IM+E    + DA    + ++   ++P+ W  ++       G+    W + LL +       I   +  V  +W+  F  P+  L   ++EV+    R  +      V    E   + K+ I  PP +G+Y++GL++ G  +D+  G+L + + K + T LPV HI F +N    P++   Y CPI+          + +   +  ++   W+LRGV
Sbjct: 4048 PMLYTVAFLHSTVQERRKFGPLGW----NIPYEFNSADFSASVQFIQNHLDECDIKKGVSWNTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCF-YTGYKIP-LCKTLDQYFEYIQSLPSLDNPEVF----GLHPNADITYQSNTASAVLETITNI-----QPKESGGGVGETR-EAIVYRLSEDMLSKLPPDYIPHEVKSRLIKMGHLNSMNIFLRQEIDRMQRVISILRSSLSDLKLAIEGT--IIMSE---NLRDA----LDNMYDARIPQLW-KRVSWDSSTLGF----WFTELLERNAQFSTWIFEGRPNV--FWMTGFFNPQGFLTAMRQEVT----RAHKGWALDTVTIHNEVLRQTKEEITSPPGEGVYIYGLYMDGAAWDRRNGKLMESTPKVLFTQLPVLHI-FAINS-TAPKDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGV 4483          

HSP 3 Score: 97.4413 bits (241), Expect = 9.117e-19
Identity = 132/613 (21.53%), Postives = 279/613 (45.51%), Query Frame = 3
Query: 11412 KKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDE-RAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSK-IEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSDLHNR--LESCLASGQCMIIADCDIHQ---LAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSI----DNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSE-------RLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLI-SPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTV 13193
            + E   ++++++  + ++  +  +     +++     L++ +   + +W   SK+++ +   +    L+ + +L+Y GP N      F ++ +       L   +   ++ + +   L     I +     LP  +  I N   +   +    + L+ D   +  +W+       +  V S +  + R  LE  L+ G+ ++I D  IH+    A D ++ +       F+K   TFK+ +  + E +    F+L++ T          + + T ++ F  ++  L N+ L R I   K  ++ E  KLL +    KRK+ +LE+ +L  LS       S+ +  ++I  L+  ++  A + +K  + +  +  I    + +   A R + ++ + + M+ V   Y     ++L LFD  +  SE       R++N  II+ LT +   YS+  + + +KF+F LL++++I      V+  + + LI   +++ LK+ P              KP+ W+ + + +N+  L+  LP F +I+  + ++  E  WK  FD ++PE   I+   + +S+D   KL LIR+  PDR +  +  +I ++L  K+   V
Sbjct: 3319 QAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFN----QIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKAT---RYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIED--IHEELDPALDNVLEK------NFIKSGTTFKVKV-GDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSA---TKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITN--IIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACP-------------PKPYRWILDMTWLNLVELSK-LPQFAEIMNQISRN--EKGWKSWFDKDAPE-EEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPV 3893          

HSP 4 Score: 77.7962 bits (190), Expect = 8.011e-13
Identity = 55/283 (19.43%), Postives = 128/283 (45.23%), Query Frame = 3
Query: 2040 MNNFDKTFSIFLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAGM 2888
            +N  +     F+N  F + + + +AL ++ +F  L     +   I H I  +   + +++    + Y   K+       M  +   + W+++L   I  P+  F    ++    + +++++QYNK+S  L+  +  Y   W+  +      L+  L V      K+ +N    +L ++ ET+ MI+++  +   A  LLK E ++K     L   + Y++ + Q +    + L    +K V    + G + L+W+++ ++ F  +V  V+     ++ +++ +
Sbjct:  433 INGLEVQIQAFMNSSFGKILSSQQALQLLQRFQKLNI-PCLGLEINHTIERILQYYVAELDATKKLYHSQKDDPPLARNMPPIAGKILWVRQLYRRISEPINYFFKNSDILSSPDGKAVIRQYNKISYVLVEFEVVYHTAWIREISQLHYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKRLLKLESKLKADKLYLQGLLQYYDELCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLTLESFFQEVELVLDMFNQLLKKISDL 714          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH8 (dynein axonemal heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:2952])

HSP 1 Score: 608.986 bits (1569), Expect = 1.260e-173
Identity = 538/2156 (24.95%), Postives = 975/2156 (45.22%), Query Frame = 3
Query: 3618 RLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDL--HTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYIS-TGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKF----NTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLA-----TLTCTHDLGY----EFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYS-DSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRR---VNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQN-HKELSINSVTIAFQNSLKVLSQMLVDNKEIGGEL---HIQRLFVFCFIWSLNSQISDLNKQAITTLLKRE--TLVLPD--DDNSICIFDYYVDESGEWDLWSSLLMDEGEYL---SLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFEC-HIDSIEN-----CQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATL-QAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGK----DSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKL---ETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFD-LIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            R      +++  ++  LW    D +  +E LA   +   ++ +I      +  +  L   I +  L + T+  +  L      W+    + L++E K+ +     +    +++L + + +L+ +   +  L  I D ++++D    PIE  Y  L  FE+ + + E   +  LR  ++ L   A S +  L+  +   F   L + ++ F  +VI F   ++ E P +    P E   +L+ F+  +     K  T  +  +LFGL V  +  L   +++L LL +LY LY         + + LW  VD++ +  +L EF + C  LP  LK+ +++ +LK +ID   +   +L  + +K ++ RHW ++ ++TG  F +E+ +F   ++   PLL++K +I+ IC  A KE ++E KL Q+ E WT Q L F +   +G ++L+   +  ++  +EDS ++L ++ ++R+  P K     W  KL   S++++ WL VQ LW+ LE VF+   I K L QE KRF+ +DKS+IK M+R +E  NV  CC+ +E +    L ++ + LE C  SL GYL +KR LF R +FV D  +L IL  ++D   I  HLP++   +N++  H     R    I  + S   E+IVL+N +  K  V  WL  L      S+ N+   A   IS +G  L      FP+Q+    + + W+++   A+   K D+K +    +KF    NT IS           ++T D ++   R +  ++    ++ RD   +L    I+   DFE  K               +F        T+    D+ +    EF G    +  TP T++  +TL  +L      +  G + +GK+   +++ R   +Y V  +C   M    L     G+A +G WG  D    ++   LS+A   I  +  A K++       + + + L      F T   P  +    LP N+  +FR VA+  PD   I++       +  +  LA + Y + K     + +       LR+I++ L                        T GS           +K   P  S                   E ++V+  + ++ L  +  E+E     ++ D F G   DS++         +L NA+  + ++           K VQLY       GL+  GP+ SGK+T + I + A                      E   P      +P+ +                  +MFG   T   D+ DG+F+ LWR+     + + I +++ DG +   W +NL S+LDD  TL L +G R+P + + K +FE++++++ASP  VSR G+VY  S+ + WR I   WL+ + + E      +++K+ +    Y+  N + ++ +       Q SL +L + L+ +KE GG     H+ +LFVF  +WSL + +   +++ +   L++    L LP+    ++  ++++YV + G+W+ W+  L  +  Y    S+     +LV  +  +R  + +D   +    V L G +G+ K++++  + +K D          +S  T+    +  +E+ ++ R G  YG    + +T+ I+D+N+P   E         NE++RQ++    + +   P +   + D  +I ++       + +  RL R F      +P  + +  I  G+  C + D   +     C++ ++    L+S  + L++   + ++   T  + H  FNLR ++ I  G+ +   +  +S P LL  + +   RV  D  I   D +WFNA L +A+ +N+  G  ++  +  E  F+ F  E       +   ++        PKI   M   +    +L  ++  +Q +F +     S++L+   + +  +I I R I +   G+ +L+G  GS    +  +A  IA   I ++    + N   L D +K++ +  G++GK    + T   +K    L+ LN+L+ SG+   LF  DEM  +   +   MKRE         FD L E F SR R++LH++LC  P  +       K+PG++S   ++W        L+A A+YF++
Sbjct: 1214 RKAAHEALQDFQKYKTLWTEDRD-VKVKEFLANNPSLTEIRSEILHYATFEQEIDELKPIIVVGALELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSYMIAFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYAILNRFEVEVTKEESEAVDTLRYSFNKLQSKAVSVQEDLVQVQPK-FKSNLLESVEVFREDVINFAEAYELEGPMVPNIPPQEASNRLQIFQASFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMSSISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDE-TMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDR----IMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLIS-----------QTTHD-LSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLK-------------QSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMN-PGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLR-----------------------TLGS-----------QKRARPEDS-------------------ELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTY-------AELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKA--------------------QTECGRPHREMRMNPKAITAP---------------QMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENI-FLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQ-SLNLL-EGLIPSKEEGGVSCVEHLHKLFVFGLMWSLGALLELESREKLEAFLRQHESKLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKL--QPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQIT---NEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIF-GIIGCGYFDPCRSFKPQICEMIVN----LVSVGRVLWQ--WTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENI--GSDAASCILPEPYFVDFLREMPEPTGDEPEDSV-----FEVPKIYELMPSFD----FLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISR-IIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHP--PTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLS 3212          

HSP 2 Score: 97.0561 bits (240), Expect = 1.297e-18
Identity = 131/576 (22.74%), Postives = 263/576 (45.66%), Query Frame = 3
Query: 11523 LVENIKPMEEKWQTMSKQYEDE-RAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSK-IEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSDLHNR--LESCLASGQCMIIADCDIHQ---LAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSI----DNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSE-------RLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLI-SPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTV 13193
            L++ +   + +W   SK+++ +   +    L+ + +L+Y GP N      F ++ +       L   +   ++ + +   L     I +     LP  +  I N   +   +    + L+ D   +  +W+       +  V S +  + R  LE  L+ G+ ++I D  IH+    A D ++ +       F+K   TFK+ +  + E +    F+L++ T          + + T ++ F  ++  L N+ L R I   K  ++ E  KLL +    KRK+ +LE+ +L  LS       S+ +  ++I  L+  ++  A + +K  + +  +  I    + +   A R + ++ + + M+ V   Y     ++L LFD  +  SE       R++N  II+ LT +   YS+  + + +KF+F LL++++I      V+  + + LI   +++ LK+ P              KP+ W+ + + +N+  L+  LP F +I+  + ++  E  WK  FD ++PE   I+   + +S+D   KL LIR+  PDR +  +  +I ++L  K+   V
Sbjct: 3573 LIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFN----QIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKAT---RYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIED--IHEELDPALDNVLEK------NFIKSGTTFKVKV-GDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSA---TKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITN--IIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACP-------------PKPYRWILDMTWLNLVELSK-LPQFAEIMNQISRN--EKGWKSWFDKDAPE-EEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPV 4110          

HSP 3 Score: 78.1814 bits (191), Expect = 6.145e-13
Identity = 55/283 (19.43%), Postives = 128/283 (45.23%), Query Frame = 3
Query: 2040 MNNFDKTFSIFLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAGM 2888
            +N  +     F+N  F + + + +AL ++ +F  L     +   I H I  +   + +++    + Y   K+       M  +   + W+++L   I  P+  F    ++    + +++++QYNK+S  L+  +  Y   W+  +      L+  L V      K+ +N    +L ++ ET+ MI+++  +   A  LLK E ++K     L   + Y++ + Q +    + L    +K V    + G + L+W+++ ++ F  +V  V+     ++ +++ +
Sbjct:  650 INGLEVQIQAFMNSSFGKILSSQQALQLLQRFQKLNI-PCLGLEINHTIERILQYYVAELDATKKLYHSQKDDPPLARNMPPIAGKILWVRQLYRRISEPINYFFKNSDILSSPDGKAVIRQYNKISYVLVEFEVVYHTAWIREISQLHYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKRLLKLESKLKADKLYLQGLLQYYDELCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLTLESFFQEVELVLDMFNQLLKKISDL 931          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 425.631 bits (1093), Expect = 5.659e-118
Identity = 575/2889 (19.90%), Postives = 1178/2889 (40.78%), Query Frame = 3
Query: 2013 KTSEMHEEIMNNF-------DKTFSIFLNLLFLRPMRTGEA-LSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDI-------TGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCV-AKLKNPLLVVDLV----------GNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAGMHSEFSKLLKYLATQKIYNFNHLLSKNW--DSNEFTEAINKDLLAKKSTVQRTLEACSNILKEITEIISIVEKLDPNSSLYESEDLIFGQMKEMYNKSLSQSLYRSIINNLVYL--AICSNCQKEHLELLTSRAE--YDPVTGINDNLCSSYGEEVFCINDIKPIYDSDHAESKTLIKFILLVKYEIPMIKFEPELDAIQSIIEQMGQDIMAFHNDVSDFSGRKLNLYIKLESDLFYEFSQIISLKYSESRLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSR----RGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCC-ISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEI-KSDKKSLSHLAKKFNTQI----SRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNR---NDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLEN-KRSIEVIALTKIFDK----ILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQML-VDNKEIGGELH----IQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSI------------CIFDYYVD-ESGEWDLWSSLLMDEGEYLSLQLTG--EVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFV-YSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETS---NDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLS-----AVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNHSLNEIDLYLSEEKDKDQLAQYLANLHKEVLKFTVTPSIVSGKSVKIGKIIMNDKKKEIYKYDSTSLAPYSQLFLREKLRNLNDNSIQKKIYNGPCTFHRFLYILRRLLHQKTIEKTQSTQTISRALNSIKQTKHDITTINNLISHQKVKFNEISIKSQQLLKTL 10439
            K+S+  + +M+ F       +K    F++  F + +R+ EA   ++ KF +++ R+++   +  K  ++   +  +I           E+   +KN          V   + W + L   I+  ++RFQ+++E+      + + ++Y +V + +  ++      W+   +  + A +K  LL    +          G    IN    L  IINET+ + ++   +   A  +   E +   + + +   ++++  +  ++      L ++H + +++ F++G   L+W ++ I  ++      IG  ES+++Q+     + S  L  +    ++ +    S+       EF E I ++  +    + R   A       I  +++ VE L  +++  ++  L      + + K + + L + I+ NL      I  N    H E + +  E    P T   D +C        C+ +   I       +K  ++++     E P  K E E      ++      I+ F+ND+S      LN  I        E + +I        + L   ++    +  LWK+    +  E+  AKK    +  EK+     +   + R P   +  C+ +  +     +      W    G+ L++ AK  L    +  E + + L++    LE L  +L  + +I    L ++  Y+ ++  Y  + ++ L    +E+  +  +   WS L   + +  + L + KR  F +    ++  + V++ +F   F  E P   G D  +    L  +  + + +E+ +  L    KLF L +  + EL  +++++  L  +Y LY+     ++ ++  LW  +++  +   +  F      LP  ++       L+ K+        +L +L ++ +R+RHW ++M+ T   F++   TF   ++  + L ++   ++ I   A KE+ +E  + +I + W         + +    RG ++  V   + ++Q L+D+   L ++  SR + P      +W   L  I EV+++W+ VQ+ W+ LE++FI   I   L +E K+F+ +DK + + M    +   + +CC   N  S    L+N+ +GLE C  SL  YL  KRN F R +F+ D  +LSIL  S+ +  +  H+  ++  +  L  +        +  + S+  E +     +  +  V +W+  + NE+  +   ++ +AI       S  +    +   +  +A  + W+ E+     +  K +K+++ +  +K + QI    +RI + L++N             R++  ++ +  ++ RD + +     I +  +F+    ++      D   ++   +   T T   GYE+ G    +  TP T++  LTL  +L      +  G + +GK+   ++LA+      V  +C   M   ++     G+A  G WG  D    +D S LS+    I  I++A+  +  T    E + I L      F T   P  +    LP ++   FR V +  PDL QI +       +  ++TLA ++  + K A   +++       LR++ + L  A   K+                 G S L                                     E  +++ A+ ++ LP    E+      ++ D F G      +       PD  +A+ +  +    ++    ++K VQ++  +      ++ GPT  GKS  ++    A                                     L  +  +Y + P +     E++G       D+ DG+ + ++R +N+        +I+FDG +   W +N+ S++DD   L L +G R+    +   +FE+  ++ ASP  VSR G+VY     + +R     W+      +E   L  +F+K    ++D +++ I+   +   +   TI  Q  L +++Q+  + +  + GE+     ++  F+     SL + + +  +      +KR   +   D   +             ++D++ D +  +W  WS L+    EY+         +LV T+ T R  + L+   +    V  +G  G+ K+    N + K+     NI   V +S  T S  ++  LEAN+E R    YG    K L + ++D+N+P+   +D    ++P  +L+ LL    + +         + D   I ++       + +DPR +  F    +  P    L  I   + + H  +     + +  + +L   T  LY+ +   L    T  + H  FNLR ++ +  G+   N +   +   +++ W     RVF D LI +TD +     + +++   +  ++        R+ I F              + +   H   P+I   + D  + +      +  + E   K  +NL+  D+ L  +  +HR I +   GH +L+G  GS    +  +A   A   + ++  S   ++ +  + +KS+  ++G E K    L T  ++     L+ +N+++ SG  P LF  +E   +LS     A++  M   K S        + + F ++   +LHI+L + P  D +      +PG+++   ++W        L A A  F+ ++       +   ++ + + +++  +H+                                     S+  YSQ FL +KLR  N        Y  P  +  F+    +LL +KT       + +   L+ +K+    +  +N  ++ QK+   E S   + LL+ +
Sbjct:  588 KSSQFWKYVMDEFKIEVLVIEKEAKHFIDESF-KTLRSAEAAFDMLLKFKHIRSREAVNRQMMMKFNDILAQYCKEIDIINKIFVQNLENPPLYKNHPP-------VAGAIYWERSLFFRIKHTILRFQEVQEILDSDRGQEVKQKYLEVGRTMKEYEDRKYEQWMEVTEQVLPALMKKSLLTKSSIATEEPSTLERGAVFAINFSPALREIINETKYLEQLGFTVPELARNVALQEDKFLRYTAGIQRMLDHYHMLIGTLNDAESVLLKDHSQELLRVFRSGYKRLNWNSLGIGDYITGCKQAIGKFESLVHQIHKNADDISSRLTLIEAINLFKYPAAKSEEELPGVKEFFEHIERERASDVDHMVRWYLA-------IGPLLTKVEGLVVHTNTGKAPKL--ASYYKYWEKKIYEVLTKLILKNLQSFNSLILGNVPLFHTETILTAPEIILHPNTNEIDKMC------FHCVRNCVEI-------TKHFVRWMNGSCIECPPQKGEEE-----EVV------IINFYNDIS------LNPQI-------IEQAVMIPQNVHRILINLMKYLQKWKRYRPLWKL-DKAIVMEKFAAKKPPCVAYDEKLQFYSKIAYEVMRHPLIKDEHCIRLQLRHLANTVQENAKSWVISLGKLLNESAKEELYNLHEEMEHLAKNLRKIPNTLEDLKFVLATIAEIRSKSLVMELRYRDVQERYRTMAMYNLFPPDAEKELVDKIESIWSNLFNDSVNVEHALGDIKRT-FTELTRGEIMNYRVQIEEFAKRFYSEGPGSVGDDLDKGVELLGVYERELARHEKSRQELANAEKLFDLPITMYPELLKVQKEMSGLRMIYELYEGLKVAKEEWSQTLWINLNVQILQEGIEGFLRALRKLPRPVRGLSVTYYLEAKMKAFKDSIPLLLDLKNEALRDRHWKELMEKTSVFFEM-TETFTLENMFAMELHKHTDVLNEIVTAAIKEVAIEKAVKEILDTWENMKFTVVKYCKGTQERGYILGSV---DEIIQSLDDNTFNLQSISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDNIDKVFKRIMGETLKDPVIKRCCEAPNRLSD---LQNVSEGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPL-CVQEHMIKMYDNIASLRFNDGDSGEKLVSAMISAEGEVMEFRKILRAEGRVEDWMTAVLNEMRRTNRLITKEAIFRYCEDRSRVDWMLLYQGMVVLAASQVWWTWEVEDVFHKAQKGEKQAMKNYGRKMHRQIDELVTRITMPLSKND------------RKKYNTVLIIDVHARDIVDSFIRGSILEAREFDWESQLRF---YWDREPDE-LNIRQCTGTFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYRAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALIHQLTTFQF-EGQEISLDSRMGIFITMN-PGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLEAKTLAKKMTVLYKLAREQLSKQYHYDFGLRALKSVLVMAGELKR-----------------GSSDL------------------------------------REDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRY------PDFNDAVEQVLEENGYAVLPIQVDKVVQMFETMLTRHTTMVVGPTRGGKSVVINTLCQAQTK----------------------------------LGLTTKLYILNPKAVS-VIELYGILDPTTRDWTDGVLSNIFREINKPTDKKERKYILFDGDVDALWVENMNSVMDDNRLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKYRPYWKKWVNQIPNKVEQYNLNSLFEKYVPYLMDVIVEGIVDGRQAEKLK--TIVPQTDLNMVTQLAKMLDALLEGEIEDLDLLECYFLEALYCSLGASLLEDGRMKFDEYIKRLASLSTVDTEGVWANPGELPGQLPTLYDFHFDNKRNQWVPWSKLV---PEYIHAPERKFINILVHTVDTTRTTWILEQMVKIKQPVIFVGESGTSKTATTQN-FLKNLSEETNIVLMVNFSSRTTSMDIQRNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPR---VDEYGTQQPIALLKLLLEKGYLYDRGKELNCKSIRDLGFIAAMGKAGGGRNEVDPRFISLFSVFNVPFPSEESLHLIYSSILKGHTSTFHESIVAV--SGKLTFCTLALYKNIVQDL--PPTPSKFHYIFNLRDLSRVFNGLVLTNPERFQTVAQMVRVWRNECLRVFHDRLISETDKQLVQQHIGSLVVEHFKDDVEV----VMRDPILFG-------------DFQMALHEGEPRIYEDIQDYEAAKALFQEILEEYNESNTK--MNLVLFDDALEHLTRVHR-IIRMDRGHALLVGVGGSGKQSLSRLAAFTASCEVFEILLSRGYSENSFREDLKSLYLKLGIENKAMIFLFTDAHVAEEGFLELINNMLTSGIVPALFSEEEKESILSQIGQEALKQGMGPAKES--------VWQYFVNKSANNLHIVLGMSPVGDTLRTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLGYN------PMIPAENIENVVKHVVLVHQ-------------------------------------SVDHYSQQFL-QKLRRSN--------YVTPKNYLDFINTYSKLLDEKTQCNIAQCKRLDGGLDKLKEATIQLDELNQKLAEQKIVLAEKSAACEALLEEI 3207          

HSP 2 Score: 128.257 bits (321), Expect = 5.151e-28
Identity = 269/1307 (20.58%), Postives = 521/1307 (39.86%), Query Frame = 3
Query: 11397 EFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERA-IFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSK-IEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSD--LHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRN-VKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESS-------ERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNES-KTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENH--WKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLS--LRATSPSSAILMKYLNNSYETNILFNQIHSSVKPRIIQSRVIDYSKEGLQLFYQQLQNQMSNIHEICLDSSLTTSNLTALNSVYIVIHL-----SSTEHISSIHK--RVMSYIDEMNSFQRSALLKSRDQNVVTYNLFFTLPQNHSGVSSSQMNKMTTVYLDYPSNLRDFLLHLFKIGFLSANSIPSMSLDLLPVIHNCSLLMSIMKSRSSYLSLGF--------QDSETIVKITNPSNLYEIVQRMCNWFESHSNISWNILRYFVSEIIYGSKVTSENDR--ITI---ASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAF-LNISPFLFESAEACHLSSNLLTKINSEKILIEKIDKVS-QTINEKSTISFQIDLTKVENELFEICKNLASKLPKS-TIESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNELG--NEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLL-AIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITS---SKWMLRGVFITIN 15179
            E   ++KE   L ++Y   I ++  ++ E + +  RL     L+  +     +W     +    R  +   CL+ +A+L+Y G   +E    F D  V     + ++      S+   +   L  ++EIS+  S  LP  E  + N       S    + L  D  ++A++W+ R     N  V S++D     +LE  +  G   +  D D +    D ++  V     + + + + F IL   + EV+   NFRL+L+T  +       +     ++++  ++  L ++ LS  +   +  ++ + + L++E  + K  L  LE+ +L +L+    N + +++  +T+ +      E++  L+  E       +  D Y   A R A +F + S M  V   Y      +L +F   ++ S       +RL N  I+D LT     +    + + +K +FS  ++I+I +    V   + ++              F+K N S + S  KKP  W+S++   ++ +L+     F D    +  D + N   W+  +D +S E   +    + N+I  +QKL ++R  R DR+ +A   ++  T+  K+   V P  I        ++P S I+      S     L      S                G +L +  +      +    L++++       L + ++++        S E I+  H   R+    D    F    L KS    VVT       P N       ++N M   Y              FKI     +  P  +    P+++  +   ++++ R  +  +G+         D +  ++I N        QR          I W  L+Y + E++YG +     DR  +TI     + DF   +      F   ++ Y  P  +     KF E  +A  L  +P +F      H ++ +     + + +   + ++  QT    S IS        ++ + ++ K + +K+PK   ++ +++RL   T     S  L++EL  ++ +   +   + + ++ +  E+G  NE+ D    V  SL    +P  W  +   P      S  +W+   L ++   + ++   + + +  WL     PES L A+ +          DRS  +  V        +D D + E    G +V GL+L G  +D   G L     K +   LP+  I        K +N+  +  P++  S  +    + +    +  T+   S W+L+GV +T+N
Sbjct: 3399 ELAAIQKELETLGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENIRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWE----FRDEMVNRIWQNDILEREIPLSQPFRLESLLTDDVEISRWGSQGLPPDELSVQNGILTTRAS---RFPLCIDPQQQALNWIKRKEEKNNLRVASFNDPDFLKQLEMSIKYGTPFLFRDVDEYI---DPVIDNVLEKNIK-VSQGRQFIIL--GDKEVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVDLVHTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFLEVFRLSLKKSLPDSILMKRLRN--IMDTLTFSIYNHGCTGLFERHKLLFSFNMTIKIEQAEGRVPQEELDF--------------FLKGNISLEKSKRKKPCAWLSDQGWEDIILLSEM---FSDNFGQLPDDVENNQTVWQEWYDLDSLEQFPV-PLGYDNNITPFQKLLILRCFRVDRVYRAVTDYVTVTMGEKY---VQPPMISFEAIFEQSTPHSPIVFILSPGSDPATDLMKLAERS-------------GFGGNRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHPDFRLWLTTDPTKGFPIGILQKS--LKVVTE------PPN-----GLKLN-MRATY--------------FKISHEMLDQCPHPAFK--PLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQR-------DPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTIYMDEYLGDFIFDTFQPFHFFRNKEVDYKIP--VGDEKEKFVEAIEALPLANTPEVF----GLHPNAEIGYYTQAARDMWAHLLELQPQTGESSSGIS-------RDDYIGQVAKEIENKMPKVFDLDQVRKRLG--TGLSPTSVVLLQELERFNKLVVRMTKSLAELQRALAGEVGMSNELDD----VARSLFIGHIPNIW--RRLAPDTLK--SLGNWMVYFLRRFS--QYMLWVTESEPSVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLFTQVTKF-----QDADEVNERAGQGCFVSGLYLEGADWDIEKGCLIKSKPKVLVVDLPILKIIPIEAHRLKLQNT--FRTPVYTTSMRRNAMGVGLVFEADLFTTRHISHWVLQGVCLTLN 4587          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 421.394 bits (1082), Expect = 1.035e-116
Identity = 557/2783 (20.01%), Postives = 1134/2783 (40.75%), Query Frame = 3
Query: 2286 VYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCV-AKLKNPLLVVDLV----------GNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAGMHSEFSKLLKYLATQKIYNFNHLLSKNW--DSNEFTEAINKDLLAKKSTVQRTLEACSNILKEITEIISIVEKLDPNSSLYESEDLIFGQMKEMYNKSLSQSLYRSIINNLVYL--AICSNCQKEHLELLTSRAE--YDPVTGINDNLCSSYGEEVFCINDIKPIYDSDHAESKTLIKFILLVKYEIPMIKFEPELDAIQSIIEQMGQDIMAFHNDVSDFSGRKLNLYIKLESDLFYEFSQIISLKYSESRLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSR----RGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCC-ISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEI-KSDKKSLSHLAKKFNTQI----SRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNR---NDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLEN-KRSIEVIALTKIFDK----ILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQML-VDNKEIGGELH----IQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSI------------CIFDYYVD-ESGEWDLWSSLLMDEGEYLSLQLTG--EVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFV-YSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETS---NDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLS-----AVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNHSLNEIDLYLSEEKDKDQLAQYLANLHKEVLKFTVTPSIVSGKSVKIGKIIMNDKKKEIYKYDSTSLAPYSQLFLREKLRNLNDNSIQKKIYNGPCTFHRFLYILRRLLHQKTIEKTQSTQTISRALNSIKQTKHDITTINNLISHQKVKFNEISIKSQQLLKTL 10439
            V   + W + L   I+  ++RFQ+++E+      + + ++Y +V + +  ++      W+   +  + A +K  LL    +          G    IN    L  IINET+ + ++   +   A  +   E +   + + +   ++++  +  ++      L ++H + +++ F++G   L+W ++ I  ++      IG  ES+++Q+     + S  L  +    ++ +    S+       EF E I ++  +    + R   A       I  +++ VE L  +++  ++  L      + + K + + L + I+ NL      I  N    H E + +  E    P T   D +C        C+ +   I       +K  ++++     E P  K E E      ++      I+ F+ND+S      LN  I        E + +I        + L   ++    +  LWK+    +  E+  AKK    +  EK+     +   + R P   +  C+ +  +     +      W    G+ L++ AK  L    +  E + + L++    LE L  +L  + +I    L ++  Y+ ++  Y  + ++ L    +E+  +  +   WS L   + +  + L + KR  F +    ++  + V++ +F   F  E P   G D  +    L  +  + + +E+ +  L    KLF L +  + EL  +++++  L  +Y LY+     ++ ++  LW  +++  +   +  F      LP  ++       L+ K+        +L +L ++ +R+RHW ++M+ T   F++   TF   ++  + L ++   ++ I   A KE+ +E  + +I + W         + +    RG ++  V   + ++Q L+D+   L ++  SR + P      +W   L  I EV+++W+ VQ+ W+ LE++FI   I   L +E K+F+ +DK + + M    +   + +CC   N  S    L+N+ +GLE C  SL  YL  KRN F R +F+ D  +LSIL  S+ +  +  H+  ++  +  L  +        +  + S+  E +     +  +  V +W+  + NE+  +   ++ +AI       S  +    +   +  +A  + W+ E+     +  K +K+++ +  +K + QI    +RI + L++N             R++  ++ +  ++ RD + +     I +  +F+    ++      D   ++   +   T T   GYE+ G    +  TP T++  LTL  +L      +  G + +GK+   ++LA+      V  +C   M   ++     G+A  G WG  D    +D S LS+    I  I++A+  +  T    E + I L      F T   P  +    LP ++   FR V +  PDL QI +       +  ++TLA ++  + K A   +++       LR++ + L  A   K+                 G S L                                     E  +++ A+ ++ LP    E+      ++ D F G      +       PD  +A+ +  +    ++    ++K VQ++  +      ++ GPT  GKS  ++    A                                     L  +  +Y + P +     E++G       D+ DG+ + ++R +N+        +I+FDG +   W +N+ S++DD   L L +G R+    +   +FE+  ++ ASP  VSR G+VY     + +R     W+      +E   L  +F+K    ++D +++ I+   +   +   TI  Q  L +++Q+  + +  + GE+     ++  F+     SL + + +  +      +KR   +   D   +             ++D++ D +  +W  WS L+    EY+         +LV T+ T R  + L+   +    V  +G  G+ K+    N + K+     NI   V +S  T S  ++  LEAN+E R    YG    K L + ++D+N+P+   +D    ++P  +L+ LL    + +         + D   I ++       + +DPR +  F    +  P    L  I   + + H  +     + +  + +L   T  LY+ +   L    T  + H  FNLR ++ +  G+   N +   +   +++ W     RVF D LI +TD +     + +++   +  ++        R+ I F              + +   H   P+I   + D  + +      +  + E   K  +NL+  D+ L  +  +HR I +   GH +L+G  GS    +  +A   A   + ++  S   ++ +  + +KS+  ++G E K    L T  ++     L+ +N+++ SG  P LF  +E   +LS     A++  M   K S        + + F ++   +LHI+L + P  D +      +PG+++   ++W        L A A  F+ ++       +   ++ + + +++  +H+                                     S+  YSQ FL +KLR  N        Y  P  +  F+    +LL +KT       + +   L+ +K+    +  +N  ++ QK+   E S   + LL+ +
Sbjct:  568 VAGAIYWERSLFFRIKHTILRFQEVQEILDSDRGQEVKQKYLEVGRTMKEYEDRKYEQWMEVTEQVLPALMKKSLLTKSSIATEEPSTLERGAVFAINFSPALREIINETKYLEQLGFTVPELARNVALQEDKFLRYTAGIQRMLDHYHMLIGTLNDAESVLLKDHSQELLRVFRSGYKRLNWNSLGIGDYITGCKQAIGKFESLVHQIHKNADDISSRLTLIEAINLFKYPAAKSEEELPGVKEFFEHIERERASDVDHMVRWYLA-------IGPLLTKVEGLVVHTNTGKAPKL--ASYYKYWEKKIYEVLTKLILKNLQSFNSLILGNVPLFHTETILTAPEIILHPNTNEIDKMC------FHCVRNCVEI-------TKHFVRWMNGSCIECPPQKGEEE-----EVV------IINFYNDIS------LNPQI-------IEQAVMIPQNVHRILINLMKYLQKWKRYRPLWKL-DKAIVMEKFAAKKPPCVAYDEKLQFYSKIAYEVMRHPLIKDEHCIRLQLRHLANTVQENAKSWVISLGKLLNESAKEELYNLHEEMEHLAKNLRKIPNTLEDLKFVLATIAEIRSKSLVMELRYRDVQERYRTMAMYNLFPPDAEKELVDKIESIWSNLFNDSVNVEHALGDIKRT-FTELTRGEIMNYRVQIEEFAKRFYSEGPGSVGDDLDKGVELLGVYERELARHEKSRQELANAEKLFDLPITMYPELLKVQKEMSGLRMIYELYEGLKVAKEEWSQTLWINLNVQILQEGIEGFLRALRKLPRPVRGLSVTYYLEAKMKAFKDSIPLLLDLKNEALRDRHWKELMEKTSVFFEM-TETFTLENMFAMELHKHTDVLNEIVTAAIKEVAIEKAVKEILDTWENMKFTVVKYCKGTQERGYILGSV---DEIIQSLDDNTFNLQSISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDNIDKVFKRIMGETLKDPVIKRCCEAPNRLSD---LQNVSEGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPL-CVQEHMIKMYDNIASLRFNDGDSGEKLVSAMISAEGEVMEFRKILRAEGRVEDWMTAVLNEMRRTNRLITKEAIFRYCEDRSRVDWMLLYQGMVVLAASQVWWTWEVEDVFHKAQKGEKQAMKNYGRKMHRQIDELVTRITMPLSKND------------RKKYNTVLIIDVHARDIVDSFIRGSILEAREFDWESQLRF---YWDREPDE-LNIRQCTGTFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYRAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALIHQLTTFQF-EGQEISLDSRMGIFITMN-PGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLEAKTLAKKMTVLYKLAREQLSKQYHYDFGLRALKSVLVMAGELKR-----------------GSSDL------------------------------------REDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRY------PDFNDAVEQVLEENGYAVLPIQVDKVVQMFETMLTRHTTMVVGPTRGGKSVVINTLCQAQTK----------------------------------LGLTTKLYILNPKAVS-VIELYGILDPTTRDWTDGVLSNIFREINKPTDKKERKYILFDGDVDALWVENMNSVMDDNRLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKYRPYWKKWVNQIPNKVEQYNLNSLFEKYVPYLMDVIVEGIVDGRQAEKLK--TIVPQTDLNMVTQLAKMLDALLEGEIEDLDLLECYFLEALYCSLGASLLEDGRMKFDEYIKRLASLSTVDTEGVWANPGELPGQLPTLYDFHFDNKRNQWVPWSKLV---PEYIHAPERKFINILVHTVDTTRTTWILEQMVKIKQPVIFVGESGTSKTATTQN-FLKNLSEETNIVLMVNFSSRTTSMDIQRNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPR---VDEYGTQQPIALLKLLLEKGYLYDRGKELNCKSIRDLGFIAAMGKAGGGRNEVDPRFISLFSVFNVPFPSEESLHLIYSSILKGHTSTFHESIVAV--SGKLTFCTLALYKNIVQDL--PPTPSKFHYIFNLRDLSRVFNGLVLTNPERFQTVAQMVRVWRNECLRVFHDRLISETDKQLVQQHIGSLVVEHFKDDVEV----VMRDPILFG-------------DFQMALHEGEPRIYEDIQDYEAAKALFQEILEEYNESNTK--MNLVLFDDALEHLTRVHR-IIRMDRGHALLVGVGGSGKQSLSRLAAFTASCEVFEILLSRGYSENSFREDLKSLYLKLGIENKAMIFLFTDAHVAEEGFLELINNMLTSGIVPALFSEEEKESILSQIGQEALKQGMGPAKES--------VWQYFVNKSANNLHIVLGMSPVGDTLRTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLGYN------PMIPAENIENVVKHVVLVHQ-------------------------------------SVDHYSQQFL-QKLRRSN--------YVTPKNYLDFINTYSKLLDEKTQCNIAQCKRLDGGLDKLKEATIQLDELNQKLAEQKIVLAEKSAACEALLEEI 3089          

HSP 2 Score: 128.642 bits (322), Expect = 3.671e-28
Identity = 269/1307 (20.58%), Postives = 521/1307 (39.86%), Query Frame = 3
Query: 11397 EFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERA-IFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSK-IEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSD--LHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRN-VKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESS-------ERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNES-KTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENH--WKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLS--LRATSPSSAILMKYLNNSYETNILFNQIHSSVKPRIIQSRVIDYSKEGLQLFYQQLQNQMSNIHEICLDSSLTTSNLTALNSVYIVIHL-----SSTEHISSIHK--RVMSYIDEMNSFQRSALLKSRDQNVVTYNLFFTLPQNHSGVSSSQMNKMTTVYLDYPSNLRDFLLHLFKIGFLSANSIPSMSLDLLPVIHNCSLLMSIMKSRSSYLSLGF--------QDSETIVKITNPSNLYEIVQRMCNWFESHSNISWNILRYFVSEIIYGSKVTSENDR--ITI---ASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAF-LNISPFLFESAEACHLSSNLLTKINSEKILIEKIDKVS-QTINEKSTISFQIDLTKVENELFEICKNLASKLPKS-TIESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNELG--NEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLL-AIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITS---SKWMLRGVFITIN 15179
            E   ++KE   L ++Y   I ++  ++ E + +  RL     L+  +     +W     +    R  +   CL+ +A+L+Y G   +E    F D  V     + ++      S+   +   L  ++EIS+  S  LP  E  + N       S    + L  D  ++A++W+ R     N  V S++D     +LE  +  G   +  D D +    D ++  V     + + + + F IL   + EV+   NFRL+L+T  +       +     ++++  ++  L ++ LS  +   +  ++ + + L++E  + K  L  LE+ +L +L+    N + +++  +T+ +      E++  L+  E       +  D Y   A R A +F + S M  V   Y      +L +F   ++ S       +RL N  I+D LT     +    + + +K +FS  ++I+I +    V   + ++              F+K N S + S  KKP  W+S++   ++ +L+     F D    +  D + N   W+  +D +S E   +    + N+I  +QKL ++R  R DR+ +A   ++  T+  K+   V P  I        ++P S I+      S     L      S                G +L +  +      +    L++++       L + ++++        S E I+  H   R+    D    F    L KS    VVT       P N       ++N M   Y              FKI     +  P  +    P+++  +   ++++ R  +  +G+         D +  ++I N        QR          I W  L+Y + E++YG +     DR  +TI     + DF   +      F   ++ Y  P  +     KF E  +A  L  +P +F      H ++ +     + + +   + ++  QT    S IS        ++ + ++ K + +K+PK   ++ +++RL   T     S  L++EL  ++ +   +   + + ++ +  E+G  NE+ D    V  SL    +P  W  +   P      S  +W+   L ++   + ++   + + +  WL     PES L A+ +          DRS  +  V        +D D + E    G +V GL+L G  +D   G L     K +   LP+  I        K +N+  +  P++  S  +    + +    +  T+   S W+L+GV +T+N
Sbjct: 3281 ELAAIQKELETLGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENIRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWE----FRDEMVNRIWQNDILEREIPLSQPFRLESLLTDDVEISRWGSQGLPPDELSVQNGILTTRAS---RFPLCIDPQQQALNWIKRKEEKNNLRVASFNDPDFLKQLEMSIKYGTPFLFRDVDEYI---DPVIDNVLEKNIK-VSQGRQFIIL--GDKEVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVDLVHTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFLEVFRLSLKKSLPDSILMKRLRN--IMDTLTFSIYNHGCTGLFERHKLLFSFNMTIKIEQAEGRVPQEELDF--------------FLKGNISLEKSKRKKPCAWLSDQGWEDIILLSEM---FSDNFGQLPDDVENNQTVWQEWYDLDSLEQFPV-PLGYDNNITPFQKLLILRCFRVDRVYRAVTDYVTVTMGEKY---VQPPMISFEAIFEQSTPHSPIVFILSPGSDPATDLMKLAERS-------------GFGGNRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHPDFRLWLTTDPTKGFPIGILQKS--LKVVTE------PPN-----GLKLN-MRATY--------------FKISHEMLDQCPHPAFK--PLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQR-------DPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTIYMDEYLGDFIFDTFQPFHFFRNKEVDYKIP--VGDEKEKFVEAIEALPLANTPEVF----GLHPNAEIGYYTQAARDMWAHLLELQPQTGESSSGIS-------RDDYIGQVAKEIENKMPKVFDLDQVRKRLG--TGLSPTSVVLLQELERFNKLVVRMTKSLAELQRALAGEVGMSNELDD----VARSLFIGHIPNIW--RRLAPDTLK--SLGNWMVYFLRRFS--QYMLWVTESEPSVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLFTQVTKF-----QDADEVNERAGQGCFVSGLYLEGADWDIEKGCLIKSKPKVLVVDLPILKIIPIEAHRLKLQNT--FRTPVYTTSMRRNAMGVGLVFEADLFTTRHISHWVLQGVCLTLN 4469          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 358.992 bits (920), Expect = 2.383e-98
Identity = 427/1960 (21.79%), Postives = 823/1960 (41.99%), Query Frame = 3
Query: 4524 DKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLT-----TIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTE---QVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPI-IMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVN-WLNLLTXXXXXXXXXXXXDAIKYIS-------TGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIK----------MKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKS-ATVSIVEKEGIHLQVGTNF-FFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQG--YSDSHSKNIKETIPPDLLNAIIKEAKL----RRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNRN-----DLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYF------------------------------------PSNMIGWREIKPLWLENKRSIEV-----IALTKIF--DKILDPVIQYIIQ--------NHKELSINSVTIAFQNSLKVLSQ---MLVDNKEIGG-ELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQ---GLMYGGKE-HKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSN-VIQNSKYPFEQMKLSDFNIIVSLATNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSES-SEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQN-IRTTAHLSAPKIAVAMNDINSKREYLVSQI-NLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVALID---SMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFD-LIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKD-SEDSYLMADANYFVNHSLNEID------------LYLSEEKDKDQLAQYLANLHKEVLKF 10043
            +K W  V    +   L E  ++   LP K +  +SY  +K  +    K++ ++  L S+ ++ RHW Q+M+    N+ L       SDLT        +L ++  I +I   A+ EM LE  L ++ E W     +++ +Q+ +R       ++  + L  +L++ Q  L  M  S + +  ++ A  W  KL +I+ + D+W++VQ+ W+ LE +F     I   L  E  RF  +    +  M++V  +  +    + N    +  L+ +   L     +L  YL ++R+ F R +FV D  +L I+  S DI  I  HL  +F  +  +  +    E   I    S   E++ L   ++ KD  +N WL  L  E++ +++   + ++ + S       T D   E   KFP+Q+      + W +E+   +++ K  +     + K          + L  +S      PI   +R+++ ++   +++ RD+   L + KIR  +DF   + ++          ++  V+    +Q F           G+E+ G    +  TP T++  LT+  +L  +   S  G + +GK+  ++ L     R+ +  +C      +++   + G+   G WG  D    ++   LS     I  I++A++     +V +V   G  L V +N   F +  P  S    LP N+ + FR +A+T PD   I +       +R + TLA ++  +       +++       LR++   L  A   K+  +  +K GS                                         +L   A  E  ++++++ E ++P +  E+   +  +L D F G  Y+ +  + +++      L+ +  E  L     +  + S  ++K +QLY +   + GL+L G + SGK+ +  + L AL                 WE  E  +                H+     MS   +  ++G       ++ DGLFT + R++  N     D   WI+FDG + PEW +NL S+LDD   L LP+G RL    NV+ +FE+  +K A+   VSR G+V+F                                    P N+IG  + KP      RSIE+     +AL   F  D I+   ++Y +           + L  +  ++   +  K++S    ++ D+ EI   +  + R  +   +W+ +      +++ ++  +++ T +    +   C+ DY V  SG+W  W S +             +++V TI T+R +  L         + L GP GSGK++ L    R      M +    +S  T    L    +   E+R+   G++    +  + L +  +++NLP P   D    +R    LRQL+  N   + S + +  ++   F    +  T+     +  R +RH   + ++ P  + LQ I  G F   +  ++        A QL +A   +Y    +  +  + + + H  ++ R +     GI       ES S   L++ W++ + R+FQD L+ + + +W +  +               +   ER F       ++ R  + L+  +  +  LS   + V   ++   ++Y+ +++   ++E+     + L+  D +L  ++ I R I +   GH++LIG+ G+  + +      +  + + +L+  +     D    M+++LR+ G   +K   ++   N+  +  L+ LN+L+ +G+ P LF  DE   L++ ++   +R+     IL + D L + F  ++ R+LH++  + P    + E  +  P + +   +NW  D SE++     +       L+  D            L  S+   +D +   L  +HK V KF
Sbjct:  383 EKTWLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWNL-------SDLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNKTRL------IKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILD--VVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDIN---EEDRSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENVEQAVVKT---------LELLADSVLKEQPPI---RRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFF----------YGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLV---GKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKL--DKMGS----------------------------------------AALEDVA--EQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQ-----LSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALER---------------WENVEGVA----------------HVIDAKAMS---KDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIG-EDAKP-----TRSIEIQRTAALALQTHFSPDGIVPGSLKYAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLIDDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATTISLPPNQQACLIDYEVQLSGDWQPWLSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQ--EMEVVNVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAP---DKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIY-GTFNRAM--LKMTPAVRGLADQLTNAMVDVY---LASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLV---------------DTTAERYF------GNACRLDEALKRPLLYSCWLSRNYVPVTREEL---QDYVSARLKGFYEEEL---DVKLVLFDQMLDHVLRIDR-IYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQ---GLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKF 2168          

HSP 2 Score: 68.9366 bits (167), Expect = 1.352e-10
Identity = 135/646 (20.90%), Postives = 288/646 (44.58%), Query Frame = 3
Query: 11439 EYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDER-AIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSD--LHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLE-NNHEVECHPNFRLFLHTCSSTSEI-PDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSID----NYHQIAVRFATIFQMASRMTNVQ--KDYSVDFEKYLNLFDSMIESSE-----------RLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVA-------LKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAAC--LPCFKDILENMYKDSKE-NHWKMLFDSESPEASNIMERLFKNSIDAYQKLCL-------IRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLSL--RATSPSSAILM 13253
            EY  LIG    ++ +L ++ E+++ +  L+ +++   ++W + S  +  +  ++    L+SSA+LAY G  +   R +          ++GL   R   ++IE   +L +  +  + +  +LP  +   +NA  +        + LI D + +A+ ++ +     N    S+ D      LES L  G  +++ D +    A D I+  V   + +    +   ++L+   + +++  P+F++F+ T  ST E  PD+ + +TF V+F  +   L ++ L++ +   +P +D +   LL+ + +   +L  LE+ +L  L+    +   I + N++I+ L+  +   A + QK          +D     Y +++   + I+    ++  +     YS+DF   + +F  ++++ E           R+   S+   + ++ S+     M   +K + +LLL + IH  +N            PS+ A       L    DF+ +N+   S      D+++ E   N K +A    +  F+++  ++  +S     W     +++PE SN+   ++ ++      LC+       +  LRPDR+M +++  +    +  F       DI LS+     SPS  +L+
Sbjct: 2461 EYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGL-HFRHDLARIE---YLSTVDDRLQWQLNSLPVDDLCTENAIMLHR---FNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDVE----AYDPILNPVLNREVK----RAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTF-VNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNE---SKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDF--LVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSR----GMLHTDKVLLALLL-MRIHIRSN------------PSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVE---NKKSIAKARKVVGFENVFAHLQHNSAAVTSW---LTNDNPE-SNV-PVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDI-LSIVDNEVSPSEPVLL 3059          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 357.451 bits (916), Expect = 8.584e-98
Identity = 427/1960 (21.79%), Postives = 823/1960 (41.99%), Query Frame = 3
Query: 4524 DKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLT-----TIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTE---QVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPI-IMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVN-WLNLLTXXXXXXXXXXXXDAIKYIS-------TGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIK----------MKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKS-ATVSIVEKEGIHLQVGTNF-FFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQG--YSDSHSKNIKETIPPDLLNAIIKEAKL----RRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNRN-----DLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYF------------------------------------PSNMIGWREIKPLWLENKRSIEV-----IALTKIF--DKILDPVIQYIIQ--------NHKELSINSVTIAFQNSLKVLSQ---MLVDNKEIGG-ELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQ---GLMYGGKE-HKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSN-VIQNSKYPFEQMKLSDFNIIVSLATNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSES-SEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQN-IRTTAHLSAPKIAVAMNDINSKREYLVSQI-NLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVALID---SMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFD-LIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKD-SEDSYLMADANYFVNHSLNEID------------LYLSEEKDKDQLAQYLANLHKEVLKF 10043
            +K W  V    +   L E  ++   LP K +  +SY  +K  +    K++ ++  L S+ ++ RHW Q+M+    N+ L       SDLT        +L ++  I +I   A+ EM LE  L ++ E W     +++ +Q+ +R       ++  + L  +L++ Q  L  M  S + +  ++ A  W  KL +I+ + D+W++VQ+ W+ LE +F     I   L  E  RF  +    +  M++V  +  +    + N    +  L+ +   L     +L  YL ++R+ F R +FV D  +L I+  S DI  I  HL  +F  +  +  +    E   I    S   E++ L   ++ KD  +N WL  L  E++ +++   + ++ + S       T D   E   KFP+Q+      + W +E+   +++ K  +     + K          + L  +S      PI   +R+++ ++   +++ RD+   L + KIR  +DF   + ++          ++  V+    +Q F           G+E+ G    +  TP T++  LT+  +L  +   S  G + +GK+  ++ L     R+ +  +C      +++   + G+   G WG  D    ++   LS     I  I++A++     +V +V   G  L V +N   F +  P  S    LP N+ + FR +A+T PD   I +       +R + TLA ++  +       +++       LR++   L  A   K+  +  +K GS                                         +L   A  E  ++++++ E ++P +  E+   +  +L D F G  Y+ +  + +++      L+ +  E  L     +  + S  ++K +QLY +   + GL+L G + SGK+ +  + L AL                 WE  E  +                H+     MS   +  ++G       ++ DGLFT + R++  N     D   WI+FDG + PEW +NL S+LDD   L LP+G RL    NV+ +FE+  +K A+   VSR G+V+F                                    P N+IG  + KP      RSIE+     +AL   F  D I+   ++Y +           + L  +  ++   +  K++S    ++ D+ EI   +  + R  +   +W+ +      +++ ++  +++ T +    +   C+ DY V  SG+W  W S +             +++V TI T+R +  L         + L GP GSGK++ L    R      M +    +S  T    L    +   E+R+   G++    +  + L +  +++NLP P   D    +R    LRQL+  N   + S + +  ++   F    +  T+     +  R +RH   + ++ P  + LQ I  G F   +  ++        A QL +A   +Y    +  +  + + + H  ++ R +     GI       ES S   L++ W++ + R+FQD L+ + + +W +  +               +   ER F       ++ R  + L+  +  +  LS   + V   ++   ++Y+ +++   ++E+     + L+  D +L  ++ I R I +   GH++LIG+ G+  + +      +  + + +L+  +     D    M+++LR+ G   +K   ++   N+  +  L+ LN+L+ +G+ P LF  DE   L++ ++   +R+     IL + D L + F  ++ R+LH++  + P    + E  +  P + +   +NW  D SE++     +       L+  D            L  S+   +D +   L  +HK V KF
Sbjct: 1315 EKTWLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWNL-------SDLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNKTRL------IKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILD--VVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDIN---EEDRSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENVEQAVVKT---------LELLADSVLKEQPPI---RRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFF----------YGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLV---GKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKL--DKMGS----------------------------------------AALEDVA--EQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQ-----LSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALER---------------WENVEGVA----------------HVIDAKAMS---KDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIG-EDAKP-----TRSIEIQRTAALALQTHFSPDGIVPGSLKYAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLIDDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATTISLPPNQQACLIDYEVQLSGDWQPWLSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQ--EMEVVNVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAP---DKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIY-GTFNRAM--LKMTPAVRGLADQLTNAMVDVY---LASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLV---------------DTTAERYF------GNACRLDEALKRPLLYSCWLSRNYVPVTREEL---QDYVSARLKGFYEEEL---DVKLVLFDQMLDHVLRIDR-IYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQ---GLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKF 3100          

HSP 2 Score: 68.9366 bits (167), Expect = 1.422e-10
Identity = 135/646 (20.90%), Postives = 288/646 (44.58%), Query Frame = 3
Query: 11439 EYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDER-AIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSD--LHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLE-NNHEVECHPNFRLFLHTCSSTSEI-PDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSID----NYHQIAVRFATIFQMASRMTNVQ--KDYSVDFEKYLNLFDSMIESSE-----------RLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVA-------LKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAAC--LPCFKDILENMYKDSKE-NHWKMLFDSESPEASNIMERLFKNSIDAYQKLCL-------IRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLSL--RATSPSSAILM 13253
            EY  LIG    ++ +L ++ E+++ +  L+ +++   ++W + S  +  +  ++    L+SSA+LAY G  +   R +          ++GL   R   ++IE   +L +  +  + +  +LP  +   +NA  +        + LI D + +A+ ++ +     N    S+ D      LES L  G  +++ D +    A D I+  V   + +    +   ++L+   + +++  P+F++F+ T  ST E  PD+ + +TF V+F  +   L ++ L++ +   +P +D +   LL+ + +   +L  LE+ +L  L+    +   I + N++I+ L+  +   A + QK          +D     Y +++   + I+    ++  +     YS+DF   + +F  ++++ E           R+   S+   + ++ S+     M   +K + +LLL + IH  +N            PS+ A       L    DF+ +N+   S      D+++ E   N K +A    +  F+++  ++  +S     W     +++PE SN+   ++ ++      LC+       +  LRPDR+M +++  +    +  F       DI LS+     SPS  +L+
Sbjct: 3393 EYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGL-HFRHDLARIE---YLSTVDDRLQWQLNSLPVDDLCTENAIML---HRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDVE----AYDPILNPVLNREVK----RAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTF-VNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNE---SKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDF--LVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSR----GMLHTDKVLLALLL-MRIHIRSN------------PSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVE---NKKSIAKARKVVGFENVFAHLQHNSAAVTSW---LTNDNPE-SNV-PVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDI-LSIVDNEVSPSEPVLL 3991          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 357.451 bits (916), Expect = 8.584e-98
Identity = 427/1960 (21.79%), Postives = 823/1960 (41.99%), Query Frame = 3
Query: 4524 DKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLT-----TIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTE---QVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPI-IMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVN-WLNLLTXXXXXXXXXXXXDAIKYIS-------TGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIK----------MKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKS-ATVSIVEKEGIHLQVGTNF-FFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQG--YSDSHSKNIKETIPPDLLNAIIKEAKL----RRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNRN-----DLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYF------------------------------------PSNMIGWREIKPLWLENKRSIEV-----IALTKIF--DKILDPVIQYIIQ--------NHKELSINSVTIAFQNSLKVLSQ---MLVDNKEIGG-ELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQ---GLMYGGKE-HKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSN-VIQNSKYPFEQMKLSDFNIIVSLATNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSES-SEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQN-IRTTAHLSAPKIAVAMNDINSKREYLVSQI-NLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVALID---SMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFD-LIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKD-SEDSYLMADANYFVNHSLNEID------------LYLSEEKDKDQLAQYLANLHKEVLKF 10043
            +K W  V    +   L E  ++   LP K +  +SY  +K  +    K++ ++  L S+ ++ RHW Q+M+    N+ L       SDLT        +L ++  I +I   A+ EM LE  L ++ E W     +++ +Q+ +R       ++  + L  +L++ Q  L  M  S + +  ++ A  W  KL +I+ + D+W++VQ+ W+ LE +F     I   L  E  RF  +    +  M++V  +  +    + N    +  L+ +   L     +L  YL ++R+ F R +FV D  +L I+  S DI  I  HL  +F  +  +  +    E   I    S   E++ L   ++ KD  +N WL  L  E++ +++   + ++ + S       T D   E   KFP+Q+      + W +E+   +++ K  +     + K          + L  +S      PI   +R+++ ++   +++ RD+   L + KIR  +DF   + ++          ++  V+    +Q F           G+E+ G    +  TP T++  LT+  +L  +   S  G + +GK+  ++ L     R+ +  +C      +++   + G+   G WG  D    ++   LS     I  I++A++     +V +V   G  L V +N   F +  P  S    LP N+ + FR +A+T PD   I +       +R + TLA ++  +       +++       LR++   L  A   K+  +  +K GS                                         +L   A  E  ++++++ E ++P +  E+   +  +L D F G  Y+ +  + +++      L+ +  E  L     +  + S  ++K +QLY +   + GL+L G + SGK+ +  + L AL                 WE  E  +                H+     MS   +  ++G       ++ DGLFT + R++  N     D   WI+FDG + PEW +NL S+LDD   L LP+G RL    NV+ +FE+  +K A+   VSR G+V+F                                    P N+IG  + KP      RSIE+     +AL   F  D I+   ++Y +           + L  +  ++   +  K++S    ++ D+ EI   +  + R  +   +W+ +      +++ ++  +++ T +    +   C+ DY V  SG+W  W S +             +++V TI T+R +  L         + L GP GSGK++ L    R      M +    +S  T    L    +   E+R+   G++    +  + L +  +++NLP P   D    +R    LRQL+  N   + S + +  ++   F    +  T+     +  R +RH   + ++ P  + LQ I  G F   +  ++        A QL +A   +Y    +  +  + + + H  ++ R +     GI       ES S   L++ W++ + R+FQD L+ + + +W +  +               +   ER F       ++ R  + L+  +  +  LS   + V   ++   ++Y+ +++   ++E+     + L+  D +L  ++ I R I +   GH++LIG+ G+  + +      +  + + +L+  +     D    M+++LR+ G   +K   ++   N+  +  L+ LN+L+ +G+ P LF  DE   L++ ++   +R+     IL + D L + F  ++ R+LH++  + P    + E  +  P + +   +NW  D SE++     +       L+  D            L  S+   +D +   L  +HK V KF
Sbjct: 1315 EKTWLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWNL-------SDLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNKTRL------IKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILD--VVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDIN---EEDRSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENVEQAVVKT---------LELLADSVLKEQPPI---RRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFF----------YGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLV---GKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKL--DKMGS----------------------------------------AALEDVA--EQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQ-----LSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALER---------------WENVEGVA----------------HVIDAKAMS---KDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIG-EDAKP-----TRSIEIQRTAALALQTHFSPDGIVPGSLKYAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLIDDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATTISLPPNQQACLIDYEVQLSGDWQPWLSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQ--EMEVVNVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAP---DKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIY-GTFNRAM--LKMTPAVRGLADQLTNAMVDVY---LASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLV---------------DTTAERYF------GNACRLDEALKRPLLYSCWLSRNYVPVTREEL---QDYVSARLKGFYEEEL---DVKLVLFDQMLDHVLRIDR-IYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQ---GLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKF 3100          

HSP 2 Score: 68.9366 bits (167), Expect = 1.422e-10
Identity = 135/646 (20.90%), Postives = 288/646 (44.58%), Query Frame = 3
Query: 11439 EYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDER-AIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSD--LHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLE-NNHEVECHPNFRLFLHTCSSTSEI-PDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSID----NYHQIAVRFATIFQMASRMTNVQ--KDYSVDFEKYLNLFDSMIESSE-----------RLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVA-------LKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAAC--LPCFKDILENMYKDSKE-NHWKMLFDSESPEASNIMERLFKNSIDAYQKLCL-------IRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLSL--RATSPSSAILM 13253
            EY  LIG    ++ +L ++ E+++ +  L+ +++   ++W + S  +  +  ++    L+SSA+LAY G  +   R +          ++GL   R   ++IE   +L +  +  + +  +LP  +   +NA  +        + LI D + +A+ ++ +     N    S+ D      LES L  G  +++ D +    A D I+  V   + +    +   ++L+   + +++  P+F++F+ T  ST E  PD+ + +TF V+F  +   L ++ L++ +   +P +D +   LL+ + +   +L  LE+ +L  L+    +   I + N++I+ L+  +   A + QK          +D     Y +++   + I+    ++  +     YS+DF   + +F  ++++ E           R+   S+   + ++ S+     M   +K + +LLL + IH  +N            PS+ A       L    DF+ +N+   S      D+++ E   N K +A    +  F+++  ++  +S     W     +++PE SN+   ++ ++      LC+       +  LRPDR+M +++  +    +  F       DI LS+     SPS  +L+
Sbjct: 3393 EYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGL-HFRHDLARIE---YLSTVDDRLQWQLNSLPVDDLCTENAIML---HRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDVE----AYDPILNPVLNREVK----RAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTF-VNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNE---SKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDF--LVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSR----GMLHTDKVLLALLL-MRIHIRSN------------PSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVE---NKKSIAKARKVVGFENVFAHLQHNSAAVTSW---LTNDNPE-SNV-PVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDI-LSIVDNEVSPSEPVLL 3991          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 251.136 bits (640), Expect = 1.174e-65
Identity = 385/1781 (21.62%), Postives = 709/1781 (39.81%), Query Frame = 3
Query: 4650 IDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIP--LLENKKEIDRICYDARKEMELEMKLNQIE--EEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINT---AVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTN-FFFTSCLPLE---SFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNRNDLI-SWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSICIFDYYVDESGEW--DLWSSLLMDEGEYLSLQLTGEVLVDTITTLRAK----YFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANI---EHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQN-SKYPFEQMKLSDFNIIVSL--ATNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSI--ENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNC---ERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIA-----LQIAKIPIQKLETSNDVA--LIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAV 9884
            +++  ++ S L       +   HW ++ +  G          K +DL ++   ++EN  ++ ++   A+ E+ +   + ++      TE  L    HS  G  +  ++     +  L+DSQ LL ++ +S +     D+ A W  +L ++   L    E+Q+ W+ LE +F        L  E  RF R+D  Y   +  V +   +   C  +  S K  L+ I   L  C  +L  +L QKR  F R +F+ D  +L IL  S + + I  H+  +F  +N +           I  + SS  E + L+  + I  +V +WL  L++E+  ++ +L++ A+      D+   L+K +PSQ+   A  + +S  I       S++ S K  L    K +                   DD ++ L   +L+S+ L +++  D +  L   + + ++ +   + ++          N    L  ++   +  YE+QG+   +  TP T+K  LTL  ++      +  G + +GK+  ++ LA L  R  +  +C   +   S+     GI   G WG  D    +D + LS   + I  I+ AIK ++ + +     G ++QV  N   F +  P          +P N+ + FR V +  PD   I         +  +  LA ++ +V + +  ++++       LR++   L    A ++T                                         +   NET            +LVV+A++   L  +T  + +    ++ D F   +   +K  +E + P  L    +E  ++   +    MEK  QLY  +R   G+++ G   SGKST   I   +L         T   L V+               +P+ +N+               S++ GN      ++ DG+ T   R V ++  +  WIV DG I PEW + L S+LDD   L +P G R+    NV F+FE +S++ ASP  VSR G++Y     +  ++I   WL          +    ++     +++ +++HK   I S  I  +N L  L       +           F+          ++  N+Q     +  + + +PD  N IC +D  +D    +  D+  ++  +E E   L+      V T  T R       +L    R S    + G  G GK  +L  H  ++D  +  +A    S  + SS L   ++ N     +  G ++  K+  ++ L ++ +NLP P +  +      NE+L  L      Q    +  E + + +   + S+    + +A  +  RL      + +   + S L SI R      ++ +   N +I  ++   + +  Q  +    SV+            F+ R + +  + +     D    E ++     + +RR+F D L  + D   F   L+ +I       IS  N      E+ ++T  T      N+              P   + M+D N   + L   IN     F   + N   T  +      I R +T P  GH+ L G  G        +      +Q+   P+    T+N  A    + +K+ + Q  +  +   ++L    L+ ++ L  +NSL+ SG+ P LF   E+ GL++ V      + S T  L  F        RIR  +H++L L  + +    ++ + P IL +  V
Sbjct: 1148 VEHFKEVSSALKFCRGDVLSADHWHEMFRFLGLPRGTTIEKLKFADLLSVSKNIIENTDQLKQLNSRAQGEVAIRDAIQELTLWAAQTEFTLADYKHSN-GQNLKIIKEWKESINSLKDSQALLQSLKSSPYYSQFTDKTAVWETRLADLDVFLAQMNEIQRKWIYLEPIFGRGA----LPSEASRFSRVDSEYRAILNDVSKDARLVSLC--SRQSLKKSLEQIVDQLNRCQKALNQFLEQKRTAFPRFYFIGDDDLLEILGQSTNPQVIQTHMKKLFQGINRVQFSSTGE---TIISMVSSEGETVPLSKAVRIVPQVESWLQELSDEMRRTLKDLTAQAV-----ADAQPSLAK-YPSQVLCLAEEVKFSASIENNLNGSSDLNSFKSQLLEKLKAYTNM--------------KVDDKVSDL---KLKSLILDLIHHIDVVDQLLTNQAKSINSWTWQRQLRFYLV------NGGIVLRQVSSEFEYTYEYQGNYAKLVHTPLTDKCYLTLTQAMYMGLGGNPYGPAGTGKTESVKALAALMGRQVLVFNCDEGIDVTSMGRIFTGIVECGAWGCFDEFNRLDSTVLSAVSMQIQTIQGAIKSRAGSCTF---GGKNVQVNPNSAIFVTLNPAGKGYGGRQKMPDNLKQLFRAVVMGKPDNELISSTILYSEGFVDATALARKIVSVFQLSRQMLSKQQHYDWGLRALKVVLGGCGALRRT-----------------------------------------QTNKNET------------DLVVQALLLNTLSKLTFSDSERFNSLIDDIFSNVTKEMTK-FEELVEP--LGVAAQEMGIK---LGDKQMEKVFQLYEQMRQRIGVVVVGAAGSGKSTIWKILQRSL-------ILTKKPLKVT-------------QFNPKAVNR---------------SKLLGNMDMDTREWSDGIITMAAREVTKDTSVHHWIVCDGDIDPEWVEALNSVLDDNRLLTMPSGERIQFGSNVNFLFETDSLQFASPATVSRMGMIYISEEDVTPKDIVASWLVKTTEDLHADMPSWIEEHFWRCLKW-VRSHKISGITSFAI-LKNGLTHLKASKTKTQ-----------FLVLLFNGFLPTVTPENRQEFAKGVVFQGMSVPDPKN-IC-YDERIDGIMSYTDDVSQNVTKEEVEREDLR----PFVQTADTQRYSDIIGSWLQSGNRESF--LITGTTGCGKQQLL-KHCFQNDPES-QLASLYCSAQSSSSHLLQLIQQNCVQASNPTGRVWRPKDRPNMILFLKGINLPAPDKYGT------NELLALLQQLLTYQGFFDHNLEWVSIENIQFVGSMNPIGDGAAVSISNRLFSLLRCVSLNTTDSSQLTSIYRTYLTPILEEVGERNSEIIANRMVDIYNKVQSNFRPTDSVV----------FLFSPRDLTNWVVSLLRHELDQGKLEAVI----CFEARRIFADRLPTENDKLKFEEILRNVI------PISQANETVIFKEKVYVTTGTVVPGESNT------------GLPLTPINMSDFN---QLLAKSINRF--AFEIANFNCPLTSQLAFFCACIDRVLTGP-GGHLFLPGRPGFGRRDSVRLVAHMHNIQVFSPPV----TANFSAKQFDNELKNAITQAVTNNEHVVLILEDHQLRKNIFLQAINSLLASGNVPGLFTQQELDGLVALVS-EAANQASFTGALQQF-----LAHRIRSLVHVVLILEVEANDFKINITENPAILKHCNV 2715          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309029)

HSP 1 Score: 593.578 bits (1529), Expect = 4.488e-169
Identity = 551/2300 (23.96%), Postives = 1004/2300 (43.65%), Query Frame = 3
Query: 3381 ESKTLIK---FILLVKYEIPMIKFEPELDAIQSIIEQMGQDIMAFHNDVSDFSG----------------------------RKLNLYIKLESDLFYEFSQIISLKYSE--------------------SRLKLQSTVENLNEFDFLWK--MTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPK-EIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQ-------DVTELEQLNELLG-ILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGD-SLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNRNDLIS--WIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHK-ELSINSVTIAFQNSLKVLSQMLVDNKEIGGEL----------------------------HIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSI---CIFDYYVDESGEWDLWSSLL-------MDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQ-ASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITF--STEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGS---HLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNH 9947
            E++T+ K   F L  + +IP +  +P LD +Q I+   G++I      V+ +S                             R+  +Y  L S+   +   ++   YS                      + ++Q+ ++    + FLWK   T+ +L  E  L + +T       +  +  L  NL   P  E+   C+ +  +  +  L   +    +K GQ +  + K+ +D    Y   V+ E+ +       D+ ++  + E LG I +Q  D++L+ID    PIE  +  L  +E+ + R + + + NLR  +  L+  A   + KLL+  +  F  +L   +  F  + I +   +    P  AG  P E   +L  F+N++     +  T  +  +LFGL    + EL  ++++L LL +LY LY        ++ D  W+ VD++++  +L EF + C  LP  LKE  ++  LK  ID    +  +L  +A+K ++ RHW ++M VT   F+ ++  F   ++   PLL++K++I+ IC  A KE ++E KL Q+  EW+   L F S + RG ++L    T   + QLEDS ++L ++ ++R+  P + +  QW   L   +E+L+ WL VQ +W+ LE VF+   I K L +E KRF ++DKS+ K M+R +ET  V  CC+ ++  K+  L ++Q+ LE C  SL GYL +KR +F R +FV D  +L IL  ++D   I  HL +IF     +       E  ++  I SS  E I L+  I  +  V  WL  L    + S+ ++   A   I+  + +L    +K P+QI    + + W+ +   A+   + ++K +     KF   ++ +     RN        +T  +R    ++    ++ RD    L    I+  +DFE  K  + +    + +      +  +T T+    E+ G    +  TP T++  +TL  +L      +  G + +GK+  ++++ +   +Y V  +C   M    L     G+A +G WG  D    ++   LS+A   +  +  A K+K  T    + + I +      F T   P  +    LP N+  +FR VA+  PD   I++       +  + TLA + YT+ K     + +       LR+I++                      V +T G +                      ++ + +T          E  +V+  + ++ L  +  ++E     ++ D F       ++ +++T  P+L  AI+++            + K +QLY       G++  GP+ +GK+T +   + A+  + +N                                  H    + P +    ++MFG       D+ DG+F+ LWR+  +       W+V DG +   W +NL S+LDD  TL L +G RL  +  VK +FE +++ +ASP  VSR+G+VY  S+ +  R I   WL+N+   E    + +FD+    V  + +Q  K ++ +    I  Q  L +L  ++   KE    +                            H+ RL++F   W L   +S  ++Q +   +K     L     S     IFD++V  +G W  W +L+       +   +YLS      +LV  +  +R  Y +         V +IG +G+GK++I+ N  +K ++ +     F +S  T   Q +  +E+ +E R G+ +G    + L + I+D+NLP   EI+    +  NE++RQ ++     + + P +   + D   + ++       + +  RL R F      +P+   +  I R + E H ++       I     +LI  T+ L+++    L    T  + H  F+LR ++ I  G+        +SE +L+  W +   RVF D      D +WF + L  +++    G+  S  +     F+ F     E +    +D         +  PK+   ++     RE LV  +    E      ++L+   + +L ++ I R I  P  G ++L+G  GS    L+++ S         I    + N    ++ +K + R  G +GK +  L T  ++K    L+ LN+++ SG    LF  DE A ++  +   MKRE    T  T   +++ F +R   +LH+  C  P  +     + ++P ++S   ++WL       L++ A +F++H
Sbjct: 1058 ENETVFKKPVFALHAQLQIPHVVIKPNLDELQDILVTAGKNITGIAKGVAQWSSGKDPPQVSMTVQPRVGRNHNESTGGGKSRRRKIYC-LASEERPQMPHMLKSFYSAIMDNKEVAKAVNQLASCTKNVKPEIQTYIKRWKPYHFLWKNDRTTRQL-MEFGLQEFET------TLRCLSDLDANLLVEPDMEVFGQCVAVYNEKLKYGLAIEIKSCNHKIGQAMKKKYKKEMD----YVYAVINEMDRKLDRPIRDLDDVRMIMETLGKIREQEVDMELRID----PIEEAFNVLTRYEVQVEREQFDLVDNLRATFQNLLAGALQAQVKLLD-MQPAFQDDLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASDRLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQ-LLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDV--EYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRN--------LTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLK--QCRFYFKEDLDKTWISVTDVTFTYQ--NEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMN-PGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILS----------------------VLRTLGAAK---------------------RRNSKDT----------ESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFP------NQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDN----------------------------------HREMRMNPKAIT-AAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIV-QQMLFILEGLIPVKKEDEQAVSMSSKESHDEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFPQLDYPKGSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLS------ILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLP---EINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLL--PTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELACLVREEL-GDSHSQMILPNPVFVDFMRDAPEPTGEEGED-------TDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHP-RGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTA-TPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSH 3207          

HSP 2 Score: 101.293 bits (251), Expect = 3.222e-20
Identity = 127/609 (20.85%), Postives = 267/609 (43.84%), Query Frame = 3
Query: 11394 EEFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERAIFI-QCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWL----DRYLIHYNPVVISYSDLHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKM-YEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSERLSNKS-----IIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSNS--KKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKF 13181
            E+    ++  + ++ +Y+  +G++  +         ++     L+  +   + +W   SK+++ +    +   L+++ +L+YCGP N E R+  +   +   +   +       + + I   L     +S+     LP  E  + NA      S   ++ L+ D   +   W+    DR  +    +   Y   H  LE  L+ G+ ++I D  I     D ++  V    F  +K     K+L+  + E +  P F L++ T          +++ T ++ F  ++  L ++ L R I   K  ++ E   L     + +R + +LE  +L  LS+   ++   E    +++  K   EE+N  L+  E       K+ + +  +A R + ++ +   M+NV   Y    +++L +F+  I  S + S        I+  LT +  +++  S+ + +K +F+L+L+I+I     N+    +E+L             FIK   S   N+   KPF W+ + + +N+ +  + L  F  +L+ +  +  E  W+  ++ E PE   I    +   +D ++KL LIR+  PDR +  +  +I+ +L  ++
Sbjct: 3524 EQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFT----TGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSS---SYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTH--LEDSLSLGRPLLIEDVGIDL---DPVIDNVLEKNF--IKSGSIEKVLV-GDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNI--SHEEFLT------------FIKGGASLDLNAVTPKPFRWILDITWLNL-VEISKLETFSTVLQVI--ELNEKDWRCWYECEKPENEEI-PCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEY 4099          

HSP 3 Score: 97.8265 bits (242), Expect = 3.011e-19
Identity = 111/505 (21.98%), Postives = 208/505 (41.19%), Query Frame = 3
Query: 13683 YPSNLRDFLLHLFKIGFLSANSIPSMSLDLLPVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFESHSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSN--LLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTIESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYS---------LLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGV 15164
            Y S  +DFL       + SA   P       P+++  + L +I++ R  +  LG+       +    +++ + +Q   +  +    +SW  L Y + E+ YG +VT + D+  + + T  W     +   FEF K  Y  P        K  +    ++N  P  +++ E   L SN  +  +INS K +++ I  V            +      E+ ++++  ++  KLP       Q    +V  N     T M  L+  +    + ++ +Q+  K +   L +     D ++V S         +   ++PE W+ K+       G+    W + LL +       I  ++ KV  +W+  F  P+  L   ++EV+    R  +      V    + T  +K+ I E P++G+YVHGL L G   D+ +G+L +  +K +   +PV +I + +N     ++   Y CPI+          +     +       W LRGV
Sbjct: 4240 YQSFTQDFL------DYTSATQWP-------PLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASV-QFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYK-GYKVPGT------KSLQGFIDYINSLP-AYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETR------ESIVYQLADDMLRKLPA------QYNAYEVRENL----TRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWM-KISWESTTLGF----WYTELLERNGQFRTWISTDRPKV--FWMTGFFNPQGFLTAMRQEVT----RAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYI-YAINT-TAGKDPKLYECPIYRKPQRTDLKYVGSIDFETEFNPKHWTLRGV 4693          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309028)

HSP 1 Score: 591.652 bits (1524), Expect = 1.463e-168
Identity = 529/2168 (24.40%), Postives = 962/2168 (44.37%), Query Frame = 3
Query: 3624 KLQSTVENLNEFDFLWK--MTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPK-EIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQ-------DVTELEQLNELLG-ILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGD-SLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNRNDLIS--WIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHK-ELSINSVTIAFQNSLKVLSQMLVDNKEIGGEL----------------------------HIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSI---CIFDYYVDESGEWDLWSSLL-------MDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQ-ASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITF--STEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGS---HLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNH 9947
            ++Q+ ++    + FLWK   T+ +L  E  L + +T       +  +  L  NL   P  E+   C+ +  +  +  L   +    +K GQ +  + K+ +D    Y   V+ E+ +       D+ ++  + E LG I +Q  D++L+ID    PIE  +  L  +E+ + R + + + NLR  +  L+  A   + KLL+  +  F  +L   +  F  + I +   +    P  AG  P E   +L  F+N++     +  T  +  +LFGL    + EL  ++++L LL +LY LY        ++ D  W+ VD++++  +L EF + C  LP  LKE  ++  LK  ID    +  +L  +A+K ++ RHW ++M VT   F+ ++  F   ++   PLL++K++I+ IC  A KE ++E KL Q+  EW+   L F S + RG ++L    T   + QLEDS ++L ++ ++R+  P + +  QW   L   +E+L+ WL VQ +W+ LE VF+   I K L +E KRF ++DKS+ K M+R +ET  V  CC+ ++  K+  L ++Q+ LE C  SL GYL +KR +F R +FV D  +L IL  ++D   I  HL +IF     +       E  ++  I SS  E I L+  I  +  V  WL  L    + S+ ++   A   I+  + +L    +K P+QI    + + W+ +   A+   + ++K +     KF   ++ +     RN        +T  +R    ++    ++ RD    L    I+  +DFE  K  + +    + +      +  +T T+    E+ G    +  TP T++  +TL  +L      +  G + +GK+  ++++ +   +Y V  +C   M    L     G+A +G WG  D    ++   LS+A   +  +  A K+K  T    + + I +      F T   P  +    LP N+  +FR VA+  PD   I++       +  + TLA + YT+ K     + +       LR+I++                      V +T G +                      ++ + +T          E  +V+  + ++ L  +  ++E     ++ D F       ++ +++T  P+L  AI+++            + K +QLY       G++  GP+ +GK+T +   + A+  + +N                                  H    + P +    ++MFG       D+ DG+F+ LWR+  +       W+V DG +   W +NL S+LDD  TL L +G RL  +  VK +FE +++ +ASP  VSR+G+VY  S+ +  R I   WL+N+   E    + +FD+    V  + +Q  K ++ +    I  Q  L +L  ++   KE    +                            H+ RL++F   W L   +S  ++Q +   +K     L     S     IFD++V  +G W  W +L+       +   +YLS      +LV  +  +R  Y +         V +IG +G+GK++I+ N  +K ++ +     F +S  T   Q +  +E+ +E R G+ +G    + L + I+D+NLP   EI+    +  NE++RQ ++     + + P +   + D   + ++       + +  RL R F      +P+   +  I R + E H ++       I     +LI  T+ L+++    L    T  + H  F+LR ++ I  G+        +SE +L+  W +   RVF D      D +WF + L  +++    G+  S  +     F+ F     E +    +D         +  PK+   ++     RE LV  +    E      ++L+   + +L ++ I R I  P  G ++L+G  GS    L+++ S         I    + N    ++ +K + R  G +GK +  L T  ++K    L+ LN+++ SG    LF  DE A ++  +   MKRE    T  T   +++ F +R   +LH+  C  P  +     + ++P ++S   ++WL       L++ A +F++H
Sbjct: 1181 EIQTYIKRWKPYHFLWKNDRTTRQL-MEFGLQEFET------TLRCLSDLDANLLVEPDMEVFGQCVAVYNEKLKYGLAIEIKSCNHKIGQAMKKKYKKEMD----YVYAVINEMDRKLDRPIRDLDDVRMIMETLGKIREQEVDMELRID----PIEEAFNVLTRYEVQVEREQFDLVDNLRATFQNLLAGALQAQVKLLD-MQPAFQDDLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASDRLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQ-LLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDV--EYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRN--------LTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLK--QCRFYFKEDLDKTWISVTDVTFTYQ--NEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMN-PGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILS----------------------VLRTLGAAK---------------------RRNSKDT----------ESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFP------NQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDN----------------------------------HREMRMNPKAIT-AAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIV-QQMLFILEGLIPVKKEDEQAVSMSSKESHDEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFPQLDYPKGSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLS------ILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLP---EINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLL--PTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELACLVREEL-GDSHSQMILPNPVFVDFMRDAPEPTGEEGED-------TDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHP-RGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTA-TPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSH 3199          

HSP 2 Score: 100.908 bits (250), Expect = 3.808e-20
Identity = 127/609 (20.85%), Postives = 267/609 (43.84%), Query Frame = 3
Query: 11394 EEFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERAIFI-QCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWL----DRYLIHYNPVVISYSDLHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKM-YEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSERLSNKS-----IIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSNS--KKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKF 13181
            E+    ++  + ++ +Y+  +G++  +         ++     L+  +   + +W   SK+++ +    +   L+++ +L+YCGP N E R+  +   +   +   +       + + I   L     +S+     LP  E  + NA      S   ++ L+ D   +   W+    DR  +    +   Y   H  LE  L+ G+ ++I D  I     D ++  V    F  +K     K+L+  + E +  P F L++ T          +++ T ++ F  ++  L ++ L R I   K  ++ E   L     + +R + +LE  +L  LS+   ++   E    +++  K   EE+N  L+  E       K+ + +  +A R + ++ +   M+NV   Y    +++L +F+  I  S + S        I+  LT +  +++  S+ + +K +F+L+L+I+I     N+    +E+L             FIK   S   N+   KPF W+ + + +N+ +  + L  F  +L+ +  +  E  W+  ++ E PE   I    +   +D ++KL LIR+  PDR +  +  +I+ +L  ++
Sbjct: 3516 EQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFT----TGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSS---SYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTH--LEDSLSLGRPLLIEDVGIDL---DPVIDNVLEKNF--IKSGSIEKVLV-GDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNI--SHEEFLT------------FIKGGASLDLNAVTPKPFRWILDITWLNL-VEISKLETFSTVLQVI--ELNEKDWRCWYECEKPENEEI-PCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEY 4091          

HSP 3 Score: 97.8265 bits (242), Expect = 3.413e-19
Identity = 111/505 (21.98%), Postives = 208/505 (41.19%), Query Frame = 3
Query: 13683 YPSNLRDFLLHLFKIGFLSANSIPSMSLDLLPVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFESHSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSN--LLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTIESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYS---------LLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGV 15164
            Y S  +DFL       + SA   P       P+++  + L +I++ R  +  LG+       +    +++ + +Q   +  +    +SW  L Y + E+ YG +VT + D+  + + T  W     +   FEF K  Y  P        K  +    ++N  P  +++ E   L SN  +  +INS K +++ I  V            +      E+ ++++  ++  KLP       Q    +V  N     T M  L+  +    + ++ +Q+  K +   L +     D ++V S         +   ++PE W+ K+       G+    W + LL +       I  ++ KV  +W+  F  P+  L   ++EV+    R  +      V    + T  +K+ I E P++G+YVHGL L G   D+ +G+L +  +K +   +PV +I + +N     ++   Y CPI+          +     +       W LRGV
Sbjct: 4232 YQSFTQDFL------DYTSATQWP-------PLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASV-QFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYK-GYKVPGT------KSLQGFIDYINSLP-AYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETR------ESIVYQLADDMLRKLPA------QYNAYEVRENL----TRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWM-KISWESTTLGF----WYTELLERNGQFRTWISTDRPKV--FWMTGFFNPQGFLTAMRQEVT----RAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYI-YAINT-TAGKDPKLYECPIYRKPQRTDLKYVGSIDFETEFNPKHWTLRGV 4685          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0344344)

HSP 1 Score: 587.8 bits (1514), Expect = 2.446e-167
Identity = 553/2324 (23.80%), Postives = 1007/2324 (43.33%), Query Frame = 3
Query: 3381 ESKTLIK---FILLVKYEIPMIKFEPELDAIQSIIEQMGQDIMAFHNDVSDFSG----------------------------RKLNLYIKLESDLFYEFSQIISLKYSE--------------------SRLKLQSTVENLNEFDFLWK--MTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPK-EIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQ-------DVTELEQLNELLG-ILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGD-SLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNRNDLIS--WIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHK-ELSINSVTIAFQNSLKVLSQMLVDNKE--------------------------------IGGEL--------------------HIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSI---CIFDYYVDESGEWDLWSSLL-------MDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQ-ASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITF--STEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGS---HLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNH 9947
            E++T+ K   F L  + +IP +  +P LD +Q I+   G++I      V+ +S                             R+  +Y  L S+   +   ++   YS                      + ++Q+ ++    + FLWK   T+ +L  E  L + +T       +  +  L  NL   P  E+   C+ +  +  +  L   +    +K GQ +  + K+ +D    Y   V+ E+ +       D+ ++  + E LG I +Q  D++L+ID    PIE  +  L  +E+ + R + + + NLR  +  L+  A   + KLL+  +  F  +L   +  F  + I +   +    P  AG  P E   +L  F+N++     +  T  +  +LFGL    + EL  ++++L LL +LY LY        ++ D  W+ VD++++  +L EF + C  LP  LKE  ++  LK  ID    +  +L  +A+K ++ RHW ++M VT   F+ ++  F   ++   PLL++K++I+ IC  A KE ++E KL Q+  EW+   L F S + RG ++L    T   + QLEDS ++L ++ ++R+  P + +  QW   L   +E+L+ WL VQ +W+ LE VF+   I K L +E KRF ++DKS+ K M+R +ET  V  CC+ ++  K+  L ++Q+ LE C  SL GYL +KR +F R +FV D  +L IL  ++D   I  HL +IF     +       E  ++  I SS  E I L+  I  +  V  WL  L    + S+ ++   A   I+  + +L    +K P+QI    + + W+ +   A+   + ++K +     KF   ++ +     RN        +T  +R    ++    ++ RD    L    I+  +DFE  K  + +    + +      +  +T T+    E+ G    +  TP T++  +TL  +L      +  G + +GK+  ++++ +   +Y V  +C   M    L     G+A +G WG  D    ++   LS+A   +  +  A K+K  T    + + I +      F T   P  +    LP N+  +FR VA+  PD   I++       +  + TLA + YT+ K     + +       LR+I++                      V +T G +                      ++ + +T          E  +V+  + ++ L  +  ++E     ++ D F       ++ +++T  P+L  AI+++            + K +QLY       G++  GP+ +GK+T +   + A+  + +N                                  H    + P +    ++MFG       D+ DG+F+ LWR+  +       W+V DG +   W +NL S+LDD  TL L +G RL  +  VK +FE +++ +ASP  VSR+G+VY  S+ +  R I   WL+N+   E    + +FD+    V  + +Q  K ++ +    I  Q  L +L  ++   KE                                IG ++                    H+ RL++F   W L   +S  ++Q +   +K     L     S     IFD++V  +G W  W +L+       +   +YLS      +LV  +  +R  Y +         V +IG +G+GK++I+ N  +K ++ +     F +S  T   Q +  +E+ +E R G+ +G    + L + I+D+NLP   EI+    +  NE++RQ ++     + + P +   + D   + ++       + +  RL R F      +P+   +  I R + E H ++       I     +LI  T+ L+++    L    T  + H  F+LR ++ I  G+        +SE +L+  W +   RVF D      D +WF + L  +++    G+  S  +     F+ F     E +    +D         +  PK+   ++     RE LV  +    E      ++L+   + +L ++ I R I  P  G ++L+G  GS    L+++ S         I    + N    ++ +K + R  G +GK +  L T  ++K    L+ LN+++ SG    LF  DE A ++  +   MKRE    T  T   +++ F +R   +LH+  C  P  +     + ++P ++S   ++WL       L++ A +F++H
Sbjct: 1058 ENETVFKKPVFALHAQLQIPHVVIKPNLDELQDILVTAGKNITGIAKGVAQWSSGKDPPQVSMTVQPRVGRNHNESTGGGKSRRRKIYC-LASEERPQMPHMLKSFYSAIMDNKEVAKAVNQLASCTKNVKPEIQTYIKRWKPYHFLWKNDRTTRQL-MEFGLQEFET------TLRCLSDLDANLLVEPDMEVFGQCVAVYNEKLKYGLAIEIKSCNHKIGQAMKKKYKKEMD----YVYAVINEMDRKLDRPIRDLDDVRMIMETLGKIREQEVDMELRID----PIEEAFNVLTRYEVQVEREQFDLVDNLRATFQNLLAGALQAQVKLLD-MQPAFQDDLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASDRLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQ-LLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDV--EYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRN--------LTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLK--QCRFYFKEDLDKTWISVTDVTFTYQ--NEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMN-PGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILS----------------------VLRTLGAAK---------------------RRNSKDT----------ESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFP------NQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDN----------------------------------HREMRMNPKAIT-AAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIV-QQMLFILEGLIPVKKEDEQAVSMSSKESHDANKRLEHQKHVEEARRQSIGSQIVEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFPQLDYPKGSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLS------ILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLP---EINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLL--PTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELACLVREEL-GDSHSQMILPNPVFVDFMRDAPEPTGEEGED-------TDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHP-RGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTA-TPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSH 3231          

HSP 2 Score: 100.908 bits (250), Expect = 3.534e-20
Identity = 127/609 (20.85%), Postives = 267/609 (43.84%), Query Frame = 3
Query: 11394 EEFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERAIFI-QCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWL----DRYLIHYNPVVISYSDLHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKM-YEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSERLSNKS-----IIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSNS--KKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKF 13181
            E+    ++  + ++ +Y+  +G++  +         ++     L+  +   + +W   SK+++ +    +   L+++ +L+YCGP N E R+  +   +   +   +       + + I   L     +S+     LP  E  + NA      S   ++ L+ D   +   W+    DR  +    +   Y   H  LE  L+ G+ ++I D  I     D ++  V    F  +K     K+L+  + E +  P F L++ T          +++ T ++ F  ++  L ++ L R I   K  ++ E   L     + +R + +LE  +L  LS+   ++   E    +++  K   EE+N  L+  E       K+ + +  +A R + ++ +   M+NV   Y    +++L +F+  I  S + S        I+  LT +  +++  S+ + +K +F+L+L+I+I     N+    +E+L             FIK   S   N+   KPF W+ + + +N+ +  + L  F  +L+ +  +  E  W+  ++ E PE   I    +   +D ++KL LIR+  PDR +  +  +I+ +L  ++
Sbjct: 3548 EQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFT----TGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSS---SYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTH--LEDSLSLGRPLLIEDVGIDL---DPVIDNVLEKNF--IKSGSIEKVLV-GDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNI--SHEEFLT------------FIKGGASLDLNAVTPKPFRWILDITWLNL-VEISKLETFSTVLQVI--ELNEKDWRCWYECEKPENEEI-PCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEY 4123          

HSP 3 Score: 97.8265 bits (242), Expect = 3.221e-19
Identity = 111/505 (21.98%), Postives = 208/505 (41.19%), Query Frame = 3
Query: 13683 YPSNLRDFLLHLFKIGFLSANSIPSMSLDLLPVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFESHSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSN--LLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTIESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYS---------LLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGV 15164
            Y S  +DFL       + SA   P       P+++  + L +I++ R  +  LG+       +    +++ + +Q   +  +    +SW  L Y + E+ YG +VT + D+  + + T  W     +   FEF K  Y  P        K  +    ++N  P  +++ E   L SN  +  +INS K +++ I  V            +      E+ ++++  ++  KLP       Q    +V  N     T M  L+  +    + ++ +Q+  K +   L +     D ++V S         +   ++PE W+ K+       G+    W + LL +       I  ++ KV  +W+  F  P+  L   ++EV+    R  +      V    + T  +K+ I E P++G+YVHGL L G   D+ +G+L +  +K +   +PV +I + +N     ++   Y CPI+          +     +       W LRGV
Sbjct: 4264 YQSFTQDFL------DYTSATQWP-------PLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASV-QFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYK-GYKVPGT------KSLQGFIDYINSLP-AYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETR------ESIVYQLADDMLRKLPA------QYNAYEVRENL----TRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWM-KISWESTTLGF----WYTELLERNGQFRTWISTDRPKV--FWMTGFFNPQGFLTAMRQEVT----RAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYI-YAINT-TAGKDPKLYECPIYRKPQRTDLKYVGSIDFETEFNPKHWTLRGV 4717          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309027)

HSP 1 Score: 586.26 bits (1510), Expect = 6.305e-167
Identity = 531/2192 (24.22%), Postives = 965/2192 (44.02%), Query Frame = 3
Query: 3624 KLQSTVENLNEFDFLWK--MTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPK-EIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQ-------DVTELEQLNELLG-ILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGD-SLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNRNDLIS--WIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHK-ELSINSVTIAFQNSLKVLSQMLVDNKE--------------------------------IGGEL--------------------HIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSI---CIFDYYVDESGEWDLWSSLL-------MDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQ-ASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITF--STEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGS---HLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNH 9947
            ++Q+ ++    + FLWK   T+ +L  E  L + +T       +  +  L  NL   P  E+   C+ +  +  +  L   +    +K GQ +  + K+ +D    Y   V+ E+ +       D+ ++  + E LG I +Q  D++L+ID    PIE  +  L  +E+ + R + + + NLR  +  L+  A   + KLL+  +  F  +L   +  F  + I +   +    P  AG  P E   +L  F+N++     +  T  +  +LFGL    + EL  ++++L LL +LY LY        ++ D  W+ VD++++  +L EF + C  LP  LKE  ++  LK  ID    +  +L  +A+K ++ RHW ++M VT   F+ ++  F   ++   PLL++K++I+ IC  A KE ++E KL Q+  EW+   L F S + RG ++L    T   + QLEDS ++L ++ ++R+  P + +  QW   L   +E+L+ WL VQ +W+ LE VF+   I K L +E KRF ++DKS+ K M+R +ET  V  CC+ ++  K+  L ++Q+ LE C  SL GYL +KR +F R +FV D  +L IL  ++D   I  HL +IF     +       E  ++  I SS  E I L+  I  +  V  WL  L    + S+ ++   A   I+  + +L    +K P+QI    + + W+ +   A+   + ++K +     KF   ++ +     RN        +T  +R    ++    ++ RD    L    I+  +DFE  K  + +    + +      +  +T T+    E+ G    +  TP T++  +TL  +L      +  G + +GK+  ++++ +   +Y V  +C   M    L     G+A +G WG  D    ++   LS+A   +  +  A K+K  T    + + I +      F T   P  +    LP N+  +FR VA+  PD   I++       +  + TLA + YT+ K     + +       LR+I++                      V +T G +                      ++ + +T          E  +V+  + ++ L  +  ++E     ++ D F       ++ +++T  P+L  AI+++            + K +QLY       G++  GP+ +GK+T +   + A+  + +N                                  H    + P +    ++MFG       D+ DG+F+ LWR+  +       W+V DG +   W +NL S+LDD  TL L +G RL  +  VK +FE +++ +ASP  VSR+G+VY  S+ +  R I   WL+N+   E    + +FD+    V  + +Q  K ++ +    I  Q  L +L  ++   KE                                IG ++                    H+ RL++F   W L   +S  ++Q +   +K     L     S     IFD++V  +G W  W +L+       +   +YLS      +LV  +  +R  Y +         V +IG +G+GK++I+ N  +K ++ +     F +S  T   Q +  +E+ +E R G+ +G    + L + I+D+NLP   EI+    +  NE++RQ ++     + + P +   + D   + ++       + +  RL R F      +P+   +  I R + E H ++       I     +LI  T+ L+++    L    T  + H  F+LR ++ I  G+        +SE +L+  W +   RVF D      D +WF + L  +++    G+  S  +     F+ F     E +    +D         +  PK+   ++     RE LV  +    E      ++L+   + +L ++ I R I  P  G ++L+G  GS    L+++ S         I    + N    ++ +K + R  G +GK +  L T  ++K    L+ LN+++ SG    LF  DE A ++  +   MKRE    T  T   +++ F +R   +LH+  C  P  +     + ++P ++S   ++WL       L++ A +F++H
Sbjct: 1181 EIQTYIKRWKPYHFLWKNDRTTRQL-MEFGLQEFET------TLRCLSDLDANLLVEPDMEVFGQCVAVYNEKLKYGLAIEIKSCNHKIGQAMKKKYKKEMD----YVYAVINEMDRKLDRPIRDLDDVRMIMETLGKIREQEVDMELRID----PIEEAFNVLTRYEVQVEREQFDLVDNLRATFQNLLAGALQAQVKLLD-MQPAFQDDLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASDRLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQ-LLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDV--EYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRN--------LTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLK--QCRFYFKEDLDKTWISVTDVTFTYQ--NEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMN-PGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILS----------------------VLRTLGAAK---------------------RRNSKDT----------ESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFP------NQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDN----------------------------------HREMRMNPKAIT-AAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIV-QQMLFILEGLIPVKKEDEQAVSMSSKESHDANKRLEHQKHVEEARRQSIGSQIVEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFPQLDYPKGSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLS------ILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLP---EINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLL--PTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELACLVREEL-GDSHSQMILPNPVFVDFMRDAPEPTGEEGED-------TDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHP-RGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTA-TPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSH 3223          

HSP 2 Score: 100.908 bits (250), Expect = 3.534e-20
Identity = 127/609 (20.85%), Postives = 267/609 (43.84%), Query Frame = 3
Query: 11394 EEFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERAIFI-QCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWL----DRYLIHYNPVVISYSDLHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKM-YEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSERLSNKS-----IIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSNS--KKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKF 13181
            E+    ++  + ++ +Y+  +G++  +         ++     L+  +   + +W   SK+++ +    +   L+++ +L+YCGP N E R+  +   +   +   +       + + I   L     +S+     LP  E  + NA      S   ++ L+ D   +   W+    DR  +    +   Y   H  LE  L+ G+ ++I D  I     D ++  V    F  +K     K+L+  + E +  P F L++ T          +++ T ++ F  ++  L ++ L R I   K  ++ E   L     + +R + +LE  +L  LS+   ++   E    +++  K   EE+N  L+  E       K+ + +  +A R + ++ +   M+NV   Y    +++L +F+  I  S + S        I+  LT +  +++  S+ + +K +F+L+L+I+I     N+    +E+L             FIK   S   N+   KPF W+ + + +N+ +  + L  F  +L+ +  +  E  W+  ++ E PE   I    +   +D ++KL LIR+  PDR +  +  +I+ +L  ++
Sbjct: 3540 EQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFT----TGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSS---SYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTH--LEDSLSLGRPLLIEDVGIDL---DPVIDNVLEKNF--IKSGSIEKVLV-GDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNI--SHEEFLT------------FIKGGASLDLNAVTPKPFRWILDITWLNL-VEISKLETFSTVLQVI--ELNEKDWRCWYECEKPENEEI-PCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEY 4115          

HSP 3 Score: 97.8265 bits (242), Expect = 3.444e-19
Identity = 111/505 (21.98%), Postives = 208/505 (41.19%), Query Frame = 3
Query: 13683 YPSNLRDFLLHLFKIGFLSANSIPSMSLDLLPVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFESHSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSN--LLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTIESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYS---------LLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGV 15164
            Y S  +DFL       + SA   P       P+++  + L +I++ R  +  LG+       +    +++ + +Q   +  +    +SW  L Y + E+ YG +VT + D+  + + T  W     +   FEF K  Y  P        K  +    ++N  P  +++ E   L SN  +  +INS K +++ I  V            +      E+ ++++  ++  KLP       Q    +V  N     T M  L+  +    + ++ +Q+  K +   L +     D ++V S         +   ++PE W+ K+       G+    W + LL +       I  ++ KV  +W+  F  P+  L   ++EV+    R  +      V    + T  +K+ I E P++G+YVHGL L G   D+ +G+L +  +K +   +PV +I + +N     ++   Y CPI+          +     +       W LRGV
Sbjct: 4256 YQSFTQDFL------DYTSATQWP-------PLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASV-QFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYK-GYKVPGT------KSLQGFIDYINSLP-AYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETR------ESIVYQLADDMLRKLPA------QYNAYEVRENL----TRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWM-KISWESTTLGF----WYTELLERNGQFRTWISTDRPKV--FWMTGFFNPQGFLTAMRQEVT----RAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYI-YAINT-TAGKDPKLYECPIYRKPQRTDLKYVGSIDFETEFNPKHWTLRGV 4709          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: kl-3 (gene:FBgn0267432 transcript:FBtr0346771)

HSP 1 Score: 528.094 bits (1359), Expect = 2.602e-149
Identity = 501/2093 (23.94%), Postives = 918/2093 (43.86%), Query Frame = 3
Query: 3846 LLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPL--QIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPS---QICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRV-----NRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHKELSINSV--TIAFQNSLKVLSQMLVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRET--LVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLT--GEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEE-----DSSRNSKDLQNIRTTA-HLSAPKI---AVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKL---ETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWL-KDSEDSYLMADANYFVNHSLNEIDLYLSEEKDKDQLAQYLANLHKEV 10034
            L+S    W+   G  L  + K+ LDE  ++       L + + +L+ + + + +L+++ D  +++D   Q I   Y+    F + + + + +++  L+  ++ +++ A+   +++ +E      +EL+  +  F  E   F   FD   P + G    E   ++  F+N++     K     +  KLFGL +  +  L   K +   L +LYSLY +  K   ++ +  W+ V+++ +  +L++F   C  LP  ++   ++ +LK KID   +   +L  + +K ++ RHWI++  +   +F      F    L   P+L+ K++++ IC  A KE+++E KL QI  +W+   L       RG +VL+   T  ++  LEDS +++ ++ ++R+  P K +   W +KL+   ++L+ WL VQ LW+ LE VF+   I K L  E KRF  +DKSY+K M R  E  N   CC  +E S    L  +   LE C  SL GYL  KR +F R +FV D  +L IL  ++D  +I  HL SIF A+  +     F+E     I+ + S +RE++   N +     V  WL  L  E++++I  +   A   +S  D     +++FPS   Q     + L W+ +   A+ + ++DK  +     KF   ++   I L       T   +T+L R R  +M    ++ RD   +L   +I+   DFE  K    +     +  N    +           E+ G    +A TP T++  +TL  ++      +  G + +GK+   +++ R   +  V  +C   M    L     G+A +G WG  D    ++   LS+A   I  +  A K+K +T   ++ + + L      F T   P  +    LP N+   FR VA+  PD   I++       ++ +  L+ ++YT+ K     +++       LR+I++ L    + K++                                             N+T          E  +V+  + ++ +  +  E+E     ++ D F G        +   +  DL  AIIK         +     K VQLY       GL+L GPT SGK++     L                                       + ++H    + P +     +MFG       D+ DG+F+ LWRR      ++N    WIV DG +   W +NL S+LDD  TL L +G R+  + N K VFE +++ +ASP  VSR G+V+  S+++ W+     WL  K+  +     + +D + D    ++    + L+   +   I  +  L ++  +L+D   +  E  ++R+F+F  +WSL + +    ++ +   L +    L  P    +  IF+YYVD++G W  WS+ + +E  Y   ++     +LV  +  +R  + L    +    V LIG +G+ K++++  +    D        F +S  T  +  +  +E+ +E RQG  YG    + +T+ I+D+N+P   E         NE++RQ++      + + P +   + D  ++ ++       + +  RL RH       +P  + +  I + +   +          ++    L+  T+  ++ V + +    T    H  FNLR ++ I  GI    ++   S   +L+ W +   RV  D    + D  WF++ +           IS   +N  + F+ F  EE     D  R++ + Q           PKI     + + + SK    +SQ N +   +  D +  M   + L  ++ + R I+ P  G+ +L+G  GS    +  ++  IA     ++    + N   L + +K + R  G +G     + TA  +K    L+ +N+++ SG+   LF  DE+  + S +   MK+ +      T  +L + F SR R +LHI LC  P  +       K+PG++S   ++W  K  ED+ +    +Y  ++ +      +  EK KDQ+   ++ +H+ V
Sbjct: 1178 LVSESKKWKVLLGHLLSVQYKKQLDEMIEFITEQNNILDKPINDLDDVRQAMVVLEKVRDNYIEMDVSLQLITDTYSLFSQFYIYVPQEDYDKVEGLQVLFNKMLENAKKVSDRI-SEMEEPLLRELNDGIATFVQEFYDFNLDFDLNGPMVEGISAKEASDRVFLFQNRFDELWRKFEMYSSGEKLFGLPITDYPLLHQRKREFNYLNRLYSLYIQVLKTITDYYEMPWADVNIEKISAELSDFQLRCRKLPKGMQSWPAFIDLKTKIDDFNETCPLLELMTNKAMKERHWIRLNALFNTDFDPTNPKFTLGKLLEAPILKYKEDVEDICVGASKELDIEAKLKQIVSDWSLVSLQLGQFKNRGDLVLKGGETLEIISSLEDSLMIMNSLASNRYNAPFKKDIQLWLSKLVNTGDILEKWLMVQNLWIYLEAVFVGGDISKQLPMEAKRFTNIDKSYVKIMMRAREIPNAVDCCTGDE-SLATNLTWLLDQLETCQKSLTGYLESKRLVFPRFFFVSDPVLLEILGQASDPTSIQPHLLSIFDAIATVD----FQEKSIDIIESMNSMNREKVKFENTVQCLGSVELWLGRLLKEMQDTIRTIL--AQMSVSLNDPEFNFAEEFPSFCGQAGVVGVQLLWTKDSEYALRKCRTDKTIMKRTNNKFLVLLNFF-IDL-------TVKDLTSLDRIRFETMVTIHVHQRDIFDDLCTLRIKSAGDFEWQK----QARFYYNEDNDDVIVGITDVNFVYQNEYLGVTERLAITPLTDRCYITLAQAVGMCMGGAPAGPAGTGKTETTKDMGRALGKLVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKEKRSTFIFLDGDIVSLNPEFGIFITMN-PGYAGRQELPENLKIMFRTVAMMVPDRQIIIRVKMASCGFKENVVLSRKMYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGSQKRS-------------------------------------------NPNDT----------EETIVMRVLRDMNVSKLIDEDEGLFVSLVDDMFPGI------KLTTNVYKDLQKAIIKVCDELGYVNNPEWNLKVVQLYETSLVRHGLMLMGPTGSGKTSCTVCMLRCFTE----------------------------------MGRTHKEMRMNPKAIT-APQMFGRLDVATNDWTDGIFSTLWRRSLKVPQHQN---CWIVLDGPVDAVWIENLNSVLDDNKTLTLANGDRIKMADNSKLVFEPDNVDNASPATVSRVGMVFTSSSVLSWKIYMEAWLL-KQGEDSEVFRRCYDVLYDDA--HVFLQSRLLAKMRILEAIYIRQMLDIMDGLLLD-LPLRTEKALERIFLFSLMWSLGAVLELSEREKLEEFLLKHVSKLRWPKRGVNETIFEYYVDDNGNWQHWSTRV-EEFRYPEDEIPEFSSILVPNVDNVRTAFLLHNIAKQLKQVLLIGEQGTAKTVMIKAYMGHYDPEVHIFKSFNFSSATTPNMYQRIIESYVEKRQGTTYGPPNQRAMTIFIDDINMPVINEWGDQIT---NEIVRQMIEQRGFYSLERPGDFSTIMDIQMLSAMIHPGGGRNDIPNRLKRHLCIFNCTLPSNNSMDQIFKSIGAGYFSPDRLGDEVVEVIPLLVPLTRIFWQNVKAKML--PTPANFHYVFNLRDLSRIWEGILKVKHEECKSVDQILKLWCHECTRVISDRFTAEKDKIWFSSKM-----------ISDAELNI-KEFMEFYPEEPTYWVDFLRDAPEGQEEEDEEMSFEPPKIYEEIPSFDFVRSKVLVFMSQFNEYIRGYNMDLVFFM---DALKHLMIVSRIISNP-RGNALLVGVGGSGKQSLTRLSSFIAGYKFFQMTLTRSYNTGNLTEDLKFLYRTAGLDGNGMTFIFTANEIKEESFLEFINNILSSGEIANLFAKDELDEMYSELIPVMKKHQPRRPA-TQDNLYDFFISRARYNLHIALCFSPVGEKFRMRSLKFPGLISGCVIDWFQKWPEDARIAVSRHYLTDYQI------VCSEKVKDQVIDIMSWIHESV 3119          

HSP 2 Score: 90.8929 bits (224), Expect = 3.921e-17
Identity = 98/453 (21.63%), Postives = 191/453 (42.16%), Query Frame = 3
Query: 13773 LPVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYE---IVQRMCNWFESHSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISP---FLFESAEACHLSSNLLTKINSEKILIE-----------KIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTIES-IQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTID-WISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIF 15074
            LP++++ S L ++++ R  +  LG+     I    N S+ Y     VQ   +  E    ISW  +RY + E+ YG +VT + D+  + + T  W         F+F K  Y   S  +     +        N+ P   + F S       +N +  I  E + I+           + D+V++ + E       +  T +  +LF++ ++L +    S++   +++ + ++    I  +++ K+L++  +V G I+   +  R  + N     I +A V  V+                  +G    S++  W + LL ++          +  V  +W+  F  P+  L   ++EV+    R  +      V    +      +  ++PP +G++V+GL + G G+DK T  L + + K + T +PV HI    +   K  NS  Y CP++
Sbjct: 4150 LPLVYSISFLHTVVQERRKFGPLGW----NIPYEFNSSDWYASCLFVQNHLDDIEQGKGISWVTVRYMLGEVQYGGRVTDDYDKRLLNTFTRVWFHDTLFEDCFQFFK-GYKVYS--FKEQEAYLAAIDDMANVDPPQVYGFHSNAEITYQTNTMRNILDEIMSIQPKESSAGTGESREDRVARQVKE------MLSKTPLAFDLFDVKQHLIAMGATSSMNIFLRQEIDRMQRIIILVRSIFKDLLL--AVEGTII-MSENLRDALDN-----IFNARVPTVFK-----------------RGSWVSSSLGFWFTELLERHTQFYNWCFGARPVV--FWMSGFFNPQGFLTAMRQEVA----RAHQGWALDQVTMHNDVLKVGPEECKKPPKEGVFVYGLFVDGAGWDKRTSRLVEATNKVLFTLMPVIHIYAIFSTAAK--NSKLYTCPVY 4556          

HSP 3 Score: 82.8037 bits (203), Expect = 1.106e-14
Identity = 134/589 (22.75%), Postives = 257/589 (43.63%), Query Frame = 3
Query: 11481 ELKALSERLDMNVWLVENIKPMEEKW--QTMSKQYEDERAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSK-IEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVV--ISYSDLHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHT-CSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSI----DNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFD-SMIESSE----RLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSNS--KKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVT 13196
            E K   +++D    L+  +   + +W  Q  S + E +R +    ++ +A+L+Y GP N E RS      + S  +  ++      S  + I + L    +I +     LP  E  I N   I++   +R  +LI  Q++  + W+         +V  +++    N LE  ++ G  +II D     +AE+             LK    +KI +  + EV+ +P FR ++ T   + +  P++    T ++ F  ++  L ++ L R I   +  ++ E  +L+       +K+ +LE  +L  LS       S+ +  T+I+ L   +     +++K  +    +  I    + Y  +A R + ++ +   M  V   Y     ++L  FD SM  SS+    +   K II+ LT +  +Y    + +++KF+F LL+++ I +    +    DE+ +            FIK   +   N     PF W ++E+ +N+  L    P F +IL  +     E  W   +  ++PE   I +    NS+D ++K+ L+R+   DR +     +I N+L  +F   V 
Sbjct: 3441 EAKKCQDKMDAATALIGGLAGEKIRWTEQIASFKSETDRLVG-DVILLTAFLSYTGPFNQEFRSD-----LQSIWTKQIIEKMIPISANVNIIESLTDRSQIGEWNIQGLPTDELSIQNG--IISTKAMRFPLLIDPQSQGKV-WIKNKEKQNKVIVTTLNHKYFRNHLEDSVSMGIPIIIED-----VAEELDPCLDNLLDRNLLKVGTQYKIKI-GDKEVDWNPAFRCYITTKLPNPAYTPEIFAR-TSIIDFTVTMRGLEDQLLGRVILAERKELEDERVQLVETVTGNMKKMKELEANLLQKLST---TKGSLLDDVTVIEVLNTSKNTAIEVKEKIEIAKVTEAKINAAREEYRVVATRGSVLYFLVCSMARVNNMYQTSLVQFLERFDASMYNSSKTHITQKRIKRIINYLTFEIYRYKSRGLYEKDKFLFVLLMALSIDRQLELITF--DEFQV------------FIKGGAALNLNDCPPVPFRWTTDETWLNLVQLTNLTP-FVNILSKV--SGNERAWFTWYKKDAPENEIIPDGY--NSLDPFRKMLLVRSWCMDRTISQCRKYIANSLGDRFAEPVV 3991          

HSP 4 Score: 58.151 bits (139), Expect = 3.638e-7
Identity = 52/269 (19.33%), Postives = 127/269 (47.21%), Query Frame = 3
Query: 2286 VYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAGMHSEFSKLLKYLATQKIYNFNHLLSKNWDSNEFTEAINKDLLAKKSTVQRTLEACSNIL-KEITEIISI 3089
            V   + WI+ +   I++PM   +  + V   K+ +  V+ YN ++  +  ++ AY   W   V+     L  P++ ++       +N    +L +I+ET  M ++  ++   A  +   + R+    + L   +  ++ ++ S+ P  + + +  ++ +    +   S+++W + N++ ++ KV   I  +E+  N +  +  E  ++L+ + +   Y + ++  +   S EF E  NK     +S ++R LE  S  + + + +II++
Sbjct:  621 VAGRIIWIRSIFKKIDLPMQALKLRQCVLAHKKAQRTVRYYNYMNGIICHYEMAYHKAWFDYVEEVRCLLNAPIMTINKEEAIYIVNIDRAILQLISETEWMWKLNLEVPNMAATITYCKDRLLGPATTLKLMLQRYDRLRTSLTPVFINIMRFRLQEISILLKPSLSTVTWISENLEDYVEKVCMKIKEVETFFNLI--LDIEDLRILQEMYSISDYLYIYVPEEPVSSYEFVEESNK----LRSEIERILEKKSVCMERAVVDIINM 883          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: dnah5l (dynein, axonemal, heavy chain 5 like [Source:ZFIN;Acc:ZDB-GENE-091204-287])

HSP 1 Score: 658.677 bits (1698), Expect = 0.000e+0
Identity = 630/2700 (23.33%), Postives = 1179/2700 (43.67%), Query Frame = 3
Query: 2091 RPMRTGEALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESY-KEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAGMHSEFSKLLKYLATQKIYNFNHLLSKNWDSNEFT----EAINKDLL-----AKKSTVQRTLEACSNILKEITEIISIVEKLDPNSSLYESEDLIFGQMKEMYNKSLSQSLYRSIINNLVYLAICSNCQKEHLELLTSRAEYDPVTGINDNLCSSYGEEVFCINDIKPIYDSDHAESKTLIKFILLVKYEIPMIKFEPELDAIQSIIEQ-------MGQDIMAF-------------------HNDVSDFSG----RKLNLYIKLESDLFYEFSQIISLKYSESRLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHL----KNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREE---IVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYIS-TGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRV--NRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQML--VDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRET--LVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYL----SLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFV-YSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIR----GVFECHIDSIEN-CQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAII----------QNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGS---HLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFV-NHSL 9953
            RP+ T + L ++S+F+    R+     +  K   +   ++ D+    + Y KE  N  +Q+  ++     + W + L   IE+PM   +D  ++ QM +   I++ YN+++  L+ ++  +   W+  V+  ++ L   LL       +  +N    +L ++ E  NM ++ + +     ++   E ++K +  KL   +  F  V + I   +    +  I+ V      G + LSWT++NID F+  V   +  LE ++  V  +                   NH L     +   T    E +  ++      A  ST + TL+  S  ++    ++ I E+L  N  L  SE +   +   ++  +   +     +    Y+ +   CQ+    L+T  A    +  ++  L ++                S    +  +  F + V+  IP I F P  + IQ I+ +       M +DI  +                   H D +  S     R L+ ++    D+    SQ++ L  S  +      +E+L++F  LW       D  E +      N +    +  L L    +  +  LP+   +  ++  T+  +  L+   + W+ + G  L+ +A   + E + + + V  +L++ +++L+ + E +G L ++ + +++I++I  P+E  +  L   +L         +  +   W  L  MA+  + KL + + ++   EL   ++ F   V  F   +D   P + G  P E   +L+ ++ ++     K  T  +  +LFGL V  + +L  +K +L LL++LYSLY         + D LW+ ++++ +  +L +F +    LP+ LKE +++ +LK  ID   +   +L  +A+K +  RHW ++  +T   F++EA  F   ++   PLL+ K++I+ +C  A KE ++E KL  +  EW+     F +   RG ++L+   T+  +  +EDS ++L ++ ++R+  P K    QW  KL   SEV++ WL VQ LWL LE VF+   I K L QE KRF+ +DKS+ + M+R +E   V QCC+ +E  ++  L ++ + LE C  SL GYL +KR +F R +FV D  +L IL  ++D   I  HL ++F  VN +     F E    D+I S   +E   + ++  I  +  V  WL +L + +++++ ++   A   I   G  L E    FP+Q+    +   W+ +   A+ + K+DKK +    +KF        + L       T   +T ++R +  ++    ++ +D   +L    IR   DFE  K  + +   +D       Q+  +    D   E+ G    +  TP T++  +TL  +L      +  G + +GK+   +++ R   +Y V  +C   M    L     G+A +G WG  D    ++   LS+A   I  +    K K +     + + + +      F T   P  +    LP N+  +FR VA+  PD   I++       +R ++ L+ + YT+ K     +++       LR+I++ L    A K++                                  +PT                     E  +V+  + ++ L  +  E+E     ++ D F G        + +   PDL  AI K+A+          + K VQLY   R   G++  GP+ +GK+T +   + A+                     +  +P      +P+ +                 S+MFG       D+ DG+F+ LWR+   ++     WIV DG +   W +NL S+LDD  TL L +G R+P + N K VFE +++ +ASP  VSR+G+V+  S+++ W+ I   WL+    ++   L   F+ I   ++ ++             +  + ++ +L  +L  V+ K +    HI RLF+F  +WS  + +   ++  +   LK+    L LP       IF++ V  +GEWDLW++ +    EY+    S+     +LV  +  +R  + +    +    V LIG +G+ K++++  +  K D    N+++ + +S  T+    +  +E+ I+ R G  YG    K +T+ ++D+N+P   E         NE++RQL+      + + P E   + D  ++ ++       + +  RL R F      +P  S +  I      G F       E  C +    A+ L+  T+K+++ V + +  S    + H  FNLR ++ I  GI +   +   +  LL   + +   RV  D  I + D + F+  L+ I           Q  W G            F+ F  +       +       T     PK+   +    +  E L      + E     +++L+  ++ ++ ++ I R I +   G+ +L+G  GS    L+++ S         I    T N   LI+ +K++ R  G EGK    + T  ++K    L+ +N+++ SG+   LF  DE+  +  ++  +MK++        + +L   F SR+R +LH+ LC  P  + +     K+PG++S   V+W +      L+A A +F+ N+SL
Sbjct:  432 RPLTTEQVLELLSRFENGVGRQMD---LNQKYMVVLQRYECDLEFVRKCYQKEKDNPVSQLTPLA---GKIEWSKHLFKKIELPMQILKDKLDILQMPDRRKIIRSYNRLAAVLLEYEMIHQKAWVEGVELGLSGLNASLLTRHPTTKEFYVNLDPLVLEVLQEANNMYKLGALVPDGIHDMAAKEPQLKEYRYKLQMMLKEFHAVVKKIPGVLKSPMKPFIRSVETALSPGLTILSWTSLNIDYFIGCVYKALQELEQVLKVVTDILD--------------CRINHTLESMCSTTLLTLPENEPVTPEMFLTHTAATISTERETLKVASQQVER--SMLEIAEEL--NRMLKPSERVNLKKCSCLHPDAKQMTRCLQCLPCAFYIMMGQLCQRNTEALVT--ATKSSLNALHRRLLAASSSYR---------SSSPSGATIQVPLFRVSVELAIPNIVFRPSFEHIQGILNKGVNMVLSMAKDIPLWNYFHLQQDQLQAEQVAAREHGDETVVSKPILLRSLDRHVTEHKDVNKSLSQLVPL-VSSLKADAGDILEDLSQFSALWNQ-----DPAEQVKAFLQTNPILADFSTQLSLYSAYETQIHELPQTCTVGPILFETESLKMSLIQECHTWKREFGAALNQQASAGMTEISSFVDGVNRQLQRPISDLDDVRESMGALRELREEEIRIETIMGPVEESFALLNRHDLFFNDGNAERIDGVVYAWKELKVMAKETQKKLSDVEPHM-KAELIAGVEVFQKSVESFYGDYDNSGPGVTGLPPREASDRLQVYQAKFDELWRKYVTFSSGEELFGLPVGEYPDLHRIKRELNLLSKLYSLYNSVIDSVSGYYDILWADLNIEKINNELLDFQNRIRKLPAALKEWQAFNDLKKTIDDFNETCPLLYMMANKAMMARHWERITDLTKHKFEVEAPNFSLRNVMEAPLLKCKEDIEDVCISAVKERDIEAKLKDVVTEWSGHQFTFATFRNRGELLLKGSDTSEKVALMEDSLMVLGSLMSNRYNAPFKPTIQQWVQKLSNSSEVIEKWLTVQNLWLYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQRIMQRAHEIPGVVQCCVGDETLQQ-LLPHLLEQLEVCQKSLSGYLEKKRLVFPRFFFVSDPVLLEILGQASDSHTIQAHLLNLFDNVNRV----VFHEK-NYDQILSFQSQEGETVNMSEPINAQGNVEAWLGMLLDGVKKTLHSIIRQAAMVIGDQGFKLVEFQSMFPAQVGLLGIQFIWTRDAEEALQQSKADKKIMQTTNQKF--------LDLLNELIDMTTHDLTKMERTKYETLITIHVHQKDIFDDLVQMNIRSPLDFEWQK--QSRFYFIDDTDRCIIQITDV--EFDYCNEYLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKKSQFIFTDGDVVDMDKEFGIFLTMN-PGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRENQVLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRS----------------------------------NPTEP-------------------EKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGIM------LDKAGYPDLEAAITKQAEEAGLIAHPPWILKLVQLYETQRVRHGMMTLGPSGTGKTTCIHTLMKAMT--------------------DCGNPHKEMRMNPKAIT---------------ASQMFGTLDVATNDWTDGIFSTLWRKTLKSKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWQPILQAWLKKIPPMQADVLLAAFNSIYQDLMNFVFTAVSPKMQLLECMYIKQTIDLLQGLLPAVEEKNLNAA-HINRLFIFAVMWSAGALMELEDRAKMEVFLKKHNARLDLPSTQGEQTIFEFLVSSTGEWDLWATRV---PEYIYPKDSVPDYASILVPNVDNIRTDFLMQTIMKQGKAVLLIGEQGTAKTVMIKGYTSKYD-PETNLSKSLNFSSATQPGMFQQTIESYIDKRMGTTYGPPGGKKMTVFVDDINMPVINEWGDQIT---NEIVRQLMVQGGFYSLERPGEFTTVVDLQLVAAMIHPGGGRNDIPQRLKRQFCVFNCTLPSNSSIDKIFHTLASGYFCVERGFPEEVCSL----AAALVPTTRKVWQAVKAKMLPSP--AKFHYIFNLRDLSRIWQGILTVGSEVCQTPQLLASLFRHECSRVIADRFIDEKDRETFDGILERITAQDHGPSLLEQGPWQG-----------YFVDFLRDAPEMTGEEPEDAEEET-----PKVYEPIPTFKALSERLSMFQEQYNEAVRGAAMDLVFFEDAMIHLMKISR-IIRTARGNALLVGVGGSGKQSLTRLASFIAGYQSFQITLTRTYNVSNLIEDLKALYRIAGLEGKGVTFIFTDNDIKDEAFLEYMNNVLASGEVSNLFARDEVDEITQSLIPAMKKDLPRCPPTID-NLYNYFLSRVRSNLHVALCFSPVGEKLRSRALKFPGLISGCTVDWFQRWPRDALVAVAQHFLSNYSL 2944          

HSP 2 Score: 111.309 bits (277), Expect = 3.850e-23
Identity = 141/620 (22.74%), Postives = 286/620 (46.13%), Query Frame = 3
Query: 11394 EEFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDE-RAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSDLHNR--LESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENC----NTIIKYLKMYEEINANLQQKEFLFSSNKKSIDN----YHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESS-------ERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSNS--KKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTV 13193
            E+ +  +KE  D ++ Y+  + ++  +  + +A  +++   V L++ +   + +W   S Q+E + + +    L+++ +L+Y GP N E R+  +        S  +  +      + +   L     I +     LP  +  I N   +   S    + L+ D   +   W+       +  V S +  + R  LE CL+ G+ +++ D    +L  D ++  +    F  +K  KT K+ +  + EV+    F L++ T  +       + + T +V F  ++  L ++ L R I   K  ++ E  KLL E    KR       +M +  SN +  + SI+       ++I+ LK+ +     + QK  + +  + +I++    Y  +A R + ++ +   M+ V   Y     ++L +FD  +E S       +RL N  I++ LT +  +Y+   + +++KF+F+LLL+++I   T N+           S   L++   FIK   S   NS   KP  W+ + + +N+  L++ L  F  +L  + ++ +   WK  FD  +PE S + +  +++ +DA++KL LIR+  PDR +  +  +I  ++ +K+   V
Sbjct: 3258 EQLDAKQKELDDAQAMYDAAMKEKQDLLDDAEACKKKMSNAVALIDGLGGEKIRWTESSAQFERQIKDMVGDVLLATGFLSYSGPFNQEYRTLLMQQWKKEMDSRHIPYS----ENLNLINMLVDNATIGEWNLQGLPNDDLSIQNGIIVTKAS---RYPLLIDPQGQGKIWIKNREQSNDLQVTSLNHKYFRTHLEDCLSQGKPLLLEDVG-EEL--DPVLDNILEKNF--IKTGKTSKVKV-GDKEVDVMETFTLYITTKLANPAYSPEINAKTGVVDFTVTMKGLEDQLLGRVILIEKKEMEAERVKLLEEVTSNKR-------KMQELESNLLYRLTSIQGSLVEDESLIEVLKVTKTTAQEVSQKLTVAAETEININHAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDMSMEKSPKSQVTAKRLEN--IMEFLTFEVFRYTARGLYEDHKFLFTLLLALKIDLQTKNI-----------SHNELQT---FIKGGASLDLNSVEAKPKRWILDTTWLNLVQLSS-LHTFATLLTQVGRNDRA--WKSWFDEATPEESPLPDG-YESQLDAFRKLLLIRSWCPDRTIAQARKYIAESMGVKYAEGV 3837          

HSP 3 Score: 85.8853 bits (211), Expect = 1.761e-15
Identity = 100/473 (21.14%), Postives = 194/473 (41.01%), Query Frame = 3
Query: 13776 PVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFESHSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTI-ESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTR-----KVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPS---DGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHI-TFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGV 15164
            P+ +  + L + ++ R  +  LG+       +    S++ + VQ   +  +    ++WN LRY + E+ YG +VT + D+  + +    W + +    +F F    Y   ++   P  +  +   A ++  P L ++ E   L  N    I  +  L    D +S  +N +   S   +    E+ + ++   +  KLP   +   ++  L+K+      +  L +EL     V G + + +   +      +IM+E   ++ DA    + S+   +VP+ W  K+       G+    W + LL + Q       N +     +WL  F  P+  L   ++E +   +   +      V  L + T   K+ +  PP     G+Y++GL+L G G+DK   +L++ S K +   LPV H+   +     K    + Y CP++          +     +       W LRGV
Sbjct: 3992 PLFYAVAFLHTTVQERRKFGPLGWNIPYEFNQADFTSSV-QFVQNHLDDIDIKRGVNWNCLRYMLGEVQYGGRVTDDMDKRLLNTFARIWFSESMFADKFCF----YKGYTI---PKARMLQDYHAHIDALP-LVDTPEVFGLHPN--ADITYQTNLAN--DTLSTILNIQPKDSSSGEGETRESSVQKMANEMLEKLPADYVPHEVKSSLQKMGAFQPMTIFLRQELDRMQRVIGRVRSTLTDLKLAIDGTIIMSE---DLRDA----LDSMYDARVPKSW-QKISWEAASLGF----WFTELLERNQQFYSWTFNGRP--LQFWLTGFFNPQGFLTAMRQETTR--MNLSKGWALDTVILLNDVTRMMKEDVTSPPPADIGGVYIYGLYLDGAGWDKRNVKLTESSPKVLFNLLPVVHVYAVSSTTESKKPAMNLYSCPVYKKPRRTDLTYIFSLFLRSSQNPDHWTLRGV 4435          

HSP 4 Score: 61.6178 bits (148), Expect = 3.481e-8
Identity = 40/143 (27.97%), Postives = 71/143 (49.65%), Query Frame = 3
Query:  690 EVILEEVNDRTSEQDIFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIRRQILS 1118
            +V+ E    R    DI    E+  W+ R     +L+ ++K    K  IG L + KSK + KW++L++ IT   N +KD +KYL T      ++E+  S P+ +L  +PK+   +      S+ ++ S  M S    +  Q+++
Sbjct:  138 QVLTESERIRRESDDIGPSAELAHWKRRMITFCSLMDEIKDPYVKKIIGILHAAKSKTMSKWKELDASITIVANEAKDNVKYLSTLDKFFELLEK--STPTSMLKHIPKLMNSIHMIHRVSQFYNTSEHMTSLFVKVTNQMVT 278          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 611.298 bits (1575), Expect = 2.387e-174
Identity = 546/2202 (24.80%), Postives = 982/2202 (44.60%), Query Frame = 3
Query: 3591 IISLKYSESRLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNS-LKEKITQVLHLKN---NLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKN-TLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFS-SSR--EEIVLNNKIAIKDEVVNWLN-LLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGY----EFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWR---RVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQN-HKELSINSVTIAFQNSLKVLSQMLVDNKEIGGEL---HIQRLFVFCFIWSLNSQISDLNKQAITTLLKRET---LVLPD--DDNSICIFDYYVDESGEWDLWSSLLMDEGEYL----SLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSII----RGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISS-GNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSH---LSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNHSLNEIDLYLSEEKD--------KDQLAQYLANLHKEVLKFT-VTP 10055
            ++S   + ++ ++ + +E  + +  +WK      D EE++ K    N  L E  +Q+L+ ++    +   P+ I +  L + T   +  L +    W    GQ  + + +  +++   + +   ++L + + +L+ +   +  L +I +  + ID    PIE  Y+ L  + L I + E  ++  LR  W  L+  +   +N+L++ +   F  EL K ++ F  +   F  Y D++  S  G    + + +L S      IY      T     +LFGL V    +L  +++ L LL +LY LY         + D  W+ + +D +  +L +F   C  LP  LKE +++ +LK  ID   +   +L  + +K +  RHW ++ +VTG  F++E   FK  ++   PLL+ K+EI+ IC  A KE ++E KL Q+  EW  +   F     RG ++L    T+ ++  +EDS ++L ++ ++R+  P K +  +W   L   +++++ W+ VQ LW+ LE VF+   I K L +E KRF  +DKS++K M R +E  NV Q C+ +E +    L ++ + LE C  SL GYL +KR LF R +FV D  +L IL  ++D   I  HL +IF  +  +     F E +  DKI + SSR  E I L+  +  +  V  WLN LL          +   A+    +G  L E    FP+Q+    + + W+ +   A+S  + D+K +S   + F        + L  N    T   + A++R +  ++    ++ RD   +L    I+   DFE  K  +          N+      +  T D+G+    EF G    +  TP T++  +TL  +L      +  G + +GK+   +++ R   +Y V  +C   M    L     G+A +G WG  D    +D   LS+A   I  +    K++       + + + +      F T   P  +    LP N+   FR VA+  PD   I++       +  +  LA + +T+ K     +++       LR+I++ L    A K+                                              N+T          E  +V+  + ++ L  +  E+E     +++D F G        + +   PDL +AI K+              K +QLY   R   G++  GP+ +GK+T +   + A+                                      Q H    + P +     +MFG       D+ DG+F+ LWR   R  + + I WIV DG +   W +NL S+LDD  TL L +G R+P + N K VFE +++++ASP  VSR+G+V+  S+++ W  I   WL+N+ + E + L  +F      + ++ IQ+   ++ +    I  Q  + +L Q L+  KE GGEL   H++RL+VF  +WS+ + +   ++  +   L+      L LP+    +   +FD+YV   G W  W++ +    EY+    S    G +LV  +  +R  + +    +    V LIG +G+ K++I+  +  K D  +       +S  T     +  +E+ ++ R G  YG    K +++ I+D+N+P   E         NE++RQL+  N   N + P E   + D   + ++       + +  RL R F      +P  + +  I      G +  H    E  + T+    +L+  T++L++   + ++   T    H  FNLR ++ I  G+     +  S+  LLLQ W +  +RV  D      D+ WF++TL  +++     E     ++  +  F+ F  +   +   +  +          PK+   +   +S  E L   ++   E     S++++   + ++ +I I R I  P  G+ +L+G  GS    L+++ S         I    + N   L++ +K + R  G +GK  + + T   +K    L+ +N+++ SG+   LF  DE+  ++S +   MKRE       TN +L E F SR+R++LH++LC  P  +       K+P ++S   ++W        L+A + +F+  S  +ID  L  + +        +D +A+  A+  +   + T VTP
Sbjct: 1028 VLSTSINSTKKEIMNALERFSIYHHIWKK-----DREETIQKFIQGNPFLSEFESQILYYRDLELEINAEPEFISVGALALYTVDLKLALTAETKSWMVDFGQYCNRKYRMEMEQIFTFIDEASKKLNRQIKDLDDIRIAMATLKEIREHQISIDFQVGPIEESYSMLHKYGLLIAKEEAEKVDTLRYTWEKLLSRSTEVQNELVSLQPK-FRGELIKNVETFVEDCQHF--YHDYDRVSPEGQLHFQAQTQLFS-----CIYIPLGYITFTGGEELFGLPVTQHPQLLEIRKQLTLLQKLYGLYNSVIDTVNGYYDISWADIHIDRINNELLDFQARCRKLPRGLKEWQAFMDLKKTIDEFSECCPLLDLMTNKAMMTRHWKRITEVTGHTFEVETDNFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVIAEWDNKTFTFAQFKTRGELLLRGDSTSEIITNMEDSLMVLGSLMSNRYNTPFKAQIQKWVQNLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQSCVGDE-TMGQLLPHLLEQLEMCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNIFDNIKCVR----FHEKM-YDKILAISSREGETIELDKPVIAEGNVEVWLNALLKESQRSLHLVIRQAALAIQDSGFELIEFLDSFPAQVGLLGIQMIWTKDSEDALSNARYDRKIMSKTNQFF--------LELLNNLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIKSPTDFEWLKQCRF-------YFNEDSDKMMINIT-DVGFVYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRKNFIFTDGDNVEMNPEFGIFLTMN-PGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRA-------------------------------------------NPNDT----------ESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGI------QLDKAGYPDLESAIDKQVTEAGLINHPPWRLKVIQLYETQRVRHGMMALGPSGAGKTTCIHTLMKAMTD----------------------------------CGQPHREMRMNPKAIT-APQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHI-WIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIENASPATVSRNGMVFMSSSVLNWSPILEGWLKNRSAQEGMVLKDLFSSSFPELYRFSIQSLQYKMEMLEAFIIMQ-CINML-QGLIQPKEQGGELSREHMERLYVFALMWSVGALLELDDRMKLERWLRNHDSIHLDLPNIPPHSEDTMFDFYVTNDGHWVHWNTRV---EEYIYPPDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYMSKYDPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVT---NEIVRQLMEQNGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDVPQRLKRQFSIFNCTLPSNASIDKIFGVIGTGHYCSHRGFSEEVRNTV---GRLVPLTRRLWQ--MTKVKMLPTPANFHYIFNLRDLSRIWQGMLGVTAEVISTPQLLLQLWKHECKRVIADRFTAPEDVAWFDSTLAKLVEEQLGEEEREVVDLGVDSYFVDFLRDAPEATGDEPEE-----TDFDMPKVYEPIESFDSLMERLNMFLSHFNESIRGASMDMVFFRDAMIHLIKISRIIRTP-RGNALLVGVGGSGKQSLTRLASFIAGYKTFQITLTRSYNTANLMEDLKGLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEIISDLIPVMKREFPRRPP-TNENLHEYFMSRVRQNLHVVLCFSPVGERFRNRALKFPALISGCTMDWFSRWPKDALIAVSEHFL--STYDIDCTLEVKSEVVQCMGSFQDGVAEKCADYFQRYRRSTHVTP 3076          

HSP 2 Score: 97.8265 bits (242), Expect = 4.515e-19
Identity = 78/290 (26.90%), Postives = 135/290 (46.55%), Query Frame = 3
Query: 2013 KTSEMHEEIMNNFDKTFSIFLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGV-ICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQV 2879
            +TSE+H ++    D TF    N        T  AL ++ KF+    R  I  + I  K   +  NF  DI      Y + K      P +      + W ++L S I+ PM  FQ +  +    + + I++ YN+V+K L+  +  Y + W++  +   A L+  LLV      ++ +N    +L  I ET  M+ +   + P A  L + +   K  ++KL   +  F+ V  S  P    L   H+  V +    G +SL+WT++NID +L ++ A + NLE ++++V
Sbjct:  476 QTSELHNQLKTFMDNTFDKIQN--------TERALYVLKKFE----RLGIPDLGISDKYQRILQNFGRDIEMISRIYNKQKTDPPIAPDLPPTAGKILWARQLYSRIQEPMDLFQQLPGLLSTPDAKPIIRNYNRVAKVLLEFEVLYHHSWMAQTEAVKAGLQASLLVKSPETGQLFVNFDPQILTQIRETDCMLGMGLDIPPFAAILQQKKEVFKKNYNKLQ--LKRFDRV--SWKPAFEQLLMPHVAKVDEAILPGLTSLNWTSLNIDKYLCRITAALDNLELLLHRV 749          

HSP 3 Score: 88.5817 bits (218), Expect = 2.682e-16
Identity = 139/577 (24.09%), Postives = 272/577 (47.14%), Query Frame = 3
Query: 11523 LVENIKPMEEKWQTMSKQYEDE-RAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASA--RSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVIS--YSDLHNRLESCLASGQCMIIADCDIH-QLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLK-MYEEINANLQ---QKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFD-SMIESSE------RLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLI---SPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTV 13193
            L+  +   +E+W  +SK++  + + +    L+++A+L+Y GP N E R+  L         R     TN      + +T+ L     +S+     LP  +  I N   +   +  R  +LI  QT+  I W+          + S  +    N LE  L+ G+ ++I D       A D ++ +       F+K   T+K+ +  + EV+    FRL++ T          +++ T ++ F  ++  L ++ L R I   K  ++ E   LL +    KRK+ +LE+ +L  L++   ++   E+  T++   K   EE+   LQ   + E   ++ +   + Y  +A R + ++ + + M+ V   Y     ++L LFD S+ +SS+      R++N  II+ +T +  +Y+   + +E+KF+F+LLL+++I   +N V+   +E+L      +S+ LK+ P              K   W+ + + +N+  L+  L  F DIL+ + +  K+  W+  FD E+PE   I    +  ++D +++L LIR+  PDR +  +  +I  ++  ++   V
Sbjct: 3393 LISGLAGEKERWTQLSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLTDWQREMKFRQIPFRTN------LNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAA--RFPLLIDPQTQGKI-WIKNKESKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEK------NFIKTGFTYKVKI-GDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKERTDLLEDVTANKRKMKELEDNLLFRLTSTQGSLVDDESLITVLGNTKRTAEEVTQKLQIAAETEIQINAAR---EEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLTKSSKSPITSKRIAN--IIEYMTFEVHKYAARGLYEEHKFLFTLLLTLKIDMQSNRVK--HEEFLTLIKGGASLDLKACP-------------PKAAKWILDITWLNLVELSK-LWQFSDILDQIGRHEKQ--WRSWFDREAPEEEPI-PNAYDQALDCFRRLLLIRSWCPDRTIAQARKYITQSMGERYAEGV 3929          

HSP 4 Score: 75.485 bits (184), Expect = 2.244e-12
Identity = 48/156 (30.77%), Postives = 80/156 (51.28%), Query Frame = 3
Query:  639 DPLKQFETFVTDVMSEIEVILEEVND-RTSEQDIFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIR 1103
            D L++ E  +   + +IE +L E +  R    D+    E++ W+ R      L+ QLK    K  +G L+  KSK+IK WR+L+  IT+A N +KD +KYL T +  C  +  Y S P  ++  +P +   ++   S SR ++ S  + S    +R
Sbjct:  235 DALEKIEACMKTWIKQIEQVLAESDQLRKEADDLGPRAELDHWKKRMSRFNYLLDQLKSPEVKAVLGVLLVAKSKLIKVWRELDIRITDAANEAKDNVKYLYTLEKFCDPL--YNSNPVSMVEAIPGLINAIRMIHSISRYYNTSEKITSLFVKVR 388          

HSP 5 Score: 66.2402 bits (160), Expect = 1.756e-9
Identity = 48/199 (24.12%), Postives = 91/199 (45.73%), Query Frame = 3
Query: 14586 QVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPI---LNITISKEGITSSK---WMLRGV 15164
            ++P +W         ++  +   W + LL + +     I   +    C+W+  F  P+  L   ++E++    R ++      +    E T   KD I +PP++G+YV+GL+L G G+D+   +L D   K +   +PV  +    N +   +++  Y  PI+      ++P+   LN   + +  TS     W+LRGV
Sbjct: 4340 RIPARW-----KKASWASTTLGFWFTELLERNRQFHSWIFEGRP--NCFWMTGFFNPQGFLTAMRQEIT----RANKGWALDRMVLCNEVTRWMKDDITQPPAEGVYVYGLYLEGAGWDRRNCKLIDSKPKVLFEMMPVIRMYAENNGV---KDARLYSSPIY------KKPVRTDLNYIAAVDLRTSHPPEYWILRGV 4518          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: si:dkeyp-86b9.1 (si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-163])

HSP 1 Score: 444.891 bits (1143), Expect = 4.912e-124
Identity = 469/2142 (21.90%), Postives = 900/2142 (42.02%), Query Frame = 3
Query: 3666 LWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENEL---INLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLV----FQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEI-KSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDL--GYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQ-------KSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNR---NDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQN--HKELSINSVTIAFQNSLKVLSQM------LVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSI------------CIFDYYVDES-GEWDLWSSLLMDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWR--KSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETS---NDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNHS 9950
            LWK+    +  E+  AKK +     EK    + + N + + P       + ++ +     +   +  W    G+ L+D A+  L         + E LK+    LE L  +L  +  I D+ L ++      +  Y  L ++   I+ + E E+    N+   W+ L  M   Q ++ L + +  F +    Q++++  E+  F   F+   P   G D  +  + + ++  +    E ++  L    KLF L +  + EL ++++++  L Q+Y +++   + +  ++  LW  +D+  +   +  F      LP   +       L+G++    +   +L +L +K +R RHW  +M+ TG NF++   TF   ++  + L +    I  I   A KE+ +E  + ++EE W          F+     G ++  V   + +LQ L+D  + L +M  S  + P      QW   L  ISE +++W+ VQQ W+ LE++FI   I   L +E K+F+ +DK++ K M    +   + +CC+    ++   L+N+  GLE C  SL  YL  KRN F R +F+ D  +LSIL  S++   +  H+  ++  +  L  D      +  + + S+  E + L   +  +  V +W+  +  E+  +   ++ +AI + S   S  +    +   +  +   + W+ E+      + + +K++L   AKK + QI+ +         K   +P+    RR++ ++ +  ++ RD + +     I D  +FE    ++           +  +L    C+     GYE+ G    +  TP T++  LTL  +L      +  G + +GK+   ++LA+      V  +C   M   ++   + G+A  G WG  D    +D S LS+    I  I++A+         +   +S+  + GI + +   +   + LP ES + L        FR V +  PDL QI +       + V++ LA ++  + K A   +++       LR++ + L  A   K+                                   SP  S                   E  +++ A+ ++ LP    E+      ++ D F G        ++     D + AI++E    R  +    ++K VQ+Y  +      ++ GPT  GKS  ++    +   L                                LL +   +YS+ P +     E++G       D+ DG+ + ++R +N+        +I+FDG +   W +N+ S++DD   L L +G R+    +   +FE+  ++ ASP  VSR G+V+     + +      W+ ++   E   L K+F+K +   I  I+      + +    T+  Q  L ++ Q+      L++N++   E  ++  F+     SL + + D  +Q     +K+ + +    D  +             ++D++ D +  +W  WSS++        ++   ++LV T+ T RA + L+   +    V L+G  G+ K+  + N      +D T M    F  S  T S  L+  LEAN+E R    +G    K L + ++DLN+P+   +D    ++P  +L+ LL+   + +         + D   I ++       + +DPR +  F    I  PE   L  I   +   H    E C   I    +L   T +LY+ +   L    T  + H  FNLR ++ +  G+   N +   +    ++ W     RVF D LI +TD       +Q  ++N+                  F ++ DS+     L     TA  S P++   + D ++ +      +  + E   K  +NL+  D+ L  +  IHR I +   GH +L+G  GS    +  +A   A   + ++  S   ++    D +K++  ++G E KK   L T  ++     L+ +N+++ SG  P LF  DE   +L+ ++    +        +   + + F ++   +LHI+L + P  D +      +PG+++  +++W        L A A  F+  S
Sbjct: 1155 LWKL-DKAIVMEKFAAKKPSCVMYDEKFQFYVKVSNEVAKQPMVKHEHIIRLNLEPLARAVQENIQVWVTSLGKLLNDSAREELFNLRNELLILSENLKRSPNTLEDLKFVLVTITDIRDMSLSVEMRINDAQERYRTLSMY---IVETTEEEMQLSANISILWNDLF-MESRQVDRSLVKVKKTFAEITLNQIEEYKQELFIFAESFNMHGPGAVGDDLEKGLQIMSTYETELVRVEARRQELAKAEKLFNLPITMYPELLNVQKEMRGLRQIYEIFKSQKEAKTEWSQTLWVNLDIQLLQEGIDGFIKSLRKLPKDARALPVSFFLEGRMKEFRESLPLLLDLKNKALRERHWKSLMERTGTNFEMNPNTFTLENMFAMELHKYGNVISEIVTSAVKELGIEKGVKEVEETWDSMKFTVHRYFKGTQEHGFILGAV---DDILQHLDDDAMNLQSMAGSHFVGPFLATVQQWEKNLSLISETIEVWMLVQQKWMYLESIFIGGDIRSQLPEEAKKFDNIDKTFKKIMTDTVKDPGIKRCCLVP--NRLADLQNLSDGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSEPTCVQEHMIKMYDNIAALRFDTGMNGEMVANALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRTNRLITKEAIYFYSHQKSRVDWMLDYQGMVVLATNQVWWTYEVEDVFRRMNEGEKQALKQYAKKMHQQINDLV--------KRITEPLKKNDRRKINTVLIIDVHARDIVDSFVRDSITDAREFEWESQLRFYWV------KEPDELFVRQCSAQFCYGYEYMGLNGRLVITPLTDRIYLTLTQALSMFLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKILSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALMLHLQRFHFEGQEISLDNRIGIFITMNPGYAGRTELP-ESVKAL--------FRPVVVIVPDLQQICEIMLFSEGFLVAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRG----------------------------------SPNLS-------------------EDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLD---CPRVRYPSFNDAVEAILEE---NRYIMMPSQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQSQTRLG-------------------------------LLTK---LYSLNPKAMS-VIELYGILDPVTRDWTDGILSNIFRDINKPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQSHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWEKWVNSRAPKEKADLCKLFEKYVPSAIDMIVDGVVDGKQTEKLKTVILQTDLNMVMQLTVMVDSLLENEDFLFE-ELECCFLEALYCSLGASLLDKGRQKFDAFIKKLSSLNSVHDEKVLAGPGEIPVYLPTLYDFHFDGTQKKWVPWSSMVSKYIHNPEMKFI-DILVPTVDTTRANWLLEQMVKVKRPVVLVGESGTSKTATIQNFLSNLNTDTTIMMTINF--SSRTTSMDLQRTLEANVEKRTKDTFGPPMGKRLLVFMDDLNMPR---VDEYGTQQPIALLKLLLDRGGMYDRGKELNYKLIKDLGFIAAMGKAGGGRNEVDPRFISLFSVFNIPFPEEESLHLIYSSILRGHTKPFEECIRNI--CDKLTFCTLELYKTIIKDL--PPTPSKFHYIFNLRDLSRVYHGLTLTNPERFCTVTQFVRVWRNECLRVFHDRLINETD----KIMVQGHVKNLVEEH--------------FKSDLDSAMRDPILFGDYRTALKSEPRVYEDILDYDASKALFQEILEEYNE--NKTKMNLVLFDDALEHLTVIHR-IIRMDRGHALLVGVGGSGKQSLTKLAAFTAGYEVFEIVLSRGYSETNFRDDLKTLYLKLGIENKKMVFLFTDAHVAEEGFLELINNMLTSGMVPALFADDEKESVLNQLRDEAMKSGCGP---SKESIWQYFVNKSANNLHIVLAMSPVGDTLRTRCRNFPGLVNNTSIDWFSPWPLQALYAVAKSFLGES 3133          

HSP 2 Score: 117.087 bits (292), Expect = 6.564e-25
Identity = 147/644 (22.83%), Postives = 288/644 (44.72%), Query Frame = 3
Query: 11397 EFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERA-IFIQCLISSAYLAYCGPLNFEQRSKFL-DFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSD--LHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLS----NGIRNVKSIEN-------CNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSERLSN-------KSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNES-KTSNSKKPFDWMSEESLMNVKILAACLPC-FKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLS--LRATSPSSAIL 13250
            E   ++KE R L  +Y G + ++ +++ E + +  RL     L+  +    ++W    ++ +  R  +   CLI +A+L+Y G  +++ R++ +     A     G+  ++       I   L  E+EIS+  S  LP  E  + N       S    + L  D  ++A++W+ +     N  + S++D      LE  +  G   +  D D +    D ++  V       +K  +  ++++  + EV+  PNF+L+L+T  +  +    +     ++++  ++  L ++ LS  +   +  ++ + ++L+ E  + KR L  LE+ +L +L+    N + NV+ I+         N + + LK+ E+   ++              D Y   A R A +F + + M  V   Y      +L +FD  +  S+ L N       K+IID LT+    Y    + + +K +FS  ++I+I +        QDE               F K N S + S  KK  DW+ ++   ++  L    P  F  + +++ K+ +E  WK  +D ++PE ++   + +K ++  +QKL LIR  R DR+ +A   ++  T+  K+   V P  I        +SP+S I+
Sbjct: 3436 ELGAIQKELRALGDKYEGAMTEKQLLQEEAEVMERRLVAADKLISGLASENKRWIKDLEELKQRRVRLLGDCLICAAFLSYEGAFSWDFRNEMVYKVWQADVLERGIPLSQ----PFRIENLLTDEVEISRWGSEGLPPDELSVQNGILTTRSS---RFPLCIDPQQQALNWVKKKEEKNNLKISSFNDPDFLKGLELAIKYGFPFLFQDVDEYI---DPVIDNVLEKN---IKGAEGRQVVVLGDKEVDYDPNFKLYLNTKLANPKFLPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLILETSENKRLLKDLEDSLLRELATSTGNMLDNVELIQTLDETKSKANEVFEKLKLAEKTAVDIDTLR----------DGYRPAAKRGAVLFFVLAEMALVSSMYQYSLASFLEVFD--LSLSKSLPNPILPSRLKNIIDTLTQNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAP--QDELEF------------FFKGNLSLEKSKRKKLLDWLPDQGWEDIIRLMELFPNEFGTLADDIEKNPEE--WKNWYDLDAPEQASFPMK-YKENLSPFQKLLLIRCFRLDRVYRAVSDYVTLTMGEKY---VQPPVISFEAIFDQSSPNSPIV 4034          

HSP 3 Score: 57.3806 bits (137), Expect = 8.187e-7
Identity = 62/389 (15.94%), Postives = 155/389 (39.85%), Query Frame = 3
Query: 2112 ALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKL--KNPLLVVDLVGN--------------------KVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAGMHSEFSKLLKYLATQKIYNFNHLLSKNWDSNEFTEAINKDLLAKKSTVQRTLEACSNILKEITEIISIVEKLDPNSSLYESEDLIFGQMKEMYNKSLSQSLYRSIINNL 3212
            A  ++ KF  ++ R +I   +  K  ++   +  ++    + + +FK+          +   + W + LL  +  PM RF++ +++   +E +++  ++ +V+  +  ++    N W +  +  +  L  K+ L++V+  G                     +  +N P  L  II+E + + RI   L      +   E     + + L + V  +  +  ++      L  + ++ + Q    G   ++W  + I  F+ +        ES+ NQ+     +    LK + +  ++ F        D   +   I +     +S   +T+    N+   I+ +++ +E L   +S  +++ +   Q    + + +  SL + +  N+
Sbjct:  654 AFDLLLKFKNIRCRDAINDQLMKKFSDILAQYCKEMVLINDIFVKFKDNPPLSKNHPPMAGAIIWQRFLLDQMRYPMKRFREDRDLMNNQEGKAVESKFIEVASRMRQYEVDLYNKWKADTNQTLPILMRKSLLVMVNSYGTVCADSTRHRTGSEKVLERDVRFSVNFPPELQEIISEAKCLDRIGIVLPDELQNVALQEEVFLRYINGLKKLVRRYHLLMDNLNDAEFLLMADQVQELRQVLSVGCKRINWNNLGIPQFIQRGNQAASKFESLENQIQKNERDIDDKLKSIESANLFKFPLA-----DQTGYLPGIREFCEFIESERAKTVNLLVNMYAAISPLLTKMESLIMGTSTGKAKGM--AQFYAYWERKIFDSLTKMVFQNI 1035          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: DNAH10 (si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-163])

HSP 1 Score: 444.891 bits (1143), Expect = 4.912e-124
Identity = 469/2142 (21.90%), Postives = 900/2142 (42.02%), Query Frame = 3
Query: 3666 LWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENEL---INLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLV----FQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEI-KSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDL--GYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQ-------KSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNR---NDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQN--HKELSINSVTIAFQNSLKVLSQM------LVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSI------------CIFDYYVDES-GEWDLWSSLLMDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWR--KSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETS---NDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNHS 9950
            LWK+    +  E+  AKK +     EK    + + N + + P       + ++ +     +   +  W    G+ L+D A+  L         + E LK+    LE L  +L  +  I D+ L ++      +  Y  L ++   I+ + E E+    N+   W+ L  M   Q ++ L + +  F +    Q++++  E+  F   F+   P   G D  +  + + ++  +    E ++  L    KLF L +  + EL ++++++  L Q+Y +++   + +  ++  LW  +D+  +   +  F      LP   +       L+G++    +   +L +L +K +R RHW  +M+ TG NF++   TF   ++  + L +    I  I   A KE+ +E  + ++EE W          F+     G ++  V   + +LQ L+D  + L +M  S  + P      QW   L  ISE +++W+ VQQ W+ LE++FI   I   L +E K+F+ +DK++ K M    +   + +CC+    ++   L+N+  GLE C  SL  YL  KRN F R +F+ D  +LSIL  S++   +  H+  ++  +  L  D      +  + + S+  E + L   +  +  V +W+  +  E+  +   ++ +AI + S   S  +    +   +  +   + W+ E+      + + +K++L   AKK + QI+ +         K   +P+    RR++ ++ +  ++ RD + +     I D  +FE    ++           +  +L    C+     GYE+ G    +  TP T++  LTL  +L      +  G + +GK+   ++LA+      V  +C   M   ++   + G+A  G WG  D    +D S LS+    I  I++A+         +   +S+  + GI + +   +   + LP ES + L        FR V +  PDL QI +       + V++ LA ++  + K A   +++       LR++ + L  A   K+                                   SP  S                   E  +++ A+ ++ LP    E+      ++ D F G        ++     D + AI++E    R  +    ++K VQ+Y  +      ++ GPT  GKS  ++    +   L                                LL +   +YS+ P +     E++G       D+ DG+ + ++R +N+        +I+FDG +   W +N+ S++DD   L L +G R+    +   +FE+  ++ ASP  VSR G+V+     + +      W+ ++   E   L K+F+K +   I  I+      + +    T+  Q  L ++ Q+      L++N++   E  ++  F+     SL + + D  +Q     +K+ + +    D  +             ++D++ D +  +W  WSS++        ++   ++LV T+ T RA + L+   +    V L+G  G+ K+  + N      +D T M    F  S  T S  L+  LEAN+E R    +G    K L + ++DLN+P+   +D    ++P  +L+ LL+   + +         + D   I ++       + +DPR +  F    I  PE   L  I   +   H    E C   I    +L   T +LY+ +   L    T  + H  FNLR ++ +  G+   N +   +    ++ W     RVF D LI +TD       +Q  ++N+                  F ++ DS+     L     TA  S P++   + D ++ +      +  + E   K  +NL+  D+ L  +  IHR I +   GH +L+G  GS    +  +A   A   + ++  S   ++    D +K++  ++G E KK   L T  ++     L+ +N+++ SG  P LF  DE   +L+ ++    +        +   + + F ++   +LHI+L + P  D +      +PG+++  +++W        L A A  F+  S
Sbjct: 1155 LWKL-DKAIVMEKFAAKKPSCVMYDEKFQFYVKVSNEVAKQPMVKHEHIIRLNLEPLARAVQENIQVWVTSLGKLLNDSAREELFNLRNELLILSENLKRSPNTLEDLKFVLVTITDIRDMSLSVEMRINDAQERYRTLSMY---IVETTEEEMQLSANISILWNDLF-MESRQVDRSLVKVKKTFAEITLNQIEEYKQELFIFAESFNMHGPGAVGDDLEKGLQIMSTYETELVRVEARRQELAKAEKLFNLPITMYPELLNVQKEMRGLRQIYEIFKSQKEAKTEWSQTLWVNLDIQLLQEGIDGFIKSLRKLPKDARALPVSFFLEGRMKEFRESLPLLLDLKNKALRERHWKSLMERTGTNFEMNPNTFTLENMFAMELHKYGNVISEIVTSAVKELGIEKGVKEVEETWDSMKFTVHRYFKGTQEHGFILGAV---DDILQHLDDDAMNLQSMAGSHFVGPFLATVQQWEKNLSLISETIEVWMLVQQKWMYLESIFIGGDIRSQLPEEAKKFDNIDKTFKKIMTDTVKDPGIKRCCLVP--NRLADLQNLSDGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSEPTCVQEHMIKMYDNIAALRFDTGMNGEMVANALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRTNRLITKEAIYFYSHQKSRVDWMLDYQGMVVLATNQVWWTYEVEDVFRRMNEGEKQALKQYAKKMHQQINDLV--------KRITEPLKKNDRRKINTVLIIDVHARDIVDSFVRDSITDAREFEWESQLRFYWV------KEPDELFVRQCSAQFCYGYEYMGLNGRLVITPLTDRIYLTLTQALSMFLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKILSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALMLHLQRFHFEGQEISLDNRIGIFITMNPGYAGRTELP-ESVKAL--------FRPVVVIVPDLQQICEIMLFSEGFLVAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRG----------------------------------SPNLS-------------------EDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLD---CPRVRYPSFNDAVEAILEE---NRYIMMPSQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQSQTRLG-------------------------------LLTK---LYSLNPKAMS-VIELYGILDPVTRDWTDGILSNIFRDINKPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQSHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWEKWVNSRAPKEKADLCKLFEKYVPSAIDMIVDGVVDGKQTEKLKTVILQTDLNMVMQLTVMVDSLLENEDFLFE-ELECCFLEALYCSLGASLLDKGRQKFDAFIKKLSSLNSVHDEKVLAGPGEIPVYLPTLYDFHFDGTQKKWVPWSSMVSKYIHNPEMKFI-DILVPTVDTTRANWLLEQMVKVKRPVVLVGESGTSKTATIQNFLSNLNTDTTIMMTINF--SSRTTSMDLQRTLEANVEKRTKDTFGPPMGKRLLVFMDDLNMPR---VDEYGTQQPIALLKLLLDRGGMYDRGKELNYKLIKDLGFIAAMGKAGGGRNEVDPRFISLFSVFNIPFPEEESLHLIYSSILRGHTKPFEECIRNI--CDKLTFCTLELYKTIIKDL--PPTPSKFHYIFNLRDLSRVYHGLTLTNPERFCTVTQFVRVWRNECLRVFHDRLINETD----KIMVQGHVKNLVEEH--------------FKSDLDSAMRDPILFGDYRTALKSEPRVYEDILDYDASKALFQEILEEYNE--NKTKMNLVLFDDALEHLTVIHR-IIRMDRGHALLVGVGGSGKQSLTKLAAFTAGYEVFEIVLSRGYSETNFRDDLKTLYLKLGIENKKMVFLFTDAHVAEEGFLELINNMLTSGMVPALFADDEKESVLNQLRDEAMKSGCGP---SKESIWQYFVNKSANNLHIVLAMSPVGDTLRTRCRNFPGLVNNTSIDWFSPWPLQALYAVAKSFLGES 3133          

HSP 2 Score: 117.087 bits (292), Expect = 6.564e-25
Identity = 147/644 (22.83%), Postives = 288/644 (44.72%), Query Frame = 3
Query: 11397 EFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERA-IFIQCLISSAYLAYCGPLNFEQRSKFL-DFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSD--LHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLS----NGIRNVKSIEN-------CNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSERLSN-------KSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNES-KTSNSKKPFDWMSEESLMNVKILAACLPC-FKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLS--LRATSPSSAIL 13250
            E   ++KE R L  +Y G + ++ +++ E + +  RL     L+  +    ++W    ++ +  R  +   CLI +A+L+Y G  +++ R++ +     A     G+  ++       I   L  E+EIS+  S  LP  E  + N       S    + L  D  ++A++W+ +     N  + S++D      LE  +  G   +  D D +    D ++  V       +K  +  ++++  + EV+  PNF+L+L+T  +  +    +     ++++  ++  L ++ LS  +   +  ++ + ++L+ E  + KR L  LE+ +L +L+    N + NV+ I+         N + + LK+ E+   ++              D Y   A R A +F + + M  V   Y      +L +FD  +  S+ L N       K+IID LT+    Y    + + +K +FS  ++I+I +        QDE               F K N S + S  KK  DW+ ++   ++  L    P  F  + +++ K+ +E  WK  +D ++PE ++   + +K ++  +QKL LIR  R DR+ +A   ++  T+  K+   V P  I        +SP+S I+
Sbjct: 3436 ELGAIQKELRALGDKYEGAMTEKQLLQEEAEVMERRLVAADKLISGLASENKRWIKDLEELKQRRVRLLGDCLICAAFLSYEGAFSWDFRNEMVYKVWQADVLERGIPLSQ----PFRIENLLTDEVEISRWGSEGLPPDELSVQNGILTTRSS---RFPLCIDPQQQALNWVKKKEEKNNLKISSFNDPDFLKGLELAIKYGFPFLFQDVDEYI---DPVIDNVLEKN---IKGAEGRQVVVLGDKEVDYDPNFKLYLNTKLANPKFLPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLILETSENKRLLKDLEDSLLRELATSTGNMLDNVELIQTLDETKSKANEVFEKLKLAEKTAVDIDTLR----------DGYRPAAKRGAVLFFVLAEMALVSSMYQYSLASFLEVFD--LSLSKSLPNPILPSRLKNIIDTLTQNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAP--QDELEF------------FFKGNLSLEKSKRKKLLDWLPDQGWEDIIRLMELFPNEFGTLADDIEKNPEE--WKNWYDLDAPEQASFPMK-YKENLSPFQKLLLIRCFRLDRVYRAVSDYVTLTMGEKY---VQPPVISFEAIFDQSSPNSPIV 4034          

HSP 3 Score: 57.3806 bits (137), Expect = 8.187e-7
Identity = 62/389 (15.94%), Postives = 155/389 (39.85%), Query Frame = 3
Query: 2112 ALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKL--KNPLLVVDLVGN--------------------KVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAGMHSEFSKLLKYLATQKIYNFNHLLSKNWDSNEFTEAINKDLLAKKSTVQRTLEACSNILKEITEIISIVEKLDPNSSLYESEDLIFGQMKEMYNKSLSQSLYRSIINNL 3212
            A  ++ KF  ++ R +I   +  K  ++   +  ++    + + +FK+          +   + W + LL  +  PM RF++ +++   +E +++  ++ +V+  +  ++    N W +  +  +  L  K+ L++V+  G                     +  +N P  L  II+E + + RI   L      +   E     + + L + V  +  +  ++      L  + ++ + Q    G   ++W  + I  F+ +        ES+ NQ+     +    LK + +  ++ F        D   +   I +     +S   +T+    N+   I+ +++ +E L   +S  +++ +   Q    + + +  SL + +  N+
Sbjct:  654 AFDLLLKFKNIRCRDAINDQLMKKFSDILAQYCKEMVLINDIFVKFKDNPPLSKNHPPMAGAIIWQRFLLDQMRYPMKRFREDRDLMNNQEGKAVESKFIEVASRMRQYEVDLYNKWKADTNQTLPILMRKSLLVMVNSYGTVCADSTRHRTGSEKVLERDVRFSVNFPPELQEIISEAKCLDRIGIVLPDELQNVALQEEVFLRYINGLKKLVRRYHLLMDNLNDAEFLLMADQVQELRQVLSVGCKRINWNNLGIPQFIQRGNQAASKFESLENQIQKNERDIDDKLKSIESANLFKFPLA-----DQTGYLPGIREFCEFIESERAKTVNLLVNMYAAISPLLTKMESLIMGTSTGKAKGM--AQFYAYWERKIFDSLTKMVFQNI 1035          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: dnah7 (dynein, axonemal, heavy chain 7 [Source:ZFIN;Acc:ZDB-GENE-070912-282])

HSP 1 Score: 384.03 bits (985), Expect = 1.382e-105
Identity = 410/1839 (22.29%), Postives = 770/1839 (41.87%), Query Frame = 3
Query: 4638 LKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILL-------MNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAI---KDEVVNWLNLLTXXXXXXXXXXXXDAIK-YISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVG-TNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIP-PD---LLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWR--RVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENK----RSIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGELHIQRL------------FVFCFIWSLNSQISD--------LNKQAITTLLKRET----------------LVLP-DDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSL-ILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLATNSSA-DLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHID-SIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERN--FITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKF---GKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVALI---DSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQI-SMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFV 9941
            +K +++   +   I+  L +  +R RHW  +  V G   +        +    + L  +    + I   A KE  LE  + ++  EW         +   G          S+L  L++ Q+LL         M  S  I+P + E   W  KL+ + E++D WL+VQ  WL LE +F +P IM  + +E +RF  +DK++  +M++V   K+V       +   K  +K+  + LE     L  YL +KR  F R +F+ +  +L IL+ + D   +  HL   F  +  +     F + L I  + SS  E + L + I+    + +V  WL  L N +  SI  +   A + Y++  D      + +P Q       ++W+ +I+ A+++     K+L    ++ NTQI  I +TL R         ++   R  L ++ +  ++ RD L +L  K + D  +FE   + +++   +++  + K   A L      GYE+ G+ P +  TP T++   TL  +L      +  G + +GK+   ++LA+   +  V  +C   +   +L  F  G+ S G W   D    +D   LS+    I  I+  I   SA   ++  EG  L++  T   F +  P  +    LP N+   FR VA+  PD   I +       +  +R L++++    +  S  ++        +R++ + L                       T  G+  ++F                                ++E  L++ +II++ LP     +    + I  D F G            +P PD   LL AI + +      ++    EK +Q+Y ++    G +L G    GK+++  +  AALN + E      N + ++                            I P S     +++G +     ++ DG+    +R   ++++    W++FDG +   W +N+ ++LDD   L L  G  +  S  +  +FE   ++ ASP  VSR G++Y   +M+GWR +   WL        S+    +T +FD++L   +Q I +  KELS  S T   ++ + ++  M+    E G E  ++R+            FVFC +WS+ +  ++        L ++ +   L  ET                L +P   + ++  + +  +  G W+LW+  L             E++V T  T+R    + +          +GP G+GKS+ ILD    + +    +     +S  T ++Q ++ + + ++ R+  ++G    K + + ++D+N+P     ++   + P E+LRQ L+     + K     + L D  I+ ++       + + PR +RHF  + I   +   + +I   + + H+       +      SQ+ISAT  +Y++ T  L    T  + H  FNLR  + +  GI     ++      + + W +   RV+ D L+   D  W    LQ         E+S  ++N + +  F    +  D      DL+++        PK            E L   +  H E++    K  +NL+     +  +  I R + +P  GH +L+G  GS    +  +A  +A+  + ++E S    +    D +K I+++  S       L T   +K    L+ +++L+ +G+ P LF  DE   +   +++   +R++   T  +   L   F  R R  LH++L + P  D     L ++P +++   ++W +   +  L A A+ F+
Sbjct:  804 VKAEVEAFKEHIPIVQVLCNPGLRERHWEAMSAVVGFPLKPSEEDACVAHFLPLHLEAHLSAFESISEGASKEHGLEKAMERMVSEWAGMEFTLLPYRETG---------TSILSSLDEVQMLLDDHIVKTQTMRGSPFIKPFEAEIRDWEDKLLLLQEIMDEWLKVQGTWLYLEPIFSSPDIMAQMPEEGRRFTAVDKTWRDTMKQVSLDKHVLAVVAIEKMLDK--MKHSNELLELILKGLNEYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASV----VFTDVLDITHMRSSEGEVVELLDIISTSKARGQVEKWLLELENGMLRSIHKVIGKACEAYLN--DLRINWVRAWPGQTVLCVSQVYWTKDIHEAIAK---GPKALQAYLEQNNTQIDDI-VTLVRGK-------LSKQNRVTLGALVVLDVHARDVLASLVQKGVDDETNFEW--LSQLRYYWIENQLHTKMINAGLA----YGYEYLGNTPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAIAKQCVVFNCSDGLDYIALGKFFKGLLSAGAWACFDEFNRIDLEVLSVVAQQILTIQRGI---SAHAEMLLFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYALIAEIVLYSCGFVRARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVL-----------------------TAAGNLKLKF------------------------------PEENEDVLLLRSIIDVNLPKFLAHDLPLFEGITSDLFPGIK----------LPKPDYSVLLEAIRENSAKMNLQVTDFFAEKILQIYEMMIVRHGFMLVGEPFGGKTSAYRVLAAALNDICEKNLMEENRVQIT---------------------------VINPKSITM-GQLYGQFDPVSHEWSDGILAVSYRAFAISQSPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMSLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPVMLSWLNTVPSTLSSMHKDLITGLFDRMLPACLQLIRKGTKELSPTSNTSLVKSLMNLMDCMM---DEFGDESQMKRMDQRDVCSWLEGIFVFCLLWSVGASCTEEGRVKFDGLVREMLVGGLSEETRTRHGILEHVEPPAKQLTVPLPTEGTLYEYRFLKEGPGRWELWTEELKAFPPIPKDVQFNEIIVPTENTVRYNALMKLLITHQKPTVFVGPTGTGKSVYILDFLLNRLEKDVYSPLLINFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKKMVVFVDDVNMPAR---ETYGAQPPVELLRQWLDHWNWYDMK-DCSMINLVDIQIMCAMGPPGGGRNPVTPRFLRHFNTVTINEFDNKTMFTIFSRILDWHLTIRFPFPKPFASVTSQIISATMSVYQEATKNLL--PTPAKSHYLFNLRDFSRVIQGICLSRPETADDLTAIKRLWVHEVLRVYYDRLVHPDDCAWMVGFLQ---------EVSKSHLNEDFHQLFKHLDSNSDGLVTEDDLRSL-MFCDFHDPKGEDRNYREVGDAEKLRQVVETHLEEYNNISKAPMNLVLFRFAIEHVCRISRILKQP-RGHALLVGVGGSGRQSLTRLAAHMAEAELFQVEISKSYGVSEWRDDLKLIMQKSTSGDTHGVFLFTDTQIKMESFLEDVSNLLNTGEVPNLFAVDEKQEICERMRVLDRQRDRDKQTDGSTLALFNMFLERCRSQLHVVLAMSPIGDTFRSRLRRFPALINCCTIDWFQSWPEDALQAVASRFL 2494          

HSP 2 Score: 137.117 bits (344), Expect = 5.430e-31
Identity = 276/1252 (22.04%), Postives = 536/1252 (42.81%), Query Frame = 3
Query: 11610 LISSAYLAYCGPL--NFEQRS--KFLDFCVASARSSGLVTNRFGCSK-IEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRY----LIHYNPVVISYSDLHNRLESCLASGQCMIIADC--DIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHT-CSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSID----NYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSERLSNKSIIDKLTKKTSQYSLL-----SMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLSLRAT----------SPSS---AILMKY-----LNNSYETNILFNQIHSSVKPRIIQSRVIDYSKEGLQLFYQQLQNQMSNIHEICLDSSLTTSNLTALNSVYIVIHLSSTEHISSIHKRVMSYIDEMNSFQRSALLKSRDQNVVTYNLFFT-LPQNHSGVSSSQMN-KMTTVYLDYPSNLRDFLLHLFKIG------FLSANSIPSMSLDLLPVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFESHSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTS---NAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFE-SAEACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTIESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADV-SVVYSLLKNQVPEKWLNK-LCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQF-IRTDRSGNYKDVKCLIEF---TNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNIT-------IS---KEGITSSKWMLRGV 15164
            LIS+A +AY G    +F QR+  +++D C    +S G+      CSK + +   L   ++I       LP     IDNA  I N    R W L+ D   +A  WL        +H   + +S +D    LE+C+  G  +++ +   ++  + E  +++Q F       K+  +  I L  +  +E  P+FR ++ T   +   +P+V   +T L++F  +   + ++ L   + + +P ++ E + L+ +  + KR+L ++E+++L+ LS    N+   E   T ++ L   + +   + +K+ +    +  ID     Y  IA+  A +F   + + N++  Y      ++NLF   I++S++        ++ K    YSL      S+ +++K +FS  L++ + K    V+  +  +L++   V L  NP               P  W+ + S   +  L   +  FK + +++ +      WK ++DS+ P  ++     ++  +  +Q++ +IR LRPD+++     F+   L  +F   V P ++  +   +          SP S   A L+K+        +  T++   Q    +   +I++ V    KEG  +  Q       N H       L TS ++ L  V                       +E+N+          D     + L+ T  P  +  V+  Q   KMT    + P  LR  ++  F +       F  ++S P++   LL    +     ++ + R  +  LG+     I    N ++L   VQ++  + + +  I ++ LRY   E  YG +VT + DR T+ +I   + TS   N    +F+   L Y  P   Y+  ++++  K   LN SP +F  +A A      + T++  + IL+      +Q+ +   + +   D+      +FE+  ++ +KLP+        R    + N   +  L++E+  ++ +   I +     +K I    G  +  A++  VV S+LK ++P  W+ K   + K   GY     IS  L + + ++   ++    V  +W+  F   ++ L   ++  + ++ I  D          L+ F     +DK++ + PP DG+Y+ GL L G  +D+ T  L++   K +   +PV  +   +   D PE    Y  P++   T+++   L+ T       IS      +    W+ RGV
Sbjct: 2886 LISAAIVAYLGAFTSSFRQRATEEWIDMC----KSRGI-----PCSKNMSLMNSLGEPVKIRSWTIAGLPSDSFSIDNAIIISNA---RRWPLMIDPQGQANKWLKNMEKSNSLHV--IKLSDADFVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTF-------KQGGSVCIRL-GDSTIEYAPDFRFYITTKLRNPHYLPEVSVKVT-LLNFMITPEGMQDQLLGIVVARERPDLEEEKQALIVQGAENKRQLQEIEDKILEVLSASEGNILEDE---TAVQILSSSKVLANEISEKQAIAEVTELKIDQTRLGYTPIAIHSAILFFSIADLANIEPMYQYSLTWFINLFIMSIDNSQKSDLLEERLQILKDHFTYSLYCNVCRSLFEKDKLLFSFCLTVNLLKHNKLVDEKEWRFLLT-GGVGL-DNP------------HSNPCTWLPKTSWDEICRLDE-MERFKGLRKDLAR--LREGWKEVYDSKDPHHTDFPSE-WQEKLGQFQRMLIIRCLRPDKVVPMVQEFVSGNLGQQFI-EVPPFNLATAFADSHCCAPLIFILSPGSDPMAALLKFGEEQGFTGNRLTSLSLGQGQGPIAMSMIETGV----KEGTWVVLQ-------NCH-------LATSWMSTLERV----------------------CEELNA----------DTTHPDFRLWLTSYPSPNFPVAVLQNGVKMTN---EAPKGLRSNIIRSFCMDPISDPEFFDSSSKPAVFKKLL---FSLCFFHALTQERRKFGPLGW----NIPYEFNETDLRISVQQLHMFLDQYEEIPFDALRYMTGECNYGGRVTDDWDRRTLRTILSIFYTSEIINDADYKFDPSGLYYSPPEGDYNSYIEYT--KTLPLNPSPEIFGMNANADITKDQVETQLLFDSILL------TQSRSSGGSAASSDDM------VFEVAADILNKLPQDFDTDAAMRKYPTSYNQSMNTVLVQEMGRFNKLLQTIRDSCVNIQKAIK---GLVVMSAELEEVVSSILKGRIPAMWMKKSYPSLKPLGGY-----ISDFLERLKFLQDWYMDGMPAV--FWMSGFFFTQAFLTGGQQNYARRYTIPID----------LLSFDFEVMEDKEY-KNPPEDGVYIRGLFLDGARWDRRTKRLAESFPKILHDTMPVIWLK-PMKKQDIPERQ-CYISPVY--KTSERRGTLSTTGHSTNYVISMALNSDVPPEHWIRRGV 3993          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: ENSXETT00000035049.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 532/2157 (24.66%), Postives = 973/2157 (45.11%), Query Frame = 3
Query: 3591 IISLKYSESRLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFS-SSR--EEIVLNNKIAIKDEVVNWLN-LLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKF----NTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWR---RVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQN-HKELSINSVTIAFQNSLKVLSQMLVDNKEIGGEL---HIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLV-------LPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYL----SLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFV-----YSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQA-SQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRT---TAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETS---NDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            ++S   + ++ ++ + +E    +  +W+   D +  E+ ++     +  + +I     L+  +   P+ I +  + + T   +  L S    W    G++ + + +  ++    + E + ++L + + +L+ +   +  L +I +  + +D    PIE  Y  L  +EL + + E  ++  LR  W  L+      +N+L+  + N F  EL   ++ F  +  +F + ++   P + G  P E   +L  F+N++     K  T     +LFGL+V  + +L  +K+ L LL +LY LY    +    + D LWS V+++ +  +L EF + C  LP  LKE +++ +LK  ID   +   +L  +++K +  RHW ++  VTG +F +E  TFK  ++   PLL+ K+EI+ IC  A KE ++E KL Q+  EW  +   F +   RG ++L    T+ ++  +EDS ++L ++ ++R+  P K +  +W   L   +++++ W+ VQ LW+ LE VF+   I K L +E KRF  +DKS++K M R +E  NV QCC+ +E +    L ++ + LE C  SL GYL +KR LF R +FV D  +L IL  ++D   I  HL ++F  +  +     F E +  D+I S SSR  E I L   +  +  V  WLN LL          +   AI    +G  L E    FP+Q+    + + W+ +   A++  K DKK +    + F    NT I              T   +++++R +  ++    ++ RD   +L    I+   DFE  K  +       +  + K  +     T     EF G    +  TP T++  +TL  +L      +  G + +GK+   +++ R   +Y V  +C   M    L     G+A +G WG  D    +D   LS+A   I  +    K++       + + + +      F T   P  +    LP N+   FR VA+  PD   I++       +  +  LA + +T+ K     +++       LR+I++ L    A K+                                   +PT +                   E  +V+  + ++ L  +  E+E     +++D F       S  + +   P+L  AIIK+ +            K +QL+   R   G++  GP+ +GK+T +   + A+    E                    P      +P+ +                  +MFG       D+ DG+F+ LWR   R  R + I WIV DG +   W +NL S+LDD  TL L +G R+P + N K VFE +++ +ASP  VSR+G+V+  S+++ W  I   WL+ +   +   L K++      + ++ +Q+   ++ +    I  Q S+ +L Q L+ +K+ GGE+   H++RL+VF  +WS+ + +   ++  +   L+    V        P  D++  +FDYYV   G+W  W++ +    EY+    S    G +LV  +  +R  + +    +    V LIG +G+ K++I+     K  ++  N  R+V     +S  T     +  +E+ ++ R G  YG    K +++ I+D+N+P   E         NE++RQL+  N   N + P E   + D   + ++       + +  RL R F      +P  + +  I   +   H  S     + I +A  +LI  T+KL++   S +    T  + H  FNLR ++ I  G+ +   +      +L++ W +  +RV  D      D+ WF+ T   ++++ +     SG+   +  F+ F       R++ +   I T    A    PKI   +   N  ++ L   + +  E      ++++   + ++ ++ I R I  P  G+ +L+G  GS    +  +A  IA     ++  S   N   L++ +K + R  G +GK  + + T   +K    L+ +N+++ SG+   LF  DE+  + S +   MK+E       TN +L E F SR+R++LH++LC  P  +       K+P ++S   ++W        L+A + +F++
Sbjct:  709 VLSTSINSTKKEVLTALERFKSYHHIWQKDRDNV-IEKFVSGSPLLSEFESQILHFRDLELAINTEPEYICVGIIALFTADLKLALTSETKAWMVDLGRHCNKKYRSEMENIFVFIEEINKKLNRQIKDLDDIRIAMAALKEIREHQITLDFQVGPIEESYAMLNKYELLVAKEETEKVDTLRYTWEKLLVRGNEVQNELMAIQPN-FRGELISTVQTFIQDCSEFYSDYEMNGPMIVGLAPQEASDRLIMFQNRFDNLHRKYITYTGGEELFGLQVTQYPQLLEIKKQLNLLQKLYGLYNNVIEIVNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSNKAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIAEWDNKTFTFANFKTRGELLLRGDSTSEIIASMEDSLMILGSLMSNRYNTPFKAQIQKWVHYLSNTTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDE-TMGQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVR----FHEKV-YDRILSISSREGETIELEKHVMAEGNVEVWLNSLLKESQSSLHLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNAKYDKKIMQKTNQSFLDLLNTLIDM------------TTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYF----NEDSDKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVEMNPEFGLFLTMN-PGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRA----------------------------------NPTDT-------------------ESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFP------SIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMKAMTDCGE--------------------PHREMRMNPKAITA---------------PQMFGRLDVATNDWTDGIFSTLWRKTLRAKRGEHI-WIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQDANILRKLYSASFAELYRFSVQSLEYKMEMVEAFIIMQ-SINML-QGLIPSKDQGGEISAEHLERLYVFSLMWSIGAMLELDDRIKMEQWLRSLDSVHLDLPKIPPGSDDT--MFDYYVTTEGKWMHWNTSV---EEYVYPSDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVII-----KGFMSKYNPERYVTKCLNFSSATTPLMFQRTIESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVT---NEIVRQLMEQNGFYNLEKPGEFTNIIDVQFLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDIKEAVKKLIPMTRKLWQMTKSKML--PTPAKFHYIFNLRDLSRIWQGMLNSTSEVIKDTTVLIKLWKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQGQKSGDFAVDYYFVDF------LRDAPEATGIDTEPEDADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRIIRTP-RGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSRSYNTSNLMEDLKVLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRRPP-TNENLYEYFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLS 2720          

HSP 2 Score: 98.5969 bits (244), Expect = 3.928e-19
Identity = 145/600 (24.17%), Postives = 286/600 (47.67%), Query Frame = 3
Query: 11523 LVENIKPMEEKWQTMSKQYEDERAIFIQCL-----ISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTN-RFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVIS--YSDLHNRLESCLASGQCMIIADCDIH-QLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLK-MYEEINANLQ---QKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIE-------SSERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLI---SPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKF-KGTVTPSDIRLSLRATSPSSAIL 13250
            L+  +   +E+W   ++Q + E+  +  CL     +++A+L+Y GP N E    F +F +   R         FG + + + + L     IS+     LP  +  I N   +   +  R  +LI  QT+  I W+    I     + S  +    N LE  L+ G+ ++I D       A D ++ +       F+K   T+K+ +  + EV+    FRL++ T          +++ T ++ F  ++  L ++ L R I   K  ++ E   L+ +    KRK+ +LE+ +L  L++   ++   E+  T++   K   EE+   LQ   + E   +S +   + Y  +A R + ++ + + M+ V   Y     ++L LFD  +        +S+R++N  II+ +T +  +Y+   + +E+KF+F+LLL+++I   +N V+   +E+L      +S+ LK+ P              KP  W+ + + +N+  L+  L  F DILE + ++  E  WK+ FD E PE   ++   +  ++D +++L LIR+  PDR +  +  +I +++  K+ +G V   D+  +   ++P + ++
Sbjct: 3080 LISGLAGEKERW---TEQNKLEKYRYFLCLSGDVLLATAFLSYSGPFNQE----FRNFVLTDWRREMKARKIPFGVN-LNLNEMLIDTPTISEWNLQGLPNDDLSIQNGIIVTKAA--RYPLLIDPQTQGKI-WIKNKEIRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEK------NFIKTGSTYKVKV-GDKEVDVMNGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQGSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAR---EEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSAKSPITSKRIAN--IIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDMQSNRVK--HEEFLTLIKGGASLDLKACP-------------AKPSKWILDMTWLNLVELSK-LRQFSDILEQIARN--EKLWKLWFDKEYPE-EEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEGVVL--DLEKTWEESNPRTPLI 3635          

HSP 3 Score: 71.2478 bits (173), Expect = 6.864e-11
Identity = 44/163 (26.99%), Postives = 80/163 (49.08%), Query Frame = 3
Query:  717 RTSEQDIFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIRRQILSIINNKIQAIVGFNQAPEDLWKRVQDEICE 1205
            R    D+    E++ W+ R      L+ QLK    K  +G L + KSK++K WR L++ IT++ N +KD +KYL T +  C  +  Y S P  ++ ++P++   +    + SR ++ S  + S    +  Q+++   + I      N     +W + QD + E
Sbjct:   26 RKEADDLGPRAELDHWKKRLSKFHYLLDQLKTPEVKAVLGVLTAAKSKLLKIWRLLDTRITDSANEAKDNVKYLYTLEKFCDPL--YNSDPVSMIDSIPRLMNAIGMIHNISRYYNTSEKITSLFVKVTNQMITACKSYIT-----NNKTAKIWDQAQDVVVE 181          

HSP 4 Score: 67.0106 bits (162), Expect = 1.329e-9
Identity = 50/194 (25.77%), Postives = 85/194 (43.81%), Query Frame = 3
Query: 14586 QVPEKWLNKLCNPKGYSGYSTID-WISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGV 15164
            ++PE+W       K     ST+  W + LL + +     I  ++    C+W+  F  P+  L   ++E++    R ++      V    E T   KD I  P S+G+YV+GL+L G G+D+   +L +   K +   +PV  I     D    +++  Y CPI+          +     K   +   W+LRGV
Sbjct: 4027 RIPERW------KKASWESSTLGFWFTELLERNKQFSSWIFESRP--NCFWMTGFFNPQGFLTAMRQEIT----RANKGWALDSVIICNEVTKWMKDDITAPASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRI---YADNTSTKDNRFYSCPIYKKPVRTDLNYIAAVDLKTVQSPDHWILRGV 4205          

HSP 5 Score: 58.9214 bits (141), Expect = 3.909e-7
Identity = 45/168 (26.79%), Postives = 76/168 (45.24%), Query Frame = 3
Query: 2172 ICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKL 2675
            I  K  ++  N+  DI    + Y + KN+      +  V   + W ++LL  I+ PM  FQ      Q +E   I++ YNKV+K L+ ++  +   WL  V    + L   LLV      ++ +N    +L +I ET  M ++  ++ P A  L + +   K  F  L
Sbjct:  328 IEEKYQKILQNYGHDIEMVSKVYTKQKNEPPLGRDLPPVAGKIVWARQLLHRIQRPMDLFQQHSTALQTEEARRIIRNYNKVAKVLLEYEILFHRSWLKQVLVAKSGLHASLLVKSPETLELFVNFDPLILTLIRETECMAKLGLEIPPFAATLQQKQNVYKKNFDNL 495          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: ENSXETT00000021690.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 531/2156 (24.63%), Postives = 971/2156 (45.04%), Query Frame = 3
Query: 3591 IISLKYSESRLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFS-SSR--EEIVLNNKIAIKDEVVNWLN-LLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKF----NTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWR---RVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQN-HKELSINSVTIAFQNSLKVLSQMLVDNKEIGGEL---HIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLV-------LPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYL----SLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFV-----YSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQA-SQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITF--STEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETS---NDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            ++S   + ++ ++ + +E    +  +W+   D +  E+ ++     +  + +I     L+  +   P+ I +  + + T   +  L S    W    G++ + + +  ++    + E + ++L + + +L+ +   +  L +I +  + +D    PIE  Y  L  +EL + + E  ++  LR  W  L+      +N+L+  + N F  EL   ++ F  +  +F + ++   P + G  P E   +L  F+N++     K  T     +LFGL+V  + +L  +K+ L LL +LY LY    +    + D LWS V+++ +  +L EF + C  LP  LKE +++ +LK  ID   +   +L  +++K +  RHW ++  VTG +F +E  TFK  ++   PLL+ K+EI+ IC  A KE ++E KL Q+  EW  +   F +   RG ++L    T+ ++  +EDS ++L ++ ++R+  P K +  +W   L   +++++ W+ VQ LW+ LE VF+   I K L +E KRF  +DKS++K M R +E  NV QCC+ +E +    L ++ + LE C  SL GYL +KR LF R +FV D  +L IL  ++D   I  HL ++F  +  +     F E +  D+I S SSR  E I L   +  +  V  WLN LL          +   AI    +G  L E    FP+Q+    + + W+ +   A++  K DKK +    + F    NT I              T   +++++R +  ++    ++ RD   +L    I+   DFE  K  +       +  + K  +     T     EF G    +  TP T++  +TL  +L      +  G + +GK+   +++ R   +Y V  +C   M    L     G+A +G WG  D    +D   LS+A   I  +    K++       + + + +      F T   P  +    LP N+   FR VA+  PD   I++       +  +  LA + +T+ K     +++       LR+I++ L    A K+                                   +PT +                   E  +V+  + ++ L  +  E+E     +++D F       S  + +   P+L  AIIK+ +            K +QL+   R   G++  GP+ +GK+T +   + A+    E                    P      +P+ +                  +MFG       D+ DG+F+ LWR   R  R + I WIV DG +   W +NL S+LDD  TL L +G R+P + N K VFE +++ +ASP  VSR+G+V+  S+++ W  I   WL+ +   +   L K++      + ++ +Q+   ++ +    I  Q S+ +L Q L+ +K+ GGE+   H++RL+VF  +WS+ + +   ++  +   L+    V        P  D++  +FDYYV   G+W  W++ +    EY+    S    G +LV  +  +R  + +    +    V LIG +G+ K++I+     K  ++  N  R+V     +S  T     +  +E+ ++ R G  YG    K +++ I+D+N+P   E         NE++RQL+  N   N + P E   + D   + ++       + +  RL R F      +P  + +  I   +   H  S     + I +A  +LI  T+KL++   S +    T  + H  FNLR ++ I  G+ +   +      +L++ W +  +RV  D      D+ WF+ T   ++++ +     SG+   +  F+ F     E +    +D       A    PKI   +   N  ++ L   + +  E      ++++   + ++ ++ I R I  P  G+ +L+G  GS    +  +A  IA     ++  S   N   L++ +K + R  G +GK  + + T   +K    L+ +N+++ SG+   LF  DE+  + S +   MK+E       TN +L E F SR+R++LH++LC  P  +       K+P ++S   ++W        L+A + +F++
Sbjct: 1116 VLSTSINSTKKEVLTALERFKSYHHIWQKDRDNV-IEKFVSGSPLLSEFESQILHFRDLELAINTEPEYICVGIIALFTADLKLALTSETKAWMVDLGRHCNKKYRSEMENIFVFIEEINKKLNRQIKDLDDIRIAMAALKEIREHQITLDFQVGPIEESYAMLNKYELLVAKEETEKVDTLRYTWEKLLVRGNEVQNELMAIQPN-FRGELISTVQTFIQDCSEFYSDYEMNGPMIVGLAPQEASDRLIMFQNRFDNLHRKYITYTGGEELFGLQVTQYPQLLEIKKQLNLLQKLYGLYNNVIEIVNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSNKAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIAEWDNKTFTFANFKTRGELLLRGDSTSEIIASMEDSLMILGSLMSNRYNTPFKAQIQKWVHYLSNTTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDE-TMGQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVR----FHEKV-YDRILSISSREGETIELEKHVMAEGNVEVWLNSLLKESQSSLHLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNAKYDKKIMQKTNQSFLDLLNTLIDM------------TTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYF----NEDSDKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVEMNPEFGLFLTMN-PGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRA----------------------------------NPTDT-------------------ESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFP------SIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMKAMTDCGE--------------------PHREMRMNPKAITA---------------PQMFGRLDVATNDWTDGIFSTLWRKTLRAKRGEHI-WIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQDANILRKLYSASFAELYRFSVQSLEYKMEMVEAFIIMQ-SINML-QGLIPSKDQGGEISAEHLERLYVFSLMWSIGAMLELDDRIKMEQWLRSLDSVHLDLPKIPPGSDDT--MFDYYVTTEGKWMHWNTSV---EEYVYPSDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVII-----KGFMSKYNPERYVTKCLNFSSATTPLMFQRTIESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVT---NEIVRQLMEQNGFYNLEKPGEFTNIIDVQFLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDIKEAVKKLIPMTRKLWQMTKSKML--PTPAKFHYIFNLRDLSRIWQGMLNSTSEVIKDTTVLIKLWKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQGQKSGDFAVDYYFVDFLRDAPEATGEEPED-------ADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRIIRTP-RGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSRSYNTSNLMEDLKVLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRRPP-TNENLYEYFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLS 3125          

HSP 2 Score: 103.219 bits (256), Expect = 1.430e-20
Identity = 144/596 (24.16%), Postives = 285/596 (47.82%), Query Frame = 3
Query: 11523 LVENIKPMEEKWQTMSKQYEDE-RAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTN-RFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVIS--YSDLHNRLESCLASGQCMIIADCDIH-QLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLK-MYEEINANLQ---QKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIE-------SSERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLI---SPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKF-KGTVTPSDIRLSLRATSPSSAIL 13250
            L+  +   +E+W   SK++  + + +    L+++A+L+Y GP N E    F +F +   R         FG + + + + L     IS+     LP  +  I N   +   +  R  +LI  QT+  I W+    I     + S  +    N LE  L+ G+ ++I D       A D ++ +       F+K   T+K+ +  + EV+    FRL++ T          +++ T ++ F  ++  L ++ L R I   K  ++ E   L+ +    KRK+ +LE+ +L  L++   ++   E+  T++   K   EE+   LQ   + E   +S +   + Y  +A R + ++ + + M+ V   Y     ++L LFD  +        +S+R++N  II+ +T +  +Y+   + +E+KF+F+LLL+++I   +N V+   +E+L      +S+ LK+ P              KP  W+ + + +N+  L+  L  F DILE + ++  E  WK+ FD E PE   ++   +  ++D +++L LIR+  PDR +  +  +I +++  K+ +G V   D+  +   ++P + ++
Sbjct: 3485 LISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQE----FRNFVLTDWRREMKARKIPFGVN-LNLNEMLIDTPTISEWNLQGLPNDDLSIQNGIIVTKAA--RYPLLIDPQTQGKI-WIKNKEIRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEK------NFIKTGSTYKVKV-GDKEVDVMNGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQGSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAR---EEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSAKSPITSKRIAN--IIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDMQSNRVK--HEEFLTLIKGGASLDLKACP-------------AKPSKWILDMTWLNLVELSK-LRQFSDILEQIARN--EKLWKLWFDKEYPE-EEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEGVVL--DLEKTWEESNPRTPLI 4039          

HSP 3 Score: 91.2781 bits (225), Expect = 6.714e-17
Identity = 98/412 (23.79%), Postives = 183/412 (44.42%), Query Frame = 3
Query: 2007 IGKTSEMHEEIMNNFDKTFSIFLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAGMHSEFSKLLKYLATQKIYNFNHLLSKNWDSNEFTEAINKDLLAKKSTVQRTLEACSNILKEIT-EIISIVEKLDPNSS-----------LYESEDLIFGQMKEMYNKSLSQSLYRSIIN 3206
            + +T ++H ++    D TF         R   T  ++ ++ KF+ LK        I  K  ++  N+  DI    + Y + KN+      +  V   + W ++LL  I+ PM  FQ      Q +E   I++ YNKV+K L+ ++  +   WL  ++   + L   LLV      ++ +N    +L +I ET  M ++  ++ P A  L + +   K  F  L   +   + +K  +   +  L   HI  + +  Q G  SL+WT++NI+ +L  +     +LE ++++V  +     ++   L    I     L  +   S E    + KDL AK +    TL+A S +++E   E+I+++  LD +S            + E  + I G++K   N   + +L+ + I 
Sbjct:  536 VKQTHDLHTQLKTFMDSTFE--------RNYNTERSIIMLEKFERLKIPDL---GIEEKYQKILQNYGHDIEMVSKVYTKQKNEPPLGRDLPPVAGKIVWARQLLHRIQRPMDLFQQHSTALQTEEARRIIRNYNKVAKVLLEYEILFHRSWLKQMEVAKSGLHASLLVKSPETLELFVNFDPLILTLIRETECMAKLGLEIPPFAATLQQKQNVYKKNFDNLQFMLMEDKRIKSKVHAPLEQLIAPHIAKIDEAIQPGLLSLNWTSLNIEKYLKNIAEKHADLELLLDRVNDL--VVFRIDAVLQDMSITPLCKLPEEEPVSCEQFLQMTKDLCAKGAV---TLQAKSCMVEEAANELINMLLDLDIHSGDEDAKSFVGHRIMEDSNDISGKLKLSGNSGATATLFVATIG 931          

HSP 4 Score: 75.485 bits (184), Expect = 3.723e-12
Identity = 49/177 (27.68%), Postives = 88/177 (49.72%), Query Frame = 3
Query:  678 MSEIEVILEEVND-RTSEQDIFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIRRQILSIINNKIQAIVGFNQAPEDLWKRVQDEICE 1205
            + +IE +L E N  R    D+    E++ W+ R      L+ QLK    K  +G L + KSK++K WR L++ IT++ N +KD +KYL T +  C  +  Y S P  ++ ++P++   +    + SR ++ S  + S    +  Q+++   + I      N     +W + QD + E
Sbjct:  256 IKQIEQVLAESNQLRKEADDLGPRAELDHWKKRLSKFHYLLDQLKTPEVKAVLGVLTAAKSKLLKIWRLLDTRITDSANEAKDNVKYLYTLEKFCDPL--YNSDPVSMIDSIPRLMNAIGMIHNISRYYNTSEKITSLFVKVTNQMITACKSYIT-----NNKTAKIWDQAQDVVVE 425          

HSP 5 Score: 66.6254 bits (161), Expect = 1.504e-9
Identity = 50/194 (25.77%), Postives = 85/194 (43.81%), Query Frame = 3
Query: 14586 QVPEKWLNKLCNPKGYSGYSTID-WISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGV 15164
            ++PE+W       K     ST+  W + LL + +     I  ++    C+W+  F  P+  L   ++E++    R ++      V    E T   KD I  P S+G+YV+GL+L G G+D+   +L +   K +   +PV  I     D    +++  Y CPI+          +     K   +   W+LRGV
Sbjct: 4432 RIPERW------KKASWESSTLGFWFTELLERNKQFSSWIFESRP--NCFWMTGFFNPQGFLTAMRQEIT----RANKGWALDSVIICNEVTKWMKDDITAPASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRI---YADNTSTKDNRFYSCPIYKKPVRTDLNYIAAVDLKTVQSPDHWILRGV 4610          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: ENSXETT00000021565.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 548/2230 (24.57%), Postives = 997/2230 (44.71%), Query Frame = 3
Query: 3426 IPMIKFEPELDAIQSIIEQMGQDIMAFHNDVSDFSGRKLNL----------------YIK--LESDLFYEFSQIISLKYSESRLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFS-SSR--EEIVLNNKIAIKDEVVNWLN-LLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKF----NTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWR---RVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQN-HKELSINSVTIAFQNSLKVLSQMLVDNKEIGGEL---HIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLV-------LPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYL----SLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFV-----YSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQA-SQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRT---TAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETS---NDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            IP I   P LD +Q  + +  ++I+     V  +S  +++                 Y K   E+    +   ++S   + ++ ++ + +E    +  +W+   D +  E+ ++     +  + +I     L+  +   P+ I +  + + T   +  L S    W    G++ + + +  ++    + E + ++L + + +L+ +   +  L +I +  + +D    PIE  Y  L  +EL + + E  ++  LR  W  L+      +N+L+  + N F  EL   ++ F  +  +F + ++   P + G  P E   +L  F+N++     K  T     +LFGL+V  + +L  +K+ L LL +LY LY    +    + D LWS V+++ +  +L EF + C  LP  LKE +++ +LK  ID   +   +L  +++K +  RHW ++  VTG +F +E  TFK  ++   PLL+ K+EI+ IC  A KE ++E KL Q+  EW  +   F +   RG ++L    T+ ++  +EDS ++L ++ ++R+  P K +  +W   L   +++++ W+ VQ LW+ LE VF+   I K L +E KRF  +DKS++K M R +E  NV QCC+ +E +    L ++ + LE C  SL GYL +KR LF R +FV D  +L IL  ++D   I  HL ++F  +  +     F E +  D+I S SSR  E I L   +  +  V  WLN LL          +   AI    +G  L E    FP+Q+    + + W+ +   A++  K DKK +    + F    NT I              T   +++++R +  ++    ++ RD   +L    I+   DFE  K  +       +  + K  +     T     EF G    +  TP T++  +TL  +L      +  G + +GK+   +++ R   +Y V  +C   M    L     G+A +G WG  D    +D   LS+A   I  +    K++       + + + +      F T   P  +    LP N+   FR VA+  PD   I++       +  +  LA + +T+ K     +++       LR+I++ L    A K+                                   +PT +                   E  +V+  + ++ L  +  E+E     +++D F       S  + +   P+L  AIIK+ +            K +QL+   R   G++  GP+ +GK+T +   + A+    E                    P      +P+ +                  +MFG       D+ DG+F+ LWR   R  R + I WIV DG +   W +NL S+LDD  TL L +G R+P + N K VFE +++ +ASP  VSR+G+V+  S+++ W  I   WL+ +   +   L K++      + ++ +Q+   ++ +    I  Q S+ +L Q L+ +K+ GGE+   H++RL+VF  +WS+ + +   ++  +   L+    V        P  D++  +FDYYV   G+W  W++ +    EY+    S    G +LV  +  +R  + +    +    V LIG +G+ K++I+     K  ++  N  R+V     +S  T     +  +E+ ++ R G  YG    K +++ I+D+N+P   E         NE++RQL+  N   N + P E   + D   + ++       + +  RL R F      +P  + +  I   +   H  S     + I +A  +LI  T+KL++   S +    T  + H  FNLR ++ I  G+   N  SE  +   L  W +  +RV  D      D+ WF+ T   ++++ +     SG+   +  F+ F       R++ +   I T    A    PKI   +   N  ++ L   + +  E      ++++   + ++ ++ I R I  P  G+ +L+G  GS    +  +A  IA     ++  S   N   L++ +K + R  G +GK  + + T   +K    L+ +N+++ SG+   LF  DE+  + S +   MK+E       TN +L E F SR+R++LH++LC  P  +       K+P ++S   ++W        L+A + +F++
Sbjct:  665 IPNIIMVPALDEVQQTLNKAVENIVNVSKGVGQWSKERMSKVWLISKITVAFVHNKNYFKNVSENKEIVKLCSVLSTSINSTKKEVLTALERFKSYHHIWQKDRDNV-IEKFVSGSPLLSEFESQILHFRDLELAINTEPEYICVGIIALFTADLKLALTSETKAWMVDLGRHCNKKYRSEMENIFVFIEEINKKLNRQIKDLDDIRIAMAALKEIREHQITLDFQVGPIEESYAMLNKYELLVAKEETEKVDTLRYTWEKLLVRGNEVQNELMAIQPN-FRGELISTVQTFIQDCSEFYSDYEMNGPMIVGLAPQEASDRLIMFQNRFDNLHRKYITYTGGEELFGLQVTQYPQLLEIKKQLNLLQKLYGLYNNVIEIVNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSNKAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIAEWDNKTFTFANFKTRGELLLRGDSTSEIIASMEDSLMILGSLMSNRYNTPFKAQIQKWVHYLSNTTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDE-TMGQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVR----FHEKV-YDRILSISSREGETIELEKHVMAEGNVEVWLNSLLKESQSSLHLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNAKYDKKIMQKTNQSFLDLLNTLID------------MTTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYF----NEDSDKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVEMNPEFGLFLTMN-PGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRA----------------------------------NPTDT-------------------ESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFP------SIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMKAMTDCGE--------------------PHREMRMNPKAITA---------------PQMFGRLDVATNDWTDGIFSTLWRKTLRAKRGEHI-WIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQDANILRKLYSASFAELYRFSVQSLEYKMEMVEAFIIMQ-SINML-QGLIPSKDQGGEISAEHLERLYVFSLMWSIGAMLELDDRIKMEQWLRSLDSVHLDLPKIPPGSDDT--MFDYYVTTEGKWMHWNTSV---EEYVYPSDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVII-----KGFMSKYNPERYVTKCLNFSSATTPLMFQRTIESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVT---NEIVRQLMEQNGFYNLEKPGEFTNIIDVQFLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDIKEAVKKLIPMTRKLWQMTKSKML--PTPAKFHYIFNLRDLSRIWQGM--LNSTSEVIKDTTL--WKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQGQKSGDFAVDYYFVDF------LRDAPEATGIDTEPEDADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRIIRTP-RGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSRSYNTSNLMEDLKVLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRRPP-TNENLYEYFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLS 2745          

HSP 2 Score: 103.219 bits (256), Expect = 1.514e-20
Identity = 144/596 (24.16%), Postives = 285/596 (47.82%), Query Frame = 3
Query: 11523 LVENIKPMEEKWQTMSKQYEDE-RAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTN-RFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVIS--YSDLHNRLESCLASGQCMIIADCDIH-QLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLK-MYEEINANLQ---QKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIE-------SSERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLI---SPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKF-KGTVTPSDIRLSLRATSPSSAIL 13250
            L+  +   +E+W   SK++  + + +    L+++A+L+Y GP N E    F +F +   R         FG + + + + L     IS+     LP  +  I N   +   +  R  +LI  QT+  I W+    I     + S  +    N LE  L+ G+ ++I D       A D ++ +       F+K   T+K+ +  + EV+    FRL++ T          +++ T ++ F  ++  L ++ L R I   K  ++ E   L+ +    KRK+ +LE+ +L  L++   ++   E+  T++   K   EE+   LQ   + E   +S +   + Y  +A R + ++ + + M+ V   Y     ++L LFD  +        +S+R++N  II+ +T +  +Y+   + +E+KF+F+LLL+++I   +N V+   +E+L      +S+ LK+ P              KP  W+ + + +N+  L+  L  F DILE + ++  E  WK+ FD E PE   ++   +  ++D +++L LIR+  PDR +  +  +I +++  K+ +G V   D+  +   ++P + ++
Sbjct: 3105 LISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQE----FRNFVLTDWRREMKARKIPFGVN-LNLNEMLIDTPTISEWNLQGLPNDDLSIQNGIIVTKAA--RYPLLIDPQTQGKI-WIKNKEIRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEK------NFIKTGSTYKVKV-GDKEVDVMNGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQGSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAR---EEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSAKSPITSKRIAN--IIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDMQSNRVK--HEEFLTLIKGGASLDLKACP-------------AKPSKWILDMTWLNLVELSK-LRQFSDILEQIARN--EKLWKLWFDKEYPE-EEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEGVVL--DLEKTWEESNPRTPLI 3659          

HSP 3 Score: 72.7886 bits (177), Expect = 2.392e-11
Identity = 52/201 (25.87%), Postives = 97/201 (48.26%), Query Frame = 3
Query:  603 IHATIDLNKELQDPLKQFETFVTDVMSEIEVILEEVNDRTSEQDIFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIRRQILSIINNKIQAIVGFNQAPEDLWKRVQDEICE 1205
            IH  ++++  L  P   F  F + V++E   + +E +D           E++ W+ R      L+ QLK    K  +G L + KSK++K WR L++ IT++ N +KD +KYL T +  C  +  Y S P  ++ ++P++   +    + SR ++ S  + S    +  Q+++   + I      N     +W + QD + E
Sbjct:   46 IHRPLNVHLYLDQPSTCF-NFSSLVLAESNQLRKEADDLGPR------AELDHWKKRLSKFHYLLDQLKTPEVKAVLGVLTAAKSKLLKIWRLLDTRITDSANEAKDNVKYLYTLEKFCDPL--YNSDPVSMIDSIPRLMNAIGMIHNISRYYNTSEKITSLFVKVTNQMITACKSYIT-----NNKTAKIWDQAQDVVVE 232          

HSP 4 Score: 67.0106 bits (162), Expect = 1.254e-9
Identity = 50/194 (25.77%), Postives = 85/194 (43.81%), Query Frame = 3
Query: 14586 QVPEKWLNKLCNPKGYSGYSTID-WISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGV 15164
            ++PE+W       K     ST+  W + LL + +     I  ++    C+W+  F  P+  L   ++E++    R ++      V    E T   KD I  P S+G+YV+GL+L G G+D+   +L +   K +   +PV  I     D    +++  Y CPI+          +     K   +   W+LRGV
Sbjct: 4051 RIPERW------KKASWESSTLGFWFTELLERNKQFSSWIFESRP--NCFWMTGFFNPQGFLTAMRQEIT----RANKGWALDSVIICNEVTKWMKDDITAPASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRI---YADNTSTKDNRFYSCPIYKKPVRTDLNYIAAVDLKTVQSPDHWILRGV 4229          

HSP 5 Score: 58.9214 bits (141), Expect = 3.846e-7
Identity = 45/168 (26.79%), Postives = 76/168 (45.24%), Query Frame = 3
Query: 2172 ICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKL 2675
            I  K  ++  N+  DI    + Y + KN+      +  V   + W ++LL  I+ PM  FQ      Q +E   I++ YNKV+K L+ ++  +   WL  V    + L   LLV      ++ +N    +L +I ET  M ++  ++ P A  L + +   K  F  L
Sbjct:  381 IEEKYQKILQNYGHDIEMVSKVYTKQKNEPPLGRDLPPVAGKIVWARQLLHRIQRPMDLFQQHSTALQTEEARRIIRNYNKVAKVLLEYEILFHRSWLKQVLVAKSGLHASLLVKSPETLELFVNFDPLILTLIRETECMAKLGLEIPPFAATLQQKQNVYKKNFDNL 548          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: ENSXETT00000021598.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 542/2212 (24.50%), Postives = 984/2212 (44.48%), Query Frame = 3
Query: 3426 IPMIKFEPELDAIQSIIEQMGQDIMAFHNDVSDFSGRKLNLYIKLESDLFYEFSQIISLKYSESRLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFS-SSR--EEIVLNNKIAIKDEVVNWLN-LLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKF----NTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWR---RVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQN-HKELSINSVTIAFQNSLKVLSQMLVDNKEIGGEL---HIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLV-------LPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYL----SLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFV-----YSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQA-SQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRT---TAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETS---NDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            IP I   P LD +Q  + +  ++I+     V  +S  +++                          ++ + +E    +  +W+   D +  E+ ++     +  + +I     L+  +   P+ I +  + + T   +  L S    W    G++ + + +  ++    + E + ++L + + +L+ +   +  L +I +  + +D    PIE  Y  L  +EL + + E  ++  LR  W  L+      +N+L+  + N F  EL   ++ F  +  +F + ++   P + G  P E   +L  F+N++     K  T     +LFGL+V  + +L  +K+ L LL +LY LY    +    + D LWS V+++ +  +L EF + C  LP  LKE +++ +LK  ID   +   +L  +++K +  RHW ++  VTG +F +E  TFK  ++   PLL+ K+EI+ IC  A KE ++E KL Q+  EW  +   F +   RG ++L    T+ ++  +EDS ++L ++ ++R+  P K +  +W   L   +++++ W+ VQ LW+ LE VF+   I K L +E KRF  +DKS++K M R +E  NV QCC+ +E +    L ++ + LE C  SL GYL +KR LF R +FV D  +L IL  ++D   I  HL ++F  +  +     F E +  D+I S SSR  E I L   +  +  V  WLN LL          +   AI    +G  L E    FP+Q+    + + W+ +   A++  K DKK +    + F    NT I              T   +++++R +  ++    ++ RD   +L    I+   DFE  K  +       +  + K  +     T     EF G    +  TP T++  +TL  +L      +  G + +GK+   +++ R   +Y V  +C   M    L     G+A +G WG  D    +D   LS+A   I  +    K++       + + + +      F T   P  +    LP N+   FR VA+  PD   I++       +  +  LA + +T+ K     +++       LR+I++ L    A K+                                   +PT +                   E  +V+  + ++ L  +  E+E     +++D F       S  + +   P+L  AIIK+ +            K +QL+   R   G++  GP+ +GK+T +   + A+    E                    P      +P+ +                  +MFG       D+ DG+F+ LWR   R  R + I WIV DG +   W +NL S+LDD  TL L +G R+P + N K VFE +++ +ASP  VSR+G+V+  S+++ W  I   WL+ +   +   L K++      + ++ +Q+   ++ +    I  Q S+ +L Q L+ +K+ GGE+   H++RL+VF  +WS+ + +   ++  +   L+    V        P  D++  +FDYYV   G+W  W++ +    EY+    S    G +LV  +  +R  + +    +    V LIG +G+ K++I+     K  ++  N  R+V     +S  T     +  +E+ ++ R G  YG    K +++ I+D+N+P   E         NE++RQL+  N   N + P E   + D   + ++       + +  RL R F      +P  + +  I   +   H  S     + I +A  +LI  T+KL++   S +    T  + H  FNLR ++ I  G+    +D       L   W +  +RV  D      D+ WF+ T   ++++ +     SG+   +  F+ F       R++ +   I T    A    PKI   +   N  ++ L   + +  E      ++++   + ++ ++ I R I  P  G+ +L+G  GS    +  +A  IA     ++  S   N   L++ +K + R  G +GK  + + T   +K    L+ +N+++ SG+   LF  DE+  + S +   MK+E       TN +L E F SR+R++LH++LC  P  +       K+P ++S   ++W        L+A + +F++
Sbjct:  593 IPNIIMVPALDEVQQTLNKAVENIVNVSKGVGQWSKERMSK-------------------------EVLTALERFKSYHHIWQKDRDNV-IEKFVSGSPLLSEFESQILHFRDLELAINTEPEYICVGIIALFTADLKLALTSETKAWMVDLGRHCNKKYRSEMENIFVFIEEINKKLNRQIKDLDDIRIAMAALKEIREHQITLDFQVGPIEESYAMLNKYELLVAKEETEKVDTLRYTWEKLLVRGNEVQNELMAIQPN-FRGELISTVQTFIQDCSEFYSDYEMNGPMIVGLAPQEASDRLIMFQNRFDNLHRKYITYTGGEELFGLQVTQYPQLLEIKKQLNLLQKLYGLYNNVIEIVNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSNKAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIAEWDNKTFTFANFKTRGELLLRGDSTSEIIASMEDSLMILGSLMSNRYNTPFKAQIQKWVHYLSNTTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDE-TMGQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVR----FHEKV-YDRILSISSREGETIELEKHVMAEGNVEVWLNSLLKESQSSLHLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNAKYDKKIMQKTNQSFLDLLNTLID------------MTTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYF----NEDSDKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVEMNPEFGLFLTMN-PGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRA----------------------------------NPTDT-------------------ESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFP------SIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMKAMTDCGE--------------------PHREMRMNPKAITA---------------PQMFGRLDVATNDWTDGIFSTLWRKTLRAKRGEHI-WIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQDANILRKLYSASFAELYRFSVQSLEYKMEMVEAFIIMQ-SINML-QGLIPSKDQGGEISAEHLERLYVFSLMWSIGAMLELDDRIKMEQWLRSLDSVHLDLPKIPPGSDDT--MFDYYVTTEGKWMHWNTSV---EEYVYPSDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVII-----KGFMSKYNPERYVTKCLNFSSATTPLMFQRTIESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVT---NEIVRQLMEQNGFYNLEKPGEFTNIIDVQFLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDIKEAVKKLIPMTRKLWQMTKSKML--PTPAKFHYIFNLRDLSRIWQGMVPQPFD-------LFSLWKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQGQKSGDFAVDYYFVDF------LRDAPEATGIDTEPEDADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRIIRTP-RGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSRSYNTSNLMEDLKVLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRRPP-TNENLYEYFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLS 2627          

HSP 2 Score: 103.219 bits (256), Expect = 1.573e-20
Identity = 144/596 (24.16%), Postives = 285/596 (47.82%), Query Frame = 3
Query: 11523 LVENIKPMEEKWQTMSKQYEDE-RAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTN-RFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVIS--YSDLHNRLESCLASGQCMIIADCDIH-QLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLK-MYEEINANLQ---QKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIE-------SSERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLI---SPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKF-KGTVTPSDIRLSLRATSPSSAIL 13250
            L+  +   +E+W   SK++  + + +    L+++A+L+Y GP N E    F +F +   R         FG + + + + L     IS+     LP  +  I N   +   +  R  +LI  QT+  I W+    I     + S  +    N LE  L+ G+ ++I D       A D ++ +       F+K   T+K+ +  + EV+    FRL++ T          +++ T ++ F  ++  L ++ L R I   K  ++ E   L+ +    KRK+ +LE+ +L  L++   ++   E+  T++   K   EE+   LQ   + E   +S +   + Y  +A R + ++ + + M+ V   Y     ++L LFD  +        +S+R++N  II+ +T +  +Y+   + +E+KF+F+LLL+++I   +N V+   +E+L      +S+ LK+ P              KP  W+ + + +N+  L+  L  F DILE + ++  E  WK+ FD E PE   ++   +  ++D +++L LIR+  PDR +  +  +I +++  K+ +G V   D+  +   ++P + ++
Sbjct: 2987 LISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQE----FRNFVLTDWRREMKARKIPFGVN-LNLNEMLIDTPTISEWNLQGLPNDDLSIQNGIIVTKAA--RYPLLIDPQTQGKI-WIKNKEIRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEK------NFIKTGSTYKVKV-GDKEVDVMNGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQGSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAR---EEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSAKSPITSKRIAN--IIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDMQSNRVK--HEEFLTLIKGGASLDLKACP-------------AKPSKWILDMTWLNLVELSK-LRQFSDILEQIARN--EKLWKLWFDKEYPE-EEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEGVVL--DLEKTWEESNPRTPLI 3541          

HSP 3 Score: 75.485 bits (184), Expect = 3.978e-12
Identity = 49/177 (27.68%), Postives = 88/177 (49.72%), Query Frame = 3
Query:  678 MSEIEVILEEVND-RTSEQDIFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIRRQILSIINNKIQAIVGFNQAPEDLWKRVQDEICE 1205
            + +IE +L E N  R    D+    E++ W+ R      L+ QLK    K  +G L + KSK++K WR L++ IT++ N +KD +KYL T +  C  +  Y S P  ++ ++P++   +    + SR ++ S  + S    +  Q+++   + I      N     +W + QD + E
Sbjct:    5 IKQIEQVLAESNQLRKEADDLGPRAELDHWKKRLSKFHYLLDQLKTPEVKAVLGVLTAAKSKLLKIWRLLDTRITDSANEAKDNVKYLYTLEKFCDPL--YNSDPVSMIDSIPRLMNAIGMIHNISRYYNTSEKITSLFVKVTNQMITACKSYIT-----NNKTAKIWDQAQDVVVE 174          

HSP 4 Score: 67.0106 bits (162), Expect = 1.338e-9
Identity = 50/194 (25.77%), Postives = 85/194 (43.81%), Query Frame = 3
Query: 14586 QVPEKWLNKLCNPKGYSGYSTID-WISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGV 15164
            ++PE+W       K     ST+  W + LL + +     I  ++    C+W+  F  P+  L   ++E++    R ++      V    E T   KD I  P S+G+YV+GL+L G G+D+   +L +   K +   +PV  I     D    +++  Y CPI+          +     K   +   W+LRGV
Sbjct: 3933 RIPERW------KKASWESSTLGFWFTELLERNKQFSSWIFESRP--NCFWMTGFFNPQGFLTAMRQEIT----RANKGWALDSVIICNEVTKWMKDDITAPASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRI---YADNTSTKDNRFYSCPIYKKPVRTDLNYIAAVDLKTVQSPDHWILRGV 4111          

HSP 5 Score: 58.9214 bits (141), Expect = 3.713e-7
Identity = 45/168 (26.79%), Postives = 76/168 (45.24%), Query Frame = 3
Query: 2172 ICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKL 2675
            I  K  ++  N+  DI    + Y + KN+      +  V   + W ++LL  I+ PM  FQ      Q +E   I++ YNKV+K L+ ++  +   WL  V    + L   LLV      ++ +N    +L +I ET  M ++  ++ P A  L + +   K  F  L
Sbjct:  323 IEEKYQKILQNYGHDIEMVSKVYTKQKNEPPLGRDLPPVAGKIVWARQLLHRIQRPMDLFQQHSTALQTEEARRIIRNYNKVAKVLLEYEILFHRSWLKQVLVAKSGLHASLLVKSPETLELFVNFDPLILTLIRETECMAKLGLEIPPFAATLQQKQNVYKKNFDNL 490          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: nifk (nucleolar protein interacting with the FHA domain of MKI67 [Source:Xenbase;Acc:XB-GENE-940532])

HSP 1 Score: 615.535 bits (1586), Expect = 1.211e-175
Identity = 515/2091 (24.63%), Postives = 949/2091 (45.38%), Query Frame = 3
Query: 3762 HLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIF---SSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYIS-TGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRR---VNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFD----KILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRET--LVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYL----SLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQ-ASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITF--STEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGK----DSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIA-----KIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
             L+  +  LP    +  +  +T   +  L+     W+   G  L+ +A   +DE   + + + + L + V +L+ +   +  L +I D +++ID +  PIE   + L  +EL         +  L   W  L   A   +N L+  +  +    LD  ++KF ++  +F   ++   P + G  P E   +L+ F+ ++     K  T     +LFGL V  + EL+ ++ +L LL +LY LY    +    + + LW+ +D++ +  +L +F +    LP  LKE +++ +LK KID   +   +L  +A+K + NRHW ++ Q+TG  F +E+ +F   ++    LL+ K++I+ IC  A KE ++E KL  +  EW+     F     RG ++L+   T+  +  +EDS ++L ++ ++R+  P K    QW  KL   +E+++ WL VQ LW+ LE VF+   I K L QE KRF+ +DKS+ K M+R +ET N+ QCC+ +E   +  L ++ + LE C  SL GYL +KR +F R +FV D  +L IL  ++D   I  HL S+F  VN +     F E    D+I    S   E++ L   +  +  V  WL LL N +++++  +   A   IS +G  L +    +P+QI    + + W+ +   A++  K+D+K +    +KF   ++ +     R+        +T ++R +  ++    ++ +D   +L    I+   DFE  K  + +   ++ +     Q+  +  ++    E+ G    +  TP T++  +TL  +L      +  G + +GK+   +++ +   +Y V  +C   M    L     G+A +G WG  D    ++   LS+A   I  +    K K +     + + + +      F T   P  +    LP N+  +FR VA+  PD   I++       +R ++ L+ + YT+ K     +++       LR+I++ L    A                                            +K+   + P         E  +V+  + ++ L  +  E+E     ++ D F G +      + +   PDL  AI K+ +          + K +QLY   R   G++  GP+ +GK+  ++I + A+                     +  +P      +P+ +  S               +MFG       D+ DG+F+ LWR+     + + I WIV DG +   W +NL S+LDD  TL L +G R+P + N K VFE +++ +ASP  VSR+G+V+  S+++ WR +   WL+   + +   L   F+    + + P +Q +   + + +I+            L Q    NK+   E H+ RLF+F  +WS+ + +   ++  + T L+  +  L LP       IF++ +DE+G+W  WS  +    EY+    S+     +LV  +  +R  + +    +    V LIG +G+ K++++  +  K D          +S  T  +  +  +E+ I+ R G  YG    K +T+ I+D+N+P   E         NE++RQL+      N + P E   + D   + ++       + +  RL R F      +P  S +  I R V E +          + + AS L+  T+K+++   + ++   T  + H  FNLR ++ I  GI     +   S  +L+  + +   RV  D  I   D  WF  T+   +++   G+    N   E  F+ F     E +    +D       A L APK+   +       E L  +++L+ +++ +      ++L+   + ++ ++ I R I  P  G+ +L+G  GS    +  +A  IA     +I + +   +N+  L+D +K + R  G +G     + T   +K    L+ +N+++ SG+   LF  DE+  +   +   MK+E       T  +L + F SR+RR+LH++LC  P  +       K+PG++S   ++W +      L+A A +F++
Sbjct:  636 QLETQISELPAHCIVGSVDFTTDSLKMALVQECRHWKRVFGSALNKKAAMDMDEIYLFIDNLSKRLSRPVLDLDDVRGAMDALKEIRDAEIRIDMMIGPIEESNSLLLKYELVFQDGNAERVDGLAYAWKNLNTQAVYTQNLLIKVQPEMKTDLLDG-VEKFHIDAAEFYKNYELLGPGVEGIPPREASDRLQVFQAKFDELWRKYVTFSGGEELFGLPVTEYPELQRIRRELALLQKLYGLYNAVIENINGYYEILWTDLDIEKINTELMDFQNRIRKLPKALKEWQAFNDLKKKIDDFSESCPLLEMMANKAMMNRHWERISQLTGHKFDVESESFSLKNIMEASLLKYKEDIEDICISAVKEKDIEAKLKSVISEWSAHCFTFTQFKSRGELLLKGSDTSEKIALMEDSLMILGSIMSNRYNAPFKPTIQQWVQKLSNTTEIIENWLTVQNLWIYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQKIMQRAHETPNIVQCCVGDETLAQ-LLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDSHTIQAHLLSLFDNVNRV----GFHEK-NYDQILYFESQEGEKVNLIEPVNAQGNVEVWLGLLLNGVKKTLHTIIRQASIAISDSGFKLYDFQTMYPAQIGLLGIQMIWTRDAEEALNMAKTDRKVMQTTNQKFLDLLNDLIDMTTRD--------LTRMERTKYETLITIHVHQKDIFDDLVRMNIKSASDFEWQK--QSRFYFIEDIDKCIIQITDVEFSY--CNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKSKKSQFIFTDGDVVDMDREFGIFLTMN-PGYAGRQELPENLKVQFRTVAMMVPDRAIIMRVKLASAGFRDNQILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA--------------------------------------------VKRSNPDEP---------EKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGIT------LDKAGYPDLEAAIQKQTEEAGLIHHPPWILKLIQLYETQRVRHGMMTLGPSGAGKTKCINILMKAMT--------------------DCGAPHKEMRMNPKAITAS---------------QMFGTLDVATNDWTDGIFSTLWRKTLKAKKGEHI-WIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWRPMLKAWLQTLPAFQHEILWNCFNMANYRAVSPKMQILECMYIKQAID------------LLQKSKQNKQPSQE-HVARLFIFAVMWSIGALLELDDRMKMETFLQDHSAPLELPTVSGDQTIFEFVIDENGQWQHWSKKV---PEYVYPKDSVPEYASILVPNVDNVRTDFLMHTIMKQGKAVLLIGEQGTAKTVMIKGYTSKYDPEYHATKSLNFSSATLPNMFQRSIESYIDKRMGTTYGPPAGKKMTVFIDDINMPVINEWGDQIT---NEIVRQLMEQKGFYNLEKPGEFTSVVDIQFVAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNSSIDKIFRTVAEGYFCEQRGFSTGVCKLASALVPTTRKIWQ--ATKIKMLPTPAKFHYIFNLRDLSRIWQGILIIMSEVCQSTDILVALFKHECSRVISDRFIDQKDKDWFENTIA--VED--HGQEIMNNALKESYFVDFLRDAPEATGDEPED-------ADLEAPKVYEPIPSF----EQLADRLDLYMQQYNEAVRGSRMDLVFFKDAMIHLVKISRIIRTP-QGNALLVGVGGSGKQSLTRLASYIAGYQSFQITLTRTYGTNN--LMDDLKILYRTAGQKGCGITFIFTDNEIKDESFLEYMNNVLASGEVSNLFARDEIDEITQDLIPVMKKEHPRRAP-TAENLYDYFLSRVRRNLHVVLCFSPVGEKFRTRALKFPGLISGCTMDWFQRWPRDALVAVAQHFLS 2571          

HSP 2 Score: 108.612 bits (270), Expect = 3.569e-22
Identity = 130/605 (21.49%), Postives = 280/605 (46.28%), Query Frame = 3
Query: 11412 KKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERAIFI-QCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSDLHNR--LESCLASGQCMIIADCDIH-QLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSI----DNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIE-------SSERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKF 13181
            ++E  D+++ Y+  + ++  +  + +A   ++     L+E +   + +W   SK ++++    +   L+++ +L+Y GP N E R+  L        S  +  +      + +   L     I +     LP  +  I N   +   S    + L+ D   +   W+     +    V S +  + R  LE CL+ G+ ++I D       A D ++ +       F+K   TFK+ +  + EV+    F L++ T  +       +++ T ++ F  ++  L ++ L R I   K  ++ E  KL+ E    KRK+ +LE+ +L  L++      S+ +  ++I+ L++ +     + +K  + +  +  I    + Y  +A R + ++ +   M+ V   Y     ++L +FD  ++       +S+R++N  II+ LT +  +Y+   + +++KF+F+LL++++I      +   + + LI      L  N           S   KP  W+ + + +N+  L+   P F ++L  + ++  E +WK  FD E+PE + + +  + N +D +++L LIR+  PDR +  +  +I  +L +K+
Sbjct: 2895 QRELDDVQAMYDAAMREKQALLDDAEACRRKMINATALIEGLGGEKIRWTESSKNFQNQITRLVGDVLLATGFLSYSGPFNQEYRNLLLQLWKKEMNSRKIPHS----EDLNLISMLVDNATIGEWNLQGLPNDDLSIQNGIIVTKAS---RFPLLIDPQGQGKIWIKNREKNNELQVTSLNHKYFRTHLEDCLSLGRPLLIEDVGEELDPALDNVLEK------NFIKSGSTFKVKV-GDKEVDVMKGFALYITTKLANPAYTPEISAKTAVIDFTVTMKGLEDQLLGRVILTEKQELEAERVKLMEEVTTNKRKMQELEDNLLFRLTS---TQGSLVDDESLIEVLRITKSTAEEVSEKLTVAAETEVKINTAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDISMDRSTKSQITSKRITN--IIEYLTFEVFKYTARGLYEDHKFLFTLLMALKIDLQAKKISHNEFQTLIK-GGATLDLN-----------SVEPKPKKWILDMTWLNLVQLSNLTP-FNNLLGQVARN--EKNWKAWFDVEAPEEAPLPDG-YDNVLDTFRRLLLIRSWCPDRTIAQARHYIAESLGVKY 3464          

HSP 3 Score: 79.337 bits (194), Expect = 2.194e-13
Identity = 91/453 (20.09%), Postives = 194/453 (42.83%), Query Frame = 3
Query: 13776 PVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFESHSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEF------PKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTI-ESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTR-----KVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLI--EFTNKDKDHIREPPS---DGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHI--TFTLNDLD-KPENSDQYYCPIF 15074
            P+++  + L + ++ R  +  LG+       +    +++ + VQ   +  ++   ++W+ LRY + E+ YG +VT + D+  + +    W   N    +F F      PK K     + Y   +   +  + F      L  +A+  +  +N+  +  S  + I+  D        + ++     + ++ NE+ E       KLP+  I   ++ RL+K+      +  L +E+     V   + + +   +      +IM+E   ++ DA    + ++   ++P+ W  K+       G+    W + LL + Q     + + +     +W+  F  P+  L   ++E +    R + S  +     ++  + T   K+ +  PP     G+Y++GL L G G+D+   +L + S K + T LPV H+    T+N  D K +    + CP++
Sbjct: 3623 PLLYGVAFLHTTVQERRKFGPLGWNIPYEFNQADFAASI-QFVQNHLDEMDTKRGVNWSCLRYMLGEVQYGGRVTDDMDKTLLNTFARVWFGENMFSDKFCFYKGYGIPKGKTIDEYLQYIDQLPLVDTPEVF-----GLHGNADITY-QTNMANETLSTIVNIQPKDSGGGAGETRESV-----VQRLANEMLE-------KLPEDYIPHEVKARLQKMGPIQPMNIFLRQEIDRMQRVIARVRSTLIDLKLAIDGTIIMSE---DLRDA----LDNMYDARIPKLWY-KISWESSTLGF----WFTELLERNQQFRSWLFDGRP--NQFWMTGFFNPQGFLTAMRQETT----RMNLSKGWALDSVILHNDVTRMMKEDVNAPPPADIGGVYIYGLFLDGAGWDRRNMKLVESSPKVLFTNLPVVHVYAVSTMNPADLKKQQGYLHACPVY 4038          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah5 (dynein, axonemal, heavy chain 5 [Source:MGI Symbol;Acc:MGI:107718])

HSP 1 Score: 593.193 bits (1528), Expect = 7.597e-169
Identity = 531/2161 (24.57%), Postives = 963/2161 (44.56%), Query Frame = 3
Query: 3591 IISLKYSESRLKLQSTVENLNEFDFLWKMTSDK--LDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFS-SSR--EEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYIS-TGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISR-IPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGY----EFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTF-------QGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWR---RVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHK-ELSINSVTIAFQNSLKVLSQMLVDNKEIGGEL---HIQRLFVFCFIWSLNSQISDLNKQAITTLLK-RE--TLVLPD-DDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLT----GEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSII----RGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNC--ERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSH---LSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            ++S   S ++ ++ ++++    ++ +W+   +   + F   +A+       + +I     L+  +   P+ I +  + + T   +  L +    W    G++ + + +  ++      E   ++L + + +L+ +   +  L +I +  +  D    PIE  Y  L  + L + + E +++  LR  W  L+  A   +N+L    +  F +EL   ++ F  +  QF   +D   P  +G  P E   +L  F+NQ+     K  T     +LFGL V  + +L  +K  L LL ++YSLY    +   ++ D LWS V+++ +  +L EF + C  LP  LK+ +++ +LK  ID   +   +L  +AS  +  RHW ++  +TG +  +   TFK  ++   PLL+ K+EI+ IC  A KE ++E KL Q+  EW  + L F     RG ++L    T+ ++  +EDS +LL ++ ++R+  P K +  +W   L   +++++ W+ VQ LW+ LE VF+   I K L +E KRF  +DKS++K M R +E  NV QCC+ +E +    L ++   LE C  SL GYL +KR  F R +FV D  +L IL  ++D   I  HL ++F  +  +     F + +  D+I S SSR  E I L+  +  +  V  WLN L  E + S+  +   A   I   G  L E    FP+Q+    + + W+ +   A+   K DKK +    + F   ++  I IT        T D +++++R +  ++    ++ RD   +L    ++   DFE  K  +           ++    T+    D+ +    EF G    +  TP T++  +TL  +L      +  G + +GK+   +++ R   +Y V  +C   M    L     G+A +G WG  D    +D   LS+A   I  I    K+   +    + + + +      F T   P  +    LP N+   FR VA+  PD   I++       +  +  LA + +T+ +     +++       LR+I++ L    A K+                                   SPT +                   E  +V+  + ++ L  +  E+E     +++D F        GY             P+L  AI K+ +            K +QL+   R   G++  GP+ SGK+T +   + A+                                      + H    + P +     +MFG       D+ DG+F+ LWR   +  + + I WIV DG +   W +NL S+LDD  TL L +G R+P + N K VFE +++ +ASP  VSR+G+V+  S+++ W  I   +L+ +   E   L +++ +    + ++ IQN + ++ +    +  Q++   + Q L+  KE  GE+   H+ RLFVF  +WS+ + +    ++ +   L+ RE  TL LP   D    +FDYYV  +G W  WS   +   EY+    T    G +LV  +  +R  + +    +    V LIG +G+ K++I+     K D  +  +    +S  T     +  +E+ ++ R G  YG    K + + I+DLN+P   E         NE++RQL+  +   N + P E   + D   + ++       + +  RL R F      +P  + +  I      G +       E  Q   D   +L+  T++L++   + L+   T  + H  FNLR ++ I  G+ +   +       LL+ W +  +RV  D   + +D+ WF+  + ++++  + GE  +  V+C  +  F+ F  +   +      +     A    PK+   +  +N  RE L   + L+ E      ++++   + ++ ++ I R I  P  G+ +L+G  GS    L+++ S         I    + N   L++ +K + R  G +GK    + T   +K    L+ +N+++ SG+   LF  DE+  + S +   MK+E       TN +L E F SR+R +LHI+LC  P  +       K+P ++S   ++W        L+A + +F++
Sbjct: 1119 VLSTVISSTKKEVITSMDRFKRYNHIWQKEKEDTIMTF---IAQNPLLPEFESRILYFQSLEQEINAEPEYIRVGSIALYTADLKLSLTAETKAWMAVIGRHCNRKYRAEMENILTVVEESQKKLSRPIKDLDDIRIAMAALKEIREQQISTDFQVGPIEESYALLNKYGLLVAKEEMDKVDTLRYAWEKLLARASDVQNEL-GALQPSFRKELISTVEVFLQDCQQFYLDYDLNGPMASGLKPQEASGRLIIFQNQFDNIYRKYITYTGGEELFGLPVTPYPQLLEIKRQLNLLQKIYSLYNNVIETVNSYQDTLWSDVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKTIDDFSECCPLLEYMASNAMVERHWQRITALTGHSLDVGNETFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLRQVINEWDNKTLTFSGFKTRGELLLRGDSTSEVIASMEDSLMLLGSLLSNRYNMPFKAQIQKWVQCLSNSTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEIPNVVQCCVGDE-TMGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVK----FHDKI-YDRILSISSREGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQEPGFQLIEFLSSFPAQVGLLGIQMLWTRDSEEALRNAKFDKKIMQKTNQAFLELLNMLIEIT--------TKD-LSSMERVKYETLITIHVHQRDIFDDLCHMHVKSPTDFEWLKQCRFYF--------KEDSDKTMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMN-PGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYQLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRA----------------------------------SPTDT-------------------ESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGY-------------PELETAISKQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGSGKTTCIHTLMKAMTD----------------------------------CGKPHREMRMNPKAIT-APQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHI-WIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGFLKRRSPQEAEILRQLYAETFPDLYRFSIQNLEFKMEVLEAFVITQSTH--MLQGLIPPKEQAGEVDPEHLGRLFVFAMMWSVGAVLELEGRRRMELWLRSREGPTLHLPQLTDAGDTMFDYYVAPNGTWRHWS---LCTPEYVYPPDTTPEYGSILVPNVDNVRTDFLIKTIAKQGKAVLLIGEQGTAKTVIIKGFMSKFDPESHMVKNLNFSSATTPVMFQRTIESYVDKRMGTTYGPPAGKKMAVFIDDLNMPVINEWGDQVT---NEIVRQLMEQSGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSDASMDKIFGVIGAGYYCAQRGFSEEVQ---DALIKLVPLTRRLWQ--MTKLKMLPTPAKFHYVFNLRDLSRIWQGMLNITSEVIKDTDELLRLWKHECKRVIADRFSMSSDVTWFDKAVVSLVEEEF-GEEKAPVVDCGVDAYFVDFLRDAPEATGETPEE-----ADAEMPKLYEPIASLNHLRERLSVFLQLYNESIRGTGMDMVFFIDAMVHLVKISRVIRTP-RGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKEESFLEYMNNVLSSGEVSNLFARDEIDEINSDLTPIMKKEHPRRPP-TNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLS 3128          

HSP 2 Score: 160.229 bits (404), Expect = 6.705e-38
Identity = 281/1310 (21.45%), Postives = 546/1310 (41.68%), Query Frame = 3
Query: 11397 EFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDE-RAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVIS--YSDLHNRLESCLASGQCMIIADCDIH-QLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENC---------------NTIIKYL----KMYEEINANLQ---QKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFD-SMIES------SERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLI---SPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLSLRATSPSSAILMKYLNNSYETNILFNQIHSSVKPRIIQSRVIDYSKEGLQLFYQQLQNQMSNIHEICLDSSLTTSNLTALNSVYIVI---HLSSTEHISSIHKRVMSYIDEMNSFQRSALLKSRDQNVVTYNLFFTLPQNHSGVSSSQMNKMTTVYLDYPSNLRDFLLHLFKIGFLSANSIP-SMSLDLLPVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFES---HSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPF-LFESAEACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPK--STIESIQERLKKVT-----NNFIYSKT--LMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTID-WISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGV 15164
            E +  + E   +++EY   + ++  +  +      ++     L+  +   +E+W   SK++  + + +    L+++A+L+Y GP N E R   L       ++  +    FG + + + + L     IS+     LP  +  I N   +   S  R  +LI  QT+  I W+          + S  +    N LE  L+ G+ ++I D       A D ++ +       F+K   TFK+ +  + EV+    F+L++ T          +++ T ++ F  ++  L ++ L R I   K  ++                  K    +L+D++   R +K +E+                 ++I  L    K  EE+   L+   + E   +S +   + Y  +A R + ++ + + M  V + Y     ++L LFD S+  S      S+R++N  II+ +T +  +Y+   + +E+KF+F+LLL+++I    N V+   +E+L      +S+ LK+ P              KP  W+ + + +N+  L+  L  F DIL+ + ++  E  W++ FD E+PE    +   +  S+D +++L LIR+  PDR +  +  +I +++   +   V   D+  +   + P + ++      S  T    + I +  K   I++R +    +G ++  ++L +Q                  T  N  ++++   HL             + ++DE+       ++   +    T+ L+ T  + H     + +        + P  LR  L   +  G +S + +  S+     P+++  + L S ++ R  +  LG+     I    N ++    VQ + N  +       +SW  +RY + EI YG +VT + D+  + +    W + N    +F F +  Y+ P        K S +      I     ++S E   L  N    I  +  L + +      I  K + S   D T+ E  +  +  ++  KLP+  S  E ++ERL+K+      N F+  +   + + L +  S   E+   +  T  +IM+E    + DA    +  +   ++P +W       K     ST+  W + LL +       + N +    C+W+  F  P+  L   ++E++    R ++     ++    E T   KD I  PP++G+YV+GL+L G G+DK   +L +   K +   +PV  I    N    P     Y CPI+          +     K       W+LRGV
Sbjct: 3447 ELDAKQAELDVVQAEYEQAMAEKQTLLEDADRCRHKMQTASTLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLHDWKKEMKARKIP---FG-NGLNLNEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKAS--RYPLLIDPQTQGKI-WIKNKESQNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEK------NFIKTGSTFKVKV-GDKEVDVMDGFKLYITTKLPNPAYTPEISARTSIIDFTVTVKGLEDQLLGRVILTEKQELE------------------KERTHLLEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIIVLSNTKKTAEEVTQKLEISGETEIQINSAR---EEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIAN--IIEHMTYEVFKYAARGLYEEHKFLFTLLLTLKIDIQRNLVK--HEEFLTLIKGGASLDLKACP-------------PKPSKWILDMTWLNLVELSK-LKQFSDILDQISRN--EKMWRVWFDKENPEEEP-LPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIMDSMGENYAEGVI-LDLEKTWEESDPRTPLICLLSMGSDPT----DSIIALGKRLKIETRYVSMG-QGQEVHARKLLHQ------------------TMANGGWVLLQNCHLG------------LDFLDELMD-----VVTETETVHDTFRLWITT-EVHKQFPITLLQMSIKFANEPPQGLRAGLRRTY--GGVSQDLLDVSVGAQWKPMLYAVAFLHSTVQERRKFGPLGW----NIPYEFNQADFNATVQFIQNHLDDMDVKKGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFTFYQ-GYNIP--------KCSTVDGYLQYIQSLPAYDSPEVFGLHPN--ADITYQSKLAKDVLDTILGIQPKDS-SGGGDETR-EAVVARLADDMLEKLPEDYSPFE-VKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAVDGT--IIMSE---NLRDA----LDCMFDARIPARW------KKASWVSSTLGFWFTELLERNCQFTSWVSNGRPH--CFWMTGFFNPQGFLTAMRQEIT----RANKGWALDNMVLCNEVTKFMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIFAENNTARDPR---LYCCPIYKKPVRTDLNYIAAVDLKTAQAPEHWVLRGV 4614          

HSP 3 Score: 99.7525 bits (247), Expect = 1.357e-19
Identity = 73/281 (25.98%), Postives = 133/281 (47.33%), Query Frame = 3
Query: 2040 MNNFDKTFSIFLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGV-ICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQV 2879
            +N        F+++ F +   T +ALS + KF+    R +I  + I  K   +F NF +DI    + Y + K           +   + W ++L   +E PM  FQ    V +  E + +++ YN+++K L+  +  Y   WL  ++   A L+  LLV      ++ +N    +L +  ET+ M ++   +SP A  L +     K  FS +   ++ +E VK  + P +  L   H+  V +  Q G + L+WT++NI  +L    A I +LE ++++V
Sbjct:  544 INELHNDLQRFMDITFEKIPSTRQALSTLKKFE----RLNIPNLGIEEKYQIIFQNFATDIDTISKLYTKQKYDPPLARNQPPIAGKILWARQLFHRLEQPMQLFQQHPFVLRTAEAKPVIRSYNRIAKVLLEFEVLYHRAWLQQIEEIHAGLEASLLVKAPGTGELFVNFDPQILVLFRETQCMSQLGLPVSPFAAALFQKRDMFKKNFSDMKMMLSEYERVKLKMPPAIEQLMFPHLARVDEALQPGLAVLTWTSLNIGGYLENAFAKIKDLELLLDRV 820          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah10 (dynein, axonemal, heavy chain 10 [Source:MGI Symbol;Acc:MGI:1860299])

HSP 1 Score: 427.943 bits (1099), Expect = 7.832e-119
Identity = 572/2863 (19.98%), Postives = 1172/2863 (40.94%), Query Frame = 3
Query: 2088 LRPMRTGEA-LSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKL-KNPLLVVDLV----------GNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAGMHSEFSKLLKYLATQKIYNFNHLLSKNWDS----NEFTEAINKDLLAKKSTVQRTLEACSNILKEITEII--SIVEKLDPNSSLYES-EDLIFGQMKEMYNKSLSQSLYRSIINNLVYLAICSNCQKEHLELLTSRAE--YDPVTGINDNLCSSYGEEVFCINDIKPIYDSDHAESKTLIKFILLVKYEIPMIKFEPELDAIQSIIEQMGQDIMAFHNDVSDFSGRKLNLYIKLESDLFYEFSQIISLKYSESRL--KLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQ----VLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIK-SDKKSLSHLAKKFNTQI----SRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHES--EMFGNWSTKKEDFHDGLFTFLWRRVNR---NDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLEN-KRSIEVIALTKIFDK----ILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQM--LVDNKEIGGELH----IQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNS-------------ICIFDYYVD-ESGEWDLWSSLLMDEGEYLSLQLTG--EVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFV-YSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITF-----STEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVA---LIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLS-----AVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNHSLNEIDLYLSEEKDKDQLAQYLANLHKEVLKFTVTPSIVSGKSVKIGKIIMNDKKKEIYKYDSTSLAPYSQLFLREKLRNLNDNSIQKKIYNGPCTFHRFLYILRRLLHQKTIEKTQSTQTISRALNSIKQTKHDITTINNLISHQKVKFNEISIKSQQLLKTL 10439
             + +R+ EA   ++ KF +++ R++I   +  K  ++   +  +I    + + + ++          V   + W + L   I+  ++RF +++E+   +  + + ++Y +V + +  ++     +W    +  +  L K  LL  +++          G    IN    L  IINET+ + ++   +   A  +   E +   +   +   ++++  +  ++      L  +H + +++ F++G   L+W ++ I  ++ +    IG  E++++Q+     + +  L  + +  ++ F   ++K  D      EF E I ++       + R   A   +L ++  ++  +   +    +S YE  E  I+  + ++  K+L         N+L    I  N      E + S  E    P     D +C      V C+     +       +K  ++++     E P  K E E      ++      I++F+ND+S       N  I           Q + +  +  RL   +   ++    +  LWK+    +  E+  AKK    +  EK+     +  ++ R P   +  C+ +  +   + +      W    G+ L++ A+  L       E + + LK+  + LE L  +L  + +I    L ++  Y+ I+  Y  + I+++    +E+  + N+   W +L   + +  + L   KR  F +    ++  +  ++ +F   F  + P   G D  +    L SF  + + +E+ +  L    KLF L +  + EL  +++++  L  +Y LY      ++ ++  LW  +++  +   +  F      LP +++       L+ K+        +L +L  + +R RHW ++M+ TG  F++   TF   ++  + L ++ + ++ I   A KE+ +E  + +I + W       V  ++    RG ++  V   + ++Q L+D+ + L ++  SR + P      +W   L  I EV+++W+ VQ+ W+ LE++FI   I   L +E K+F+ +D+ + + M    +   + +CC +   ++   L+ I +GLE C  SL  YL  KRN F R +F+ D  +LSIL  S+ +  +  H+  ++  +  L           +  + S+  E +     I     V +W+  + +E+  +   ++ +AI       S  +    +   +  +A  + W+ E+    +++K  DK+++ +  KK ++QI    +RI + L++N             R++  ++ +  ++ RD + +     I +  +FE    ++      D   ++   +   T T   GYE+ G    +  TP T++  LTL  +L      +  G + +GK+   ++LA+      V  +C   M  +++     G+A  G WG  D    +D S LS+    I  I++A+  +  T    E + I L      F T   P  +    LP ++   FR V +  PDL QI +       +  ++TLA ++  + K A   +++       LR++ + L  A   K+                                                      +A   E  +++ A+ ++ LP    E+      ++ D F G      +       PD  +A+ +  +     +    ++K VQ++  +      ++ GPT  GKS  ++    A   L                                       M  +Y ++ +  S  E++G       D+ DG+ + ++R +NR        +I+FDG +   W +N+ S++DD   L L +G R+    +   +FE+  ++ ASP  VSR G+VY     + ++     WL+  +  +E   L  +F+K    ++D +I+ I+   +   +  V    Q  L +++Q+  ++D+  + GE+     ++  F+     SL S + +  +      +KR +  +P  D+                ++D++ D +   W  W+ L+    EY+        ++LV T+ T R  + L+   +    V  +G  G+ K+    N  +  +    NI   V +S  T S  ++  LEAN+E R    YG    K L + ++D+N+PK   +D    ++P  +L+ LL    + +         + D   I ++       + +DPR +  F    +  P    L  I   + + H  +       +  + +L   T  LY+ +   L    T  + H  FNLR ++ +  G+   N D   +   +++ W     RVF D LI + D       +Q  I N+ +   +       R+ I F     + +E   R  +D+Q+      L   +I    N++N+K                   +NL+  D+ L  +  +HR I +   GH +L+G  GS    +  +A   A   + ++  S   +     D +K++  ++G E K    L T  ++     L+ +N+++ SG  P LF  +E   +L      A++  M   K S        + + F ++   +LHI+L + P  D +      +PG+++   ++W        L A A  F+       D  +  ++  ++L +++  +H+                                     S+  +S+ F ++KLR  N        Y  P  +  F+    +LL +KT       + +   L+ +K+    +  +N  ++ QK+   E S   + LL+ +
Sbjct:  621 FKTLRSAEAAFDMLLKFKHIRSREAINRQMMMKFNDILAQYYKEIDIVNKIFVQNQDNPPLYKNHPPVAGAICWERSLFYRIKHTILRFMEVEELLDSERGQQVKQRYLEVGRKMKEYEDGKYEHWKETTEQSLPTLMKKSLLTKNIITAEDSAIIDRGTTFIINFSPVLKEIINETKYLEQLGFTIPELARNVALQEDKFLRYTEGIQRMLDHYHLLINTLNEAETALLDDHSQELLRVFRSGYKRLNWNSLGISDYITRCKQAIGKFETLVHQIHKNADDINSRLTLIESVSLFRFP--VAKTADGVPGVKEFFEYIERERARDVDHMVRWYMAIGPLLTKVEGLVVHTNTGRAPKLASYYEYWEGKIYDVLVKLIQKNLQA------FNSL----ILRNVPLFQAETILSAPEIVLHPNANEIDKMC------VHCVRSCVEV-------TKHFVRWMNGSCIECPPQKGEEE-----EVV------IISFYNDISQ------NTQI---------MDQALMIPQNIHRLLVNIMKYLQRWKRYRPLWKL-DKSIVMEKFAAKKPACVAYDEKLQFYSKIATDVMRHPLIKDEHCIRLQLEPLASTVQENAKSWVISLGKLLNESAREELYSLRDEIEHLAKNLKKSPSTLEDLKFVLATISEIRSKSLVMELRYKDIQERYRTMAIYKIFPTDTEQELVNNIENMWESLFTESMNVEHALGGIKRT-FTEITRSEIMNYRSQLDEFARRFYSQGPGAVGEDLDKGSELLGSFEKELAKHEKNRQELANAEKLFDLPITMYPELIKVQKEMTGLRMIYELYNSLKLAKEEWSQTLWINLNVQYLQEGIEGFLKNLRKLPRQVRGLSVAFHLEVKMKAFKDSIPLLLDLKHEALRERHWKELMEKTGVFFEM-TETFTLENMFAMELHKHTEVLNEIVTAAVKEVAIEKAVKEILDTWENMKFTVVKYYKGTQERGYILGSV---DDIIQCLDDNTVNLQSISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDNIDRIFKRIMGETLKDPVIKRCCEAP--NRLHDLQTISEGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGNSDPL-CVQEHMIKMYDNIAMLRFHDGDSGEKLVSAMISAEGEVMTFRKIIRADGRVEDWMTAVLHEMRRTNRLITKEAIFRYCEDRSRVDWMLLYQGMVVLAASQVWWTWEVEDVFNKVKQGDKQAMKNYGKKMHSQIDDLVTRITMELSKND------------RKKYNTVLIIDVHARDIVDSFIRGSILEAREFEWESQLRF---YWDREPDE-LNIRQCTGTFSYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYKAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALIHQLTTFQF-EGQEISLDSRMGIFITMN-PGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLGAKTLAKKMTVLYKLAREQLSKQHHYDFGLRALKSVLVMAGELKR-----------------------------------------------------GSADLQEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRY------PDFNDAVEQVLEENGYVLLPVQVDKVVQMFETMLTRHTTMVVGPTGGGKSVVINTLCQAQTKLG-------------------------------------IMTKLYILNPKAVSVIELYGILDPTTRDWTDGVLSNIFREINRPTDKKERKYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKYQPYWKKWLQQIQNKVEQKYLNDLFEKYVPTLIDMIIEGIVDGRQGEKLKMVVP--QTDLNMVTQLTRMLDSL-LEGEIEDLDLLECFFLEALYCSLGSSLLEEGRVKFDECIKRLS-SMPTVDSEGNWARPGELPGHLPSLYDFHFDAKRNHWIPWNKLV---PEYVHSHEKKFVDILVHTVDTTRTTWILEQMVKIKHPVLFVGESGTSKTATTQNFLKNLN-EETNIVLIVNFSSRTTSLDIQRNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPK---VDEYGTQQPIALLKLLLEKGYLYDRGKELNCKSIRDLGFIAAMGKAGGGRNEVDPRFLSLFSVFNVPFPSEESLNLIYYSILKGHTSTFNESIGGV--SRKLTFCTLTLYKNIVQDL--PPTPSKFHYIFNLRDLSRVFNGLVLTNPDRFQTVSQMVRVWRNECLRVFHDRLINEVD----KELVQNHIGNLVTEHFNDDFEMVMRDPILFGDFRLALQEGEPRIYEDIQDYEAAKALFE-EILEEYNEVNTK-------------------MNLVLFDDALEHLTRVHR-IIRMDRGHALLVGVGGSGKQSLARLAAFTAGCEVFEILLSRGYSENNFRDDLKNLYMKLGLENKMMIFLFTDAHVAEEGFLELINNMLTSGMVPALFAEEEKDNILGQIGQEALKFGMGPAKES--------VWQFFVNKSANNLHIVLGMSPVGDTLRTRCRNFPGLVNNTGIDWFMPWPPQALHAVAKSFLG------DNSMIPDEKLEELVEHVVMVHQ-------------------------------------SVGEFSKQF-QQKLRRSN--------YVTPKNYLDFINTYSKLLDEKTQYNIAQCKRLEGGLDKLKEATIQLDELNLKLAEQKIVLAEKSAACEALLEEI 3209          

HSP 2 Score: 94.7449 bits (234), Expect = 3.669e-18
Identity = 144/636 (22.64%), Postives = 275/636 (43.24%), Query Frame = 3
Query: 11397 EFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERA-IFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSK-IEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSD--LHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRN-VKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESS-------ERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNES-KTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENH---WKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLS--LRATSPSSAIL 13250
            E   ++KE   L ++Y   I ++  ++ E + +  RL     L+  +     +W     +    R  +   CL+ +A+L+Y G   +E    F D  V     + ++      S+   +   L  ++EIS+  S  LP  E  + N       S    + L  D  ++A++W+ R     N  V S++D     +LE  +  G   +  D D +    D ++  V     +   + + F IL   + EV+   NFRL+L+T  +       +     ++++  ++  L ++ LS  +   +  ++ + + L++E  + K  L  LE+ +L +L+    N + ++E   T+ +      E++  L+  E       +  D Y   A R A +F + S M  V   Y      +L +F   ++ S       +RL N  I+D LT     Y    + + +K +FS  ++I+I +    V   + ++              F+K N S + S  KKP  W+S++   ++ +L+     F DI  N+  D  E+H   W+  +D +S E        + ++I A+QKL ++R  R DR+ +A   ++  T+  K+   V P  I        ++P+S I+
Sbjct: 3401 ELAAIQKELEALGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENVRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWE----FRDEMVNQVWQNDILDRDIPLSQPFRLENLLTDDVEISRWGSQGLPPDELSVQNGILTTRAS---RFPLCIDPQQQALNWIKRKEEKNNLRVASFNDPDFLKQLEMSIKYGTPFLFHDVDEYI---DPVIDSVLEKNIK-TSQGRQFIIL--GDKEVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVELVQTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFLEVFGLSLKKSLPDSILLKRLKN--IMDTLTFNIYNYGCTGLFERHKLLFSFNMTIKIEQAEGRVPQEELDF--------------FLKGNISLEKSKWKKPCTWLSDQGWEDIILLSQK---FSDIFGNLPLDI-EHHLPMWQEWYDQDSLEQFPF-PLGYDDNITAFQKLLILRCFRVDRVYRAVTDYVTLTMGEKY---VQPPMISFEAIFEQSTPNSPIV 3999          

HSP 3 Score: 65.855 bits (159), Expect = 2.151e-9
Identity = 99/489 (20.25%), Postives = 196/489 (40.08%), Query Frame = 3
Query: 13776 PVIHNCSLLMSIMKSRSSYLSLGF--------QDSETIVKITNPSNLYEIVQRMCNWFESHSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNI--SPFLFESAEACHLSSNLLTKINSEK---ILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPK-STIESIQERLK-KVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNELG--NEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLL-AIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITS---SKWMLRGVFITIN 15179
            P+++  +   ++++ R  +  +G+         D +  ++I N        QR          I W  L+Y + E++YG +     DR  + +  D +L  + +   F+ P   +    V Y   +   +IK  F+    +  L  + E   L SN      ++    +    ++   QT    S +S        ++ + ++ K++ +K+PK   ++ +++ L   +T     S  L++EL  ++ +   +   + + ++ +  E+G  NE+ D    V  SL    +P  W     +     G    +W+   L ++      +   +  V   WL     PES L A+ +          DRS  +  V        +D D + E    G +V GL+L G  +D   G L     K +   LP+  I  T     K +N+  +  P++  S  +    + +    +  T+   S W+L+GV +T+N
Sbjct: 4139 PLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQR-------DPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTTYMDEYL-GDFIFDTFQ-PFHFFRNKDVDY--KIPVGDIKDKFVEAIEALPLANTPEVFGLHSNAEIGYYTQAARDMWGHLLELQPQTGESSSGVS-------RDDYIGQVAKDIENKMPKIFDLDQVRKHLGLSITPT---SVVLLQELGRFNKLVIRMTRSLAELQRALAGEVGMSNELDD----VARSLFLGHIPHIWRKLAPDTLKTLG----NWMVYFLRRFSQYTLWVTEGEPSVM--WLSGLHIPESYLTALVQATCRRNGWPLDRSTLFTQVTKF-----QDADEVNERAGQGCFVSGLYLEGADWDIERGCLVKSKPKVLVVDLPILKIIPTEGHRLKLQNT--FRTPVYTTSMRRNAMGIGLVFEADLFTAKHISHWVLQGVCLTLN 4589          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah10 (dynein, axonemal, heavy chain 10 [Source:MGI Symbol;Acc:MGI:1860299])

HSP 1 Score: 423.705 bits (1088), Expect = 1.670e-117
Identity = 563/2796 (20.14%), Postives = 1143/2796 (40.88%), Query Frame = 3
Query: 2286 VYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKL-KNPLLVVDLV----------GNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAGMHSEFSKLLKYLATQKIYNFNHLLSKNWDS----NEFTEAINKDLLAKKSTVQRTLEACSNILKEITEII--SIVEKLDPNSSLYES-EDLIFGQMKEMYNKSLSQSLYRSIINNLVYLAICSNCQKEHLELLTSRAE--YDPVTGINDNLCSSYGEEVFCINDIKPIYDSDHAESKTLIKFILLVKYEIPMIKFEPELDAIQSIIEQMGQDIMAFHNDVSDFSGRKLNLYIKLESDLFYEFSQIISLKYSESRL--KLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQ----VLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIK-SDKKSLSHLAKKFNTQI----SRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHES--EMFGNWSTKKEDFHDGLFTFLWRRVNR---NDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLEN-KRSIEVIALTKIFDK----ILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQM--LVDNKEIGGELH----IQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNS-------------ICIFDYYVD-ESGEWDLWSSLLMDEGEYLSLQLTG--EVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFV-YSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITF-----STEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVA---LIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLS-----AVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNHSLNEIDLYLSEEKDKDQLAQYLANLHKEVLKFTVTPSIVSGKSVKIGKIIMNDKKKEIYKYDSTSLAPYSQLFLREKLRNLNDNSIQKKIYNGPCTFHRFLYILRRLLHQKTIEKTQSTQTISRALNSIKQTKHDITTINNLISHQKVKFNEISIKSQQLLKTL 10439
            V   + W + L   I+  ++RF +++E+   +  + + ++Y +V + +  ++     +W    +  +  L K  LL  +++          G    IN    L  IINET+ + ++   +   A  +   E +   +   +   ++++  +  ++      L  +H + +++ F++G   L+W ++ I  ++ +    IG  E++++Q+     + +  L  + +  ++ F   ++K  D      EF E I ++       + R   A   +L ++  ++  +   +    +S YE  E  I+  + ++  K+L         N+L    I  N      E + S  E    P     D +C      V C+     +       +K  ++++     E P  K E E      ++      I++F+ND+S       N  I           Q + +  +  RL   +   ++    +  LWK+    +  E+  AKK    +  EK+     +  ++ R P   +  C+ +  +   + +      W    G+ L++ A+  L       E + + LK+  + LE L  +L  + +I    L ++  Y+ I+  Y  + I+++    +E+  + N+   W +L   + +  + L   KR  F +    ++  +  ++ +F   F  + P   G D  +    L SF  + + +E+ +  L    KLF L +  + EL  +++++  L  +Y LY      ++ ++  LW  +++  +   +  F      LP +++       L+ K+        +L +L  + +R RHW ++M+ TG  F++   TF   ++  + L ++ + ++ I   A KE+ +E  + +I + W       V  ++    RG ++  V   + ++Q L+D+ + L ++  SR + P      +W   L  I EV+++W+ VQ+ W+ LE++FI   I   L +E K+F+ +D+ + + M    +   + +CC +   ++   L+ I +GLE C  SL  YL  KRN F R +F+ D  +LSIL  S+ +  +  H+  ++  +  L           +  + S+  E +     I     V +W+  + +E+  +   ++ +AI       S  +    +   +  +A  + W+ E+    +++K  DK+++ +  KK ++QI    +RI + L++N             R++  ++ +  ++ RD + +     I +  +FE    ++      D   ++   +   T T   GYE+ G    +  TP T++  LTL  +L      +  G + +GK+   ++LA+      V  +C   M  +++     G+A  G WG  D    +D S LS+    I  I++A+  +  T    E + I L      F T   P  +    LP ++   FR V +  PDL QI +       +  ++TLA ++  + K A   +++       LR++ + L  A   K+                                                      +A   E  +++ A+ ++ LP    E+      ++ D F G      +       PD  +A+ +  +     +    ++K VQ++  +      ++ GPT  GKS  ++    A   L                                       M  +Y ++ +  S  E++G       D+ DG+ + ++R +NR        +I+FDG +   W +N+ S++DD   L L +G R+    +   +FE+  ++ ASP  VSR G+VY     + ++     WL+  +  +E   L  +F+K    ++D +I+ I+   +   +  V    Q  L +++Q+  ++D+  + GE+     ++  F+     SL S + +  +      +KR +  +P  D+                ++D++ D +   W  W+ L+    EY+        ++LV T+ T R  + L+   +    V  +G  G+ K+    N  +  +    NI   V +S  T S  ++  LEAN+E R    YG    K L + ++D+N+PK   +D    ++P  +L+ LL    + +         + D   I ++       + +DPR +  F    +  P    L  I   + + H  +       +  + +L   T  LY+ +   L    T  + H  FNLR ++ +  G+   N D   +   +++ W     RVF D LI + D       +Q  I N+ +   +       R+ I F     + +E   R  +D+Q+      L   +I    N++N+K                   +NL+  D+ L  +  +HR I +   GH +L+G  GS    +  +A   A   + ++  S   +     D +K++  ++G E K    L T  ++     L+ +N+++ SG  P LF  +E   +L      A++  M   K S        + + F ++   +LHI+L + P  D +      +PG+++   ++W        L A A  F+       D  +  ++  ++L +++  +H+                                     S+  +S+ F ++KLR  N        Y  P  +  F+    +LL +KT       + +   L+ +K+    +  +N  ++ QK+   E S   + LL+ +
Sbjct:  631 VAGAICWERSLFYRIKHTILRFMEVEELLDSERGQQVKQRYLEVGRKMKEYEDGKYEHWKETTEQSLPTLMKKSLLTKNIITAEDSAIIDRGTTFIINFSPVLKEIINETKYLEQLGFTIPELARNVALQEDKFLRYTEGIQRMLDHYHLLINTLNEAETALLDDHSQELLRVFRSGYKRLNWNSLGISDYITRCKQAIGKFETLVHQIHKNADDINSRLTLIESVSLFRFP--VAKTADGVPGVKEFFEYIERERARDVDHMVRWYMAIGPLLTKVEGLVVHTNTGRAPKLASYYEYWEGKIYDVLVKLIQKNLQA------FNSL----ILRNVPLFQAETILSAPEIVLHPNANEIDKMC------VHCVRSCVEV-------TKHFVRWMNGSCIECPPQKGEEE-----EVV------IISFYNDISQ------NTQI---------MDQALMIPQNIHRLLVNIMKYLQRWKRYRPLWKL-DKSIVMEKFAAKKPACVAYDEKLQFYSKIATDVMRHPLIKDEHCIRLQLEPLASTVQENAKSWVISLGKLLNESAREELYSLRDEIEHLAKNLKKSPSTLEDLKFVLATISEIRSKSLVMELRYKDIQERYRTMAIYKIFPTDTEQELVNNIENMWESLFTESMNVEHALGGIKRT-FTEITRSEIMNYRSQLDEFARRFYSQGPGAVGEDLDKGSELLGSFEKELAKHEKNRQELANAEKLFDLPITMYPELIKVQKEMTGLRMIYELYNSLKLAKEEWSQTLWINLNVQYLQEGIEGFLKNLRKLPRQVRGLSVAFHLEVKMKAFKDSIPLLLDLKHEALRERHWKELMEKTGVFFEMTE-TFTLENMFAMELHKHTEVLNEIVTAAVKEVAIEKAVKEILDTWENMKFTVVKYYKGTQERGYILGSV---DDIIQCLDDNTVNLQSISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDNIDRIFKRIMGETLKDPVIKRCCEAP--NRLHDLQTISEGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGNSDPL-CVQEHMIKMYDNIAMLRFHDGDSGEKLVSAMISAEGEVMTFRKIIRADGRVEDWMTAVLHEMRRTNRLITKEAIFRYCEDRSRVDWMLLYQGMVVLAASQVWWTWEVEDVFNKVKQGDKQAMKNYGKKMHSQIDDLVTRITMELSKND------------RKKYNTVLIIDVHARDIVDSFIRGSILEAREFEWESQLRF---YWDREPDE-LNIRQCTGTFSYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYKAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALIHQLTTFQF-EGQEISLDSRMGIFITMN-PGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLGAKTLAKKMTVLYKLAREQLSKQHHYDFGLRALKSVLVMAGELKR-----------------------------------------------------GSADLQEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRY------PDFNDAVEQVLEENGYVLLPVQVDKVVQMFETMLTRHTTMVVGPTGGGKSVVINTLCQAQTKLG-------------------------------------IMTKLYILNPKAVSVIELYGILDPTTRDWTDGVLSNIFREINRPTDKKERKYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKYQPYWKKWLQQIQNKVEQKYLNDLFEKYVPTLIDMIIEGIVDGRQGEKLKMVVP--QTDLNMVTQLTRMLDSL-LEGEIEDLDLLECFFLEALYCSLGSSLLEEGRVKFDECIKRLS-SMPTVDSEGNWARPGELPGHLPSLYDFHFDAKRNHWIPWNKLV---PEYVHSHEKKFVDILVHTVDTTRTTWILEQMVKIKHPVLFVGESGTSKTATTQNFLKNLN-EETNIVLIVNFSSRTTSLDIQRNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPK---VDEYGTQQPIALLKLLLEKGYLYDRGKELNCKSIRDLGFIAAMGKAGGGRNEVDPRFLSLFSVFNVPFPSEESLNLIYYSILKGHTSTFNESIGGV--SRKLTFCTLTLYKNIVQDL--PPTPSKFHYIFNLRDLSRVFNGLVLTNPDRFQTVSQMVRVWRNECLRVFHDRLINEVD----KELVQNHIGNLVTEHFNDDFEMVMRDPILFGDFRLALQEGEPRIYEDIQDYEAAKALFE-EILEEYNEVNTK-------------------MNLVLFDDALEHLTRVHR-IIRMDRGHALLVGVGGSGKQSLARLAAFTAGCEVFEILLSRGYSENNFRDDLKNLYMKLGLENKMMIFLFTDAHVAEEGFLELINNMLTSGMVPALFAEEEKDNILGQIGQEALKFGMGPAKES--------VWQFFVNKSANNLHIVLGMSPVGDTLRTRCRNFPGLVNNTGIDWFMPWPPQALHAVAKSFLG------DNSMIPDEKLEELVEHVVMVHQ-------------------------------------SVGEFSKQF-QQKLRRSN--------YVTPKNYLDFINTYSKLLDEKTQYNIAQCKRLEGGLDKLKEATIQLDELNLKLAEQKIVLAEKSAACEALLEEI 3152          

HSP 2 Score: 131.724 bits (330), Expect = 3.167e-29
Identity = 272/1307 (20.81%), Postives = 519/1307 (39.71%), Query Frame = 3
Query: 11397 EFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERA-IFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSK-IEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSD--LHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRN-VKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESS-------ERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNES-KTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENH---WKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLS--LRATSPSSAILMKYLNNSYETNILFNQIHSSVKPRIIQSRVIDYSKEGLQLFYQQLQNQMSNIHEICLDSSLTTSNLTALNSVYIVIHL-----SSTEHISSIHK--RVMSYIDEMNSFQRSALLKSRDQNVVTYNLFFTLPQNHSGVSSSQMNKMTTVYLDYPSNLRDFLLHLFKIGFLSANSIPSMSLDLLPVIHNCSLLMSIMKSRSSYLSLGF--------QDSETIVKITNPSNLYEIVQRMCNWFESHSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNI--SPFLFESAEACHLSSNLLTKINSEK---ILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPK-STIESIQERLK-KVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNELG--NEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLL-AIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITS---SKWMLRGVFITIN 15179
            E   ++KE   L ++Y   I ++  ++ E + +  RL     L+  +     +W     +    R  +   CL+ +A+L+Y G   +E    F D  V     + ++      S+   +   L  ++EIS+  S  LP  E  + N       S    + L  D  ++A++W+ R     N  V S++D     +LE  +  G   +  D D +    D ++  V     +   + + F IL   + EV+   NFRL+L+T  +       +     ++++  ++  L ++ LS  +   +  ++ + + L++E  + K  L  LE+ +L +L+    N + ++E   T+ +      E++  L+  E       +  D Y   A R A +F + S M  V   Y      +L +F   ++ S       +RL N  I+D LT     Y    + + +K +FS  ++I+I +    V   + ++              F+K N S + S  KKP  W+S++   ++ +L+     F DI  N+  D  E+H   W+  +D +S E        + ++I A+QKL ++R  R DR+ +A   ++  T+  K+   V P  I        ++P+S I+      S   + L      S                G +L +  +      +    L++++       L + ++++        S E I+  H   R+    D    F    L KS    VVT       P N       ++N M   Y              FKI        P  +    P+++  +   ++++ R  +  +G+         D +  ++I N        QR          I W  L+Y + E++YG +     DR  + +  D +L  + +   F+ P   +    V Y   +   +IK  F+    +  L  + E   L SN      ++    +    ++   QT    S +S        ++ + ++ K++ +K+PK   ++ +++ L   +T     S  L++EL  ++ +   +   + + ++ +  E+G  NE+ D    V  SL    +P  W     +     G    +W+   L ++      +   +  V   WL     PES L A+ +          DRS  +  V        +D D + E    G +V GL+L G  +D   G L     K +   LP+  I  T     K +N+  +  P++  S  +    + +    +  T+   S W+L+GV +T+N
Sbjct: 3344 ELAAIQKELEALGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENVRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWE----FRDEMVNQVWQNDILDRDIPLSQPFRLENLLTDDVEISRWGSQGLPPDELSVQNGILTTRAS---RFPLCIDPQQQALNWIKRKEEKNNLRVASFNDPDFLKQLEMSIKYGTPFLFHDVDEYI---DPVIDSVLEKNIK-TSQGRQFIIL--GDKEVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVELVQTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFLEVFGLSLKKSLPDSILLKRLKN--IMDTLTFNIYNYGCTGLFERHKLLFSFNMTIKIEQAEGRVPQEELDF--------------FLKGNISLEKSKWKKPCTWLSDQGWEDIILLSQK---FSDIFGNLPLDI-EHHLPMWQEWYDQDSLEQFPF-PLGYDDNITAFQKLLILRCFRVDRVYRAVTDYVTLTMGEKY---VQPPMISFEAIFEQSTPNSPIVFILSPGSDPASDLMKLAERS-------------GFGGTRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHPDFRLWLTTDPTKGFPIGILQKSL--KVVTE------PPN-----GLKLN-MRATY--------------FKISNDMLEQCPHTAFK--PLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQR-------DPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTTYMDEYL-GDFIFDTFQ-PFHFFRNKDVDY--KIPVGDIKDKFVEAIEALPLANTPEVFGLHSNAEIGYYTQAARDMWGHLLELQPQTGESSSGVS-------RDDYIGQVAKDIENKMPKIFDLDQVRKHLGLSITPT---SVVLLQELGRFNKLVIRMTRSLAELQRALAGEVGMSNELDD----VARSLFLGHIPHIWRKLAPDTLKTLG----NWMVYFLRRFSQYTLWVTEGEPSVM--WLSGLHIPESYLTALVQATCRRNGWPLDRSTLFTQVTKF-----QDADEVNERAGQGCFVSGLYLEGADWDIERGCLVKSKPKVLVVDLPILKIIPTEGHRLKLQNT--FRTPVYTTSMRRNAMGIGLVFEADLFTAKHISHWVLQGVCLTLN 4532          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah17 (dynein, axonemal, heavy chain 17 [Source:MGI Symbol;Acc:MGI:1917176])

HSP 1 Score: 417.542 bits (1072), Expect = 1.064e-115
Identity = 462/2108 (21.92%), Postives = 904/2108 (42.88%), Query Frame = 3
Query: 3720 DTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTE--LEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINP-IIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTD-PAFREPLQIDKIFSSSREEIV-LNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSD-KKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDL--GYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLR-RCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNEN--RFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNR--NDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKR-SIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQMLVDN---KEIGGELHIQRLFVFCFIWSLNS-----QISDLNKQAITTLLKR-ETLVLPDDDNSICIFDYYVD-ESGEWDLWSSLL--MDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFN---IIVSLATNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQ-ASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPL-LLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKK---SAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKD-SEDSYLMADANYF 9938
            D+Y  L E+++       N +     ++ DC     + F+  LL+ +  W     + L++     L +   +       LK+ + E   + L E++G L ++ +  +  DS+++P++     L+ +   +      +L  L + W+   K+A   +  +   + N  +  L ++ ++F ++  +FR  F  + P  + SDP E  + L   +   S  E     L   + LF + V  + +L++   ++ LL +L+ +    +    ++    W  ++++ + +   +F  +  +L  ++K  +++  L   +  +I     ++ L +  IR+RHW Q+MQ T   F++   T   +DL  + L + + E+  I   A KE  +E  L  ++  WT      + H R G ++L  +    L++ LED+Q+ L N+  S+++     E   W  KL     V+ +W EVQ+ W +LE++FI    I   L ++ KRF+ +D+ +   M    +T NV +     +   K  L+N++  L  C  +L  YL  KR  F R +FV  + +L IL+  ND   +  HL  +F ++  L     A  +PL+      S  +E V  + +  +  +V  WLN + + +  ++ +   +A+         E+    +P+Q+  +   + W+ E+  A + ++   + ++    KK  +Q++ +   L  N        +TA  R ++ ++    ++ RD +  +   K+     F     ++ +         +K       C   +   YE+ G+ P +  TP T++  +TL  SL      +  G + +GK+   ++L R         +C   M  +S  N   G+A  G WG  D    +    LS+  V +  ++DAI+ K    + +  E I L V T   F +  P  +    LP N+   FR  A+  PD   I +   V   +  +R LA +  T+      L+++       LR+I          K  L++    GS + G  T                                        + E  +++ A+ +  +P I  ++      ++ D F        +++           IIK++ +  +       + K VQL  +++    + + G   SGKS      L +LN   +N  R   + DL                  DP+ +                  E+FG  +    ++ DGLF+ + R +    ++   WIV DG I P W ++L +++DD   L L    R+P ++ ++ VFE++ ++ A+P  VSR+G++Y     +GW  +   W+E ++   E   L  +FDK L   +  +    K ++        Q  L +L  +L +     +   EL+ +  FVF   W+        Q+ D   +     +   +T+ LP       IFDYY+D E+ ++  W+  +   +    + LQ +   LV T  T+R +YF+D+    +  V L+G  G+GKS+++ +           +    ++++T S+ L+  LE  +E + G  YG    K L   I+D+N+P   E+D      P+ ++RQ ++        Y  +++ L D +    +  +   S +  +DPRL RHF    +  P    L SI   +   H+ S  +  + I + +S L++A   L++KV++    ++   + H  FNLR +++I  GI  F+       PL L++ W + + RV+ D ++ + D +  +    A ++  +  ++   N+  + N     T+                  +  PK    + D+    + L   ++ + E      +NL+  ++ +  I  I+R +  P  G+ +L+G  GS    +  +A  I+ + + ++      A+ D    +  Q      K   S  L+T   +     L  +N L+ SG+ P LF  +++  ++S+++  +K    + T    +     F  ++RR L ++LC  P   ++     K+P +++  A+NW  +  ED+ +   A + 
Sbjct: 1037 DSYEKLYEEVSSC----ENTKVFHGWLQCDC-----RPFKQTLLNTIKRWSFLFKRYLNNHVINSLADLESFMNITRTALKKPLKEGDYDGLVEVMGHLMKVKERQVATDSMFEPLKQTIELLKSYGEEMPEEIYLKLQELPEQWTNTKKLAIQVKQNVAPLQANEVNI-LRRKCQQFELKQHEFREKFRRDAP-FSFSDP-EPYKSLNKQQKSISAMEGVMEALCKSASLFEVTVPDYKQLKACHREVRLLKELWDMIVMVNTSIDDWKTTKWKDINVEQMDIDCKKFAKDVRSLDKEMKPWDAFVGLDNTVKNMITSLRAVSELQNPAIRDRHWQQLMQATQVKFEMSEET-TLADLLQLNLHKYEDEVRNIVDKAVKESGMEKVLKTLDITWTTMEFEHELHPRTGTMML--KSDEVLVETLEDNQVQLQNLMMSKYLSHFLKEVTSWQQKLSTADSVISIWFEVQRTWSHLESIFIGSEDIRAQLPEDSKRFDAIDQEFKALMEDAVKTPNVVEATNKPDLYNK--LENLKMSLAVCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNDPVEVSRHLSKLFDSLCKLKFRLDASGKPLKFGLGMYSKEDEFVDFDKECDLSGQVEVWLNRVLDRMRATLRHEIPEAVVTYEEKPR-EQWIFDYPAQVALTCTQIWWTTEVGLAFARLEEGYENAIKDYNKKQISQLNALITLLIGN--------LTAGDRMKIMTICTIDVHARDVVAKMITAKVESSQAFTWQSQLRHRW------DEEKKHCFANICDAQIKYSYEYLGNTPRLVITPLTDRCYITLTQSLHLIMGGAPAGPAGTGKTETTKDLGRALGTMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVIAVQVKCVQDAIRAKKKKFNFL-GEIISL-VPTVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLDARLLARKFITLYTLCKELLSKQDHYDWGLRAI----------KSVLVV---AGSLKRGDPT----------------------------------------RAEDQVLMRALRDFNIPKIVTDDLPVFMGLIGDLFPALDVPRKRDLN-------FEKIIKQSIVELKLQAEDSFVLKVVQLEELLQVRHSVFVIGNAGSGKSQ----VLKSLNKTYQNLKRKPVAVDL------------------DPKAVTCD---------------ELFGIINPATREWKDGLFSTIMRDLANLTHEGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNRTMRLVFEISHLRTATPATVSRAGILYINPADLGWNPVVSSWIERRKVQSEKANLIILFDKYLPTCLDKLRIGFKRITPVPEITVIQTILYLLECLLTEKNAPPDSPKELY-ELYFVFACFWAFGGAMFQDQLIDYRVEFSKWWINEFKTIKLPSQGT---IFDYYIDPETKKFLPWTDKVPNFELDPDIPLQAS---LVHTTETIRIRYFIDLLMEKAWPVMLVGNAGTGKSVLMGDKLENLSTDDYLVQAVPFNFYTTSAMLQGVLEKPLEKKSGRNYGPPGTKKLIYFIDDMNMP---EVDKYGTVAPHTLIRQHMD----HRHWYDRQKLTLKDVHNCQYVACMNPTSGSFTIDPRLQRHFCVFAVSFPGQEALTSIYNTILAQHL-SFRSAPLVIQRLSSHLVTAALALHQKVSATFLPTAI--KFHYIFNLRDLSNIFQGI-LFSTAEILKTPLDLVRLWLHEAERVYGDKMVDEKDQETLHRVTIASVKKFFD-DLGEENLFAKPNIFCHFTQ-----------------GIGDPKY-FPVTDVAQLNKLLKDVLDSYNEV--NAVMNLVLFEDAVAHICKINRILESP-RGNALLVGVGGSGKQSLSRLAAYISALDVFQITLKKGYAIPDLKMDLATQYIKSAVKNVPSVFLMTDSQVAEEQFLVLINDLLASGEIPGLFGDEDLENIISSMRPQVKSLGIADTREACWKF---FIEKVRRQLKVILCFSPVGSVLRVRARKFPAVVNCTAINWFHEWPEDALVSVSARFL 2970          

HSP 2 Score: 85.5001 bits (210), Expect = 2.841e-15
Identity = 98/465 (21.08%), Postives = 193/465 (41.51%), Query Frame = 3
Query: 13806 SIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFESHSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSE----IKKAFLNISPFLFESAEACHLSSNL-LTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTIESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYK-DVKCL-IEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITIS-KEGITSSKWMLRGVFITI 15176
            +++  R  + + G+  S       N  +L   +  + N+ E++S + W+ LRY   EI+YG  +T + DR    +    ++    +  E          P     PN+ +      I +     SP+L+      H ++ +    + SEK+      +    +  K T S        E ++  +  ++  K+P++   ++ E + K      Y     +E    + +  E+   +++    +  EL       D+S   +L  + VP+ W+ +   P   S      W + LL + + +E    +     T  WL  F  P+S L    + ++       R   +  D  CL +E T K+++ +  PP +G YV+GL + G  +D  TG +++  +K +   +PV  I      +D+ E  + Y CP++   T  + P    T + K    ++KW+L  V + +
Sbjct: 4032 AVVAERRKFGAQGWNRSYPF----NNGDLTISINVLYNYLEANSKVPWDDLRYLFGEIMYGGHITDDWDRRLCRTYLAEYIRVEMLEGEVLL------APGFQIPPNLDYKGYHEYIDENLPPESPYLY----GLHPNAEIGFLTVTSEKLF-----RTVLEMQPKETDSGAGTGVSREEKVKAVLDDILEKIPETF--NMAEIMAKAAEKTPYVVVAFQECERMNILTNEMRRSLKELNLGLKGELTITTDMEDLST--ALFYDTVPDTWVAR-AYP---SMMGLAAWYADLLQRIRELESWTTDFALPTTV-WLAGFFNPQSFLTAIMQSMA-------RKNEWPLDKMCLSVEVTKKNREDMTAPPREGSYVYGLFMEGARWDTQTGVIAEARLKDLTPVMPVIFIKAI--PVDRMETKNIYECPVY--KTRIRGPTYVWTFNLKTKEKAAKWILAAVALLL 4457          

HSP 3 Score: 85.1149 bits (209), Expect = 2.913e-15
Identity = 128/571 (22.42%), Postives = 250/571 (43.78%), Query Frame = 3
Query: 11607 CLISSAYLAYCGPLNFEQRSKFLD-FCVASARSSGLVTNRFGCSKIEITQ------FLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWL-DRYLIHYNPVVISYSDLHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLS----NGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQ-------KDYSVDFEKYLNLFDSMIESSERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEI---HKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKF-KGTVTPSDIRLSLRATSPSSAIL 13250
             L+ SA+++Y G    + R++ ++ F +          N+     I IT+       L  + +++   +  LP      +NA  + N      W LI D   + I W+ ++Y      + +      + +E  +++G  ++I +  I +  +  +   + R+    +K+ +  KI    + EVE HP+FRL LHT          + +   L++F  +   L ++ L+  + K +P ++     L + + + K  L +LE+ +L  LS    N + +   +EN  T         EI   +Q+ +       ++ +NY   A R + ++ + + +  +        K ++V FEK +       E  +R+ N  + D++T     Y+   + + +K +F   ++ ++    K  N VEL  D  L  P    + S                 P D++  +S   +K L+  +  FK++  ++   +K   WK L +SE+PE   I  + +KN   A QKLC++R +RPDR+  A   F++  +  KF +G     +   S + +SPS+ I 
Sbjct: 3353 VLLISAFVSYVGYFTKKYRNELMEKFWIP-------YINKLKVP-IPITEGLDPLTLLTDDADVATWNNQGLPSDRMSTENATILCN---TERWPLIVDAQLQGIKWIKNKYGSDLQAIRLGQKSYLDIIEQAISAGDTLLIEN--IGETVDPVLDPLLGRNT---IKKGRFIKI---GDKEVEYHPSFRLILHTKYFNPHYKPEMQAQCTLINFLVTRDGLEDQLLAAVVAKERPDLEQLKANLTKSQNEFKIVLKELEDSLLARLSAASGNFLGDTALVENLETT---KHTANEIEEKVQEAKITEVKINEARENYRPAAERASLLYFILNDLNKINPIYQFSLKAFNVVFEKAIQKTAPADEVKQRVIN--LTDEITYSVYMYTARGLFERDKLIFLAQVTFQVLSMKKELNPVEL--DFLLRFPFKAGVVS-----------------PVDFLQHQSWGGIKALSE-MDEFKNLDSDIEGSAK--RWKKLVESEAPE-KEIFPKEWKNKT-ALQKLCMVRCMRPDRMTYAVKNFVEEKMGSKFVEGRSV--EFSKSYKESSPSTPIF 3873          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah17 (dynein, axonemal, heavy chain 17 [Source:MGI Symbol;Acc:MGI:1917176])

HSP 1 Score: 405.601 bits (1041), Expect = 4.494e-112
Identity = 465/2110 (22.04%), Postives = 904/2110 (42.84%), Query Frame = 3
Query: 3720 DTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTE--LEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFR--NQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINP-IIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTD-PAFREPLQIDKIFSSSREEIV-LNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSD-KKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDL--GYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLR-RCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNEN--RFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNR--NDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKR-SIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQMLVDN---KEIGGELHIQRLFVFCFIWSLNS-----QISDLNKQAITTLLKR-ETLVLPDDDNSICIFDYYVD-ESGEWDLWSSLL--MDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFN---IIVSLATNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQ-ASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPL-LLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKK---SAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKD-SEDSYLMADANYF 9938
            D+Y  L E+++       N +     ++ DC     + F+  LL+ +  W     + L++     L +   +       LK+ + E   + L E++G L ++ +  +  DS+++P++     L+ +   +      +L  L + W+   K+A   +  +   + N  +  L ++ ++F ++  +FR  F  + P  + SDP       E ++  N+ S  E     L   + LF + V  + +L++   ++ LL +L+ +    +    ++    W  ++++ + +   +F  +  +L  ++K  +++  L   +  +I     ++ L +  IR+RHW Q+MQ T   F++   T   +DL  + L + + E+  I   A KE  +E  L  ++  WT      + H R G ++L  +    L++ LED+Q+ L N+  S+++     E   W  KL     V+ +W EVQ+ W +LE++FI    I   L ++ KRF+ +D+ +   M    +T NV +     +   K  L+N++  L  C  +L  YL  KR  F R +FV  + +L IL+  ND   +  HL  +F ++  L     A  +PL+      S  +E V  + +  +  +V  WLN + + +  ++ +   +A+         E+    +P+QI        W+ E+  A + ++   + ++    KK  +Q++ +   L  N        +TA  R ++ ++    ++ RD +    AK I      E  +    ++ +      +K       C   +   YE+ G+ P +  TP T++  +TL  SL      +  G + +GK+   ++L R         +C   M  +S  N   G+A  G WG  D    +    LS+  V +  ++DAI+ K    + +  E I L V T   F +  P  +    LP N+   FR  A+  PD   I +   V   +  +R LA +  T+      L+++       LR+I          K  L++    GS + G  T                                        + E  +++ A+ +  +P I  ++      ++ D F        +++           IIK++ +  +       + K VQL  +++    + + G   SGKS      L +LN   +N  R   + DL                  DP+ +                  E+FG  +    ++ DGLF+ + R +    ++   WIV DG I P W ++L +++DD   L L    R+P ++ ++ VFE++ ++ A+P  VSR+G++Y     +GW  +   W+E ++   E   L  +FDK L   +  +    K ++        Q  L +L  +L +     +   EL+ +  FVF   W+        Q+ D   +     +   +T+ LP       IFDYY+D E+ ++  W+  +   +    + LQ +   LV T  T+R +YF+D+    +  V L+G  G+GKS+++ +           +    ++++T S+ L+  LE  +E + G  YG    K L   I+D+N+P   E+D      P+ ++RQ ++        Y  +++ L D +    +  +   S +  +DPRL RHF    +  P    L SI   +   H+ S  +  + I + +S L++A   L++KV++    ++   + H  FNLR +++I  GI  F+       PL L++ W + + RV+ D ++ + D +  +    A ++  +  ++   N+  + N     T+                  +  PK    + D+    + L   ++ + E      +NL+  ++ +  I  I+R +  P  G+ +L+G  GS    +  +A  I+ + + ++      A+ D    +  Q      K   S  L+T   +     L  +N L+ SG+ P LF  +++  ++S+++  +K    + T    +     F  ++RR L ++LC  P   ++     K+P +++  A+NW  +  ED+ +   A + 
Sbjct: 1037 DSYEKLYEEVSSC----ENTKVFHGWLQCDC-----RPFKQTLLNTIKRWSFLFKRYLNNHVINSLADLESFMNITRTALKKPLKEGDYDGLVEVMGHLMKVKERQVATDSMFEPLKQTIELLKSYGEEMPEEIYLKLQELPEQWTNTKKLAIQVKQNVAPLQANEVNI-LRRKCQQFELKQHEFREKFRRDAP-FSFSDP-------EPYKSLNKISAMEGVMEALCKSASLFEVTVPDYKQLKACHREVRLLKELWDMIVMVNTSIDDWKTTKWKDINVEQMDIDCKKFAKDVRSLDKEMKPWDAFVGLDNTVKNMITSLRAVSELQNPAIRDRHWQQLMQATQVKFEMSEET-TLADLLQLNLHKYEDEVRNIVDKAVKESGMEKVLKTLDITWTTMEFEHELHPRTGTMML--KSDEVLVETLEDNQVQLQNLMMSKYLSHFLKEVTSWQQKLSTADSVISIWFEVQRTWSHLESIFIGSEDIRAQLPEDSKRFDAIDQEFKALMEDAVKTPNVVEATNKPDLYNK--LENLKMSLAVCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNDPVEVSRHLSKLFDSLCKLKFRLDASGKPLKFGLGMYSKEDEFVDFDKECDLSGQVEVWLNRVLDRMRATLRHEIPEAVVTYEEKPR-EQWIFDYPAQIW-------WTTEVGLAFARLEEGYENAIKDYNKKQISQLNALITLLIGN--------LTAGDRMKIMTICTIDVHARDVV----AKMIT----VESSQAFTWQSQLRHRWDEEKKHCFANICDAQIKYSYEYLGNTPRLVITPLTDRCYITLTQSLHLIMGGAPAGPAGTGKTETTKDLGRALGTMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVIAVQVKCVQDAIRAKKKKFNFL-GEIISL-VPTVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLDARLLARKFITLYTLCKELLSKQDHYDWGLRAI----------KSVLVV---AGSLKRGDPT----------------------------------------RAEDQVLMRALRDFNIPKIVTDDLPVFMGLIGDLFPALDVPRKRDLN-------FEKIIKQSIVELKLQAEDSFVLKVVQLEELLQVRHSVFVIGNAGSGKSQ----VLKSLNKTYQNLKRKPVAVDL------------------DPKAVTCD---------------ELFGIINPATREWKDGLFSTIMRDLANLTHEGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNRTMRLVFEISHLRTATPATVSRAGILYINPADLGWNPVVSSWIERRKVQSEKANLIILFDKYLPTCLDKLRIGFKRITPVPEITVIQTILYLLECLLTEKNAPPDSPKELY-ELYFVFACFWAFGGAMFQDQLIDYRVEFSKWWINEFKTIKLPSQGT---IFDYYIDPETKKFLPWTDKVPNFELDPDIPLQAS---LVHTTETIRIRYFIDLLMEKAWPVMLVGNAGTGKSVLMGDKLENLSTDDYLVQAVPFNFYTTSAMLQGVLEKPLEKKSGRNYGPPGTKKLIYFIDDMNMP---EVDKYGTVAPHTLIRQHMD----HRHWYDRQKLTLKDVHNCQYVACMNPTSGSFTIDPRLQRHFCVFAVSFPGQEALTSIYNTILAQHL-SFRSAPLVIQRLSSHLVTAALALHQKVSATFLPTAI--KFHYIFNLRDLSNIFQGI-LFSTAEILKTPLDLVRLWLHEAERVYGDKMVDEKDQETLHRVTIASVKKFFD-DLGEENLFAKPNIFCHFTQ-----------------GIGDPKY-FPVTDVAQLNKLLKDVLDSYNEV--NAVMNLVLFEDAVAHICKINRILESP-RGNALLVGVGGSGKQSLSRLAAYISALDVFQITLKKGYAIPDLKMDLATQYIKSAVKNVPSVFLMTDSQVAEEQFLVLINDLLASGEIPGLFGDEDLENIISSMRPQVKSLGIADTREACWKF---FIEKVRRQLKVILCFSPVGSVLRVRARKFPAVVNCTAINWFHEWPEDALVSVSARFL 2957          

HSP 2 Score: 85.5001 bits (210), Expect = 2.230e-15
Identity = 128/571 (22.42%), Postives = 250/571 (43.78%), Query Frame = 3
Query: 11607 CLISSAYLAYCGPLNFEQRSKFLD-FCVASARSSGLVTNRFGCSKIEITQ------FLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWL-DRYLIHYNPVVISYSDLHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLS----NGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQ-------KDYSVDFEKYLNLFDSMIESSERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEI---HKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKF-KGTVTPSDIRLSLRATSPSSAIL 13250
             L+ SA+++Y G    + R++ ++ F +          N+     I IT+       L  + +++   +  LP      +NA  + N      W LI D   + I W+ ++Y      + +      + +E  +++G  ++I +  I +  +  +   + R+    +K+ +  KI    + EVE HP+FRL LHT          + +   L++F  +   L ++ L+  + K +P ++     L + + + K  L +LE+ +L  LS    N + +   +EN  T         EI   +Q+ +       ++ +NY   A R + ++ + + +  +        K ++V FEK +       E  +R+ N  + D++T     Y+   + + +K +F   ++ ++    K  N VEL  D  L  P    + S                 P D++  +S   +K L+  +  FK++  ++   +K   WK L +SE+PE   I  + +KN   A QKLC++R +RPDR+  A   F++  +  KF +G     +   S + +SPS+ I 
Sbjct: 3340 VLLISAFVSYVGYFTKKYRNELMEKFWIP-------YINKLKVP-IPITEGLDPLTLLTDDADVATWNNQGLPSDRMSTENATILCN---TERWPLIVDAQLQGIKWIKNKYGSDLQAIRLGQKSYLDIIEQAISAGDTLLIEN--IGETVDPVLDPLLGRNT---IKKGRFIKI---GDKEVEYHPSFRLILHTKYFNPHYKPEMQAQCTLINFLVTRDGLEDQLLAAVVAKERPDLEQLKANLTKSQNEFKIVLKELEDSLLARLSAASGNFLGDTALVENLETT---KHTANEIEEKVQEAKITEVKINEARENYRPAAERASLLYFILNDLNKINPIYQFSLKAFNVVFEKAIQKTAPADEVKQRVIN--LTDEITYSVYMYTARGLFERDKLIFLAQVTFQVLSMKKELNPVEL--DFLLRFPFKAGVVS-----------------PVDFLQHQSWGGIKALSE-MDEFKNLDSDIEGSAK--RWKKLVESEAPE-KEIFPKEWKNKT-ALQKLCMVRCMRPDRMTYAVKNFVEEKMGSKFVEGRSV--EFSKSYKESSPSTPIF 3860          

HSP 3 Score: 79.7221 bits (195), Expect = 1.554e-13
Identity = 98/488 (20.08%), Postives = 198/488 (40.57%), Query Frame = 3
Query: 13806 SIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFESHSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSE----IKKAFLNISPFLFESAEACHLSSNL-LTKINSEKIL------------------IEKIDKVSQTINEKSTISFQ-----IDLTKVENELFEICKNLASKLPKSTIESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYK-DVKCL-IEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITIS-KEGITSSKWMLRGVFITI 15176
            +++  R  + + G+  S       N  +L   +  + N+ E++S + W+ LRY   EI+YG  +T + DR    +    ++    +  E          P     PN+ +      I +     SP+L+      H ++ +    + SEK+                   + + +KV      + ++  +     I L     ++  +  ++  K+P++   ++ E + K      Y     +E    + +  E+   +++    +  EL       D+S   +L  + VP+ W+ +   P   S      W + LL + + +E    +     T  WL  F  P+S L    + ++       R   +  D  CL +E T K+++ +  PP +G YV+GL + G  +D  TG +++  +K +   +PV  I      +D+ E  + Y CP++   T  + P    T + K    ++KW+L  V + +
Sbjct: 4026 AVVAERRKFGAQGWNRSYPF----NNGDLTISINVLYNYLEANSKVPWDDLRYLFGEIMYGGHITDDWDRRLCRTYLAEYIRVEMLEGEVLL------APGFQIPPNLDYKGYHEYIDENLPPESPYLY----GLHPNAEIGFLTVTSEKLFRTVLEMQPKETDSGAGTGVSREEKVGAVPVPEGSLGSEGSLGTIGLPGTGFQVKAVLDDILEKIPETF--NMAEIMAKAAEKTPYVVVAFQECERMNILTNEMRRSLKELNLGLKGELTITTDMEDLST--ALFYDTVPDTWVAR-AYP---SMMGLAAWYADLLQRIRELESWTTDFALPTTV-WLAGFFNPQSFLTAIMQSMA-------RKNEWPLDKMCLSVEVTKKNREDMTAPPREGSYVYGLFMEGARWDTQTGVIAEARLKDLTPVMPVIFIKAI--PVDRMETKNIYECPVY--KTRIRGPTYVWTFNLKTKEKAAKWILAAVALLL 4479          
BLAST of Dynein heavy chain 5, axonemal vs. UniProt/SwissProt
Match: sp|Q39575|DYHG_CHLRE (Dynein gamma chain, flagellar outer arm OS=Chlamydomonas reinhardtii OX=3055 GN=ODA2 PE=1 SV=1)

HSP 1 Score: 634.795 bits (1636), Expect = 1.268e-180
Identity = 606/2698 (22.46%), Postives = 1173/2698 (43.48%), Query Frame = 3
Query: 2040 MNNFDKTFSIFLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETV---KQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQV---------AGMHSEFSKLLKYLATQKIYNFNHLLSKNWDSNEFTEAINKDLLAKKSTVQRTLEACSNILKEITEIISIVEKLDPNSSLYESEDLIFGQMKEMYNKSLSQSLYRSIINNLVYLAICSNCQKEHLELLTSRAEYDPVTGINDNLCSSYGEEVFCINDIKPIYDSDHAESKTLIKFILLVKYEIPMIKFEPELDAIQSIIEQMGQDIMAFHNDVSDFSGRKLNLYIKLESDLFYEFSQIISLKYSESRLKLQ--STVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMA-GSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWS--VVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPS-IFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQI-SRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKM-----KTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNRN-DLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGELH---IQRLFVFCFIWSLNSQIS----DLNKQAITTLLKRETLVLPDDDNSICIFDYYVDES-GEWDLWSSLLM--------DEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMK-LSDFNIIVSLATNSSADLLDP-RLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGI---------------KSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDS----INLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFD-LIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            +N+ +     F+N  F     T  ALS++++F  +  R++++  + +K   +F N+  D+    + Y++ K +         V   + W ++LL  IE PM   Q+ K +   KE +  +K YNKV+K LI  ++ +   W+ +++ C A L  PLLV      K+ +N  + ++ ++ E + M R   + S  +  +L  E + K++ ++L   V  +E V     +I P    L + H+  + +    G + L+WT++NID +LH+    +  LE ++ +V         + + +  S LL  L T + + +   +    + N F +   + L  +   V+R +E    +++              N     +ED++  +   +  +  S+++Y +I+           C    L+ +  R      TGI            F +   +P +D D             V+ ++P +   P L+ IQ+ I Q  + ++     +  +    +  Y ++          ++ L  S   +K Q    +   +++DFLWK    +  ++  +    T  + + ++ + + ++  +  +     I  L + T   +  L +    W+ +  QNLH +    L      R+T   +  + + +LE +  ++ +L ++ + + +ID++  PIE MY  L  +E+ + + E   + +LR  W  L K+A    + L   +   F +EL K++K F V+   FR   D+E  +M  G DP E   +L  F+  + + + K     +  +LFGL V  + ELE  ++++ +L +LYSLY       K + D  W   V  +D++  ++ ++ ++   LP KL++  +Y   +  ID  +++  +   L  K +R RHW +VM+VTG    L    FK   L    +L  +++I+ +   A KE  +E+KLNQ++ +W    L    +  RG V+L+   T+ L+++LE+SQ+ L +M  +R+  P +DE   W+ KL  +SE+++ WL VQ +W  +E VF    I+K L QE KRF  +DK+++K +    ET+NV   C  NE   K  L ++ + LE C  SL  YL QKR  F R   V    +L I   ++D  ++  H  S +F +++++  D    +  ++ ++FS   E++     +  K  +  WL  L + +E+++  +   A++ ++    LE+     P+Q+    +   W+ E   A+S  K DK  ++   KK +  +   + IT+  +        +T  QR  L +     ++ ++S  +L  KKI+D  DFE  K ++      K TV+ S+ +  F+ +         +E+ G    +  TP T+   +TL  +L      +  G + +GK+   ++L     +Y V  +C        +     G+A +G WG  D    ++   LS+    +  I    +++  +    +   + L     FF T   P  +    LP N+   FR V +  P+   I+K       Y+ +  L+ + + +       +++       LR+I++ L  A A K+                                  +SP  S                   E  L++  + ++ +     E+      ++ D F G     ++       PD+     K    R   +    M K +QLY       G++L GP+ SGKS   +   AAL                                    L   H ++ + P +     +MFG       D+ DG+F  LWRR  +N +  +WIV DG +   W +NL ++LDD   L L +G R+  S  +K +FE  ++ +ASP  VSR+G++Y     +GW      WL+ +   E     ++F K +D +++++  + K +  N         + +L+  L   KE G  ++    +R+F++C  WSL   +      L  Q + T       + P +++S  IF++ V+ +  EW  W   +         ++ +Y       ++++ T+ ++R    L+++        L+G  G+ K+  ++    K +          +S  T     +  +E  +E RQG  +G    K + + ++D+++P    I+    +  NE++RQLL    + + + P   MK ++D   + ++ T        P RL R F    + +P  + +  I   + E        C+  +  AS+L+  T  L+ ++ + +    T  + H  FN+R ++ +  G+                 F  +  S E  LL  W +  RRVF D LI   D  W +  +  + ++ +S ++    V     F+ F  E        ++     + + S P     + ++ ++ E L       Q KF ++S    + L+   + +  ++ I R +  P  G +V +G  G     +  ++  IA       +T N   L + +K + +  G +G+    + T   +K    L+ +N ++++G+   L   ++   +++ ++  MK +  +  IL  +D L   F +R+R +LH++LC  P          ++PG+++   ++W        L + +  F++
Sbjct:  492 INDLELQLQGFVNASFEHITSTEHALSLLAQFQAIMQRETLQQDLENKYMVIFQNYAKDLDAVQKLYEKNKYEPPVPRNAPPVAGNIMWARQLLRRIEAPMQLAQN-KNLLAAKESKKNIKTYNKVAKALIEFETLWHQAWIKSIEQCKAGLAAPLLVQHPDTGKILVNFDKEIMQLVREAKYMQRFNIRCSSPSQMVLLQEEKFKFYHNQLTHLVREYEHVLGRGATIKP----LLRPHLDDMERKIAPGFAVLTWTSLNIDGYLHRFKQGLARLEELVRKVVDLTENRVDSNLGAISSTLLVELPTDRSFTYEGFV----EQNRFQKKQAELLAIRNEEVRRAIEDLYTLVR--------------NYPRENTEDVLDEKEVSLLVRHYSKNMYNAIMQ----------CTLNSLQAMKRRLGSKTTTGI------------FFME--RPFFDVD-------------VELKVPSVCMNPTLEEIQAAINQCAKKVLTISKQLPAWGMDNVATYHEMMRGDRRWVKAVLRLTGSVEGIKTQVGEYIRTFDKYDFLWK-EDLQAAYDHFMRSNPTLEAFEAELKKYMAIETEVTMINGVNNIGALSLETHPLKNSLKAEAVSWKTQFAQNLHKQCSDDLKLDNYIRDTN-SKFHRKIEDLEDVRNVMAVLKEVREKESEIDNLIGPIEEMYGLLMRYEVRVPKEETTMVSDLRYGWKKLKKVATEVSDNLTRLQVG-FKRELIKEVKTFVVDAQMFRK--DWEANAMVPGLDPQEAVDRLRKFQQMFEVRKRKWENYSSGEELFGLPVTQYPELEQTEKEIQMLDRLYSLYVAVITTIKGYGDYFWVDVVEKIDEMGEQVQQYQNQSKKLP-KLRDWPAYNACRKTIDDFLEMLPLFQALTHKSMRERHWKEVMRVTGHELNLAEDHFKLQHLLDCNVLRYREDIEDLTGAAVKEEIIEVKLNQLKADWATANLALAEYKNRGPVILKPSDTSELMEKLEESQMTLGSMATNRYSAPFRDEVQAWSIKLSTVSEIIEQWLMVQSMWQYMEAVFSGGDIVKQLPQEAKRFLNIDKNFMKIVSNALETQNVINTCFGNELM-KNMLPHLHEQLEMCQKSLSAYLEQKRAEFPRFTCV-GPHLLEICRWAHDPPSVVPHFQSGLFDSLSNVTFDRI--DKTRMTEMFSQQNEKVEFERPVDAKGNIEVWLQRLVDGMEDTVKQIIKRAVRNVAEM-PLEDFVFGHPAQVSLLGIQFQWTAETQMALSSAKVDKTIMNKNMKKVDALLRDMVNITVRLD--------LTKNQRTNLETCITVHMHQKESTEDLVKKKIKDPTDFEWLKQVRFYWRDDKDTVIISICDVDFEYS---------FEYLGVKERLVITPLTDICYITLSQALGMFLGGAPAGPAGTGKTETTKDLGNTLGKYVVVFNCSDQFDYTYMGKIYKGLAQSGLWGCFDEFNRINLDVLSVCAQQVYCICRT-RERKKSFQFTDGTTVSLDPRVGFFITMN-PGYAGAQELPENLKALFRGVTMMVPNRQIIMKVKLAAAGYQENDILSKKFFVLYGLCEQQLSKQAHYDFGLRNILSVLRTAGASKR----------------------------------QSPDKS-------------------EVFLMMRTVRDMNMSKFVAEDVPLFLSLIDDLFPGLKADATR-------PDVNKDAEKVVLERGLQVHPTWMNKCIQLYETYLVRHGIMLVGPSGSGKSAICECLAAALTE----------------------------------LGTKHVIWRMNPKAIT-APQMFGRRDDTTGDWTDGIFAVLWRRAAKNKNQNTWIVLDGPVDAIWIENLNTVLDDNKVLTLANGDRILMSAAMKAMFEPENLNNASPATVSRAGIIYVSDVELGWEPPVKSWLQKRDPTEA-CWARLFSKYIDRMLEFVRISLKPVMYNEQVSIVGTVMTLLNGYLKSMKEAGTAMNDAKYERVFLYCMTWSLGGLLEMKERPLFDQELRTFAHN---MPPKEEDSDTIFEFLVNTTDAEWLHWRHCVPVWTYPKNEEKPQY------AQLVIPTLDSVRYGALLNLSYNVDKATLLVGGPGTAKTNTINQFISKFNAETTANKTITFSSLTTPGIFQMSIEGAVEKRQGRTFGPPGGKQMCIFVDDISMPY---INEWGHQVTNEIVRQLLEQGGMYSLEKPIGDMKFITDVRYVAAMNTPGGGKNDIPNRLKRQFAIFNVPLPSVAAINGIFGKLVEGRFSRDVFCEEVVYVASKLVPLTITLWNRIQTKM--LPTPAKFHYLFNMRELSKVFQGVILATRDRFNLAAGDSAVFGGNVASPEGYLLGLWIHECRRVFSDKLISYEDKNWVDKAVFDLCRDNFSSDLVK-QVEEPIYFVDFLREPAVMMRPVEIVTPHPSFYYSVPG---GLPEVRARVEGL-------QRKFNEESKVMKLELVLFTDCVTHLMRITRLLAWPGLGLLVGVGGSGKQ--SLSRLSAYIAGPTFYITKTYNVSNLFEHIKGLYKIAGFKGQPVYFIFTDAEVKDEGFLEYINQILMTGEVAGLLTKEDQDMIVNDIRPVMKHQ--APGILDTYDNLYNFFLNRVRDNLHVVLCFSPVGAKFARRAQQFPGLINGCTIDWFCPGPKKRLTSVSGKFID 2974          

HSP 2 Score: 129.028 bits (323), Expect = 1.200e-27
Identity = 139/616 (22.56%), Postives = 290/616 (47.08%), Query Frame = 3
Query: 11394 EEFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDE-RAIFIQCLISSAYLAYCGPLNFEQRSKFL--DFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSD--LHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSI----DNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSERLSNKS-----IIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSNS--KKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTV 13193
            E    ++ +  +++++++  +  +  +E +  A   ++D    L+  +   E +W   SK+++ + + +   C ++SA+++Y GP N E R   L  DF     + +  VT       ++IT+FL  + E+ +     LP  E  I N   +   S    + ++ D   +   W+              +D    N LE CLA G+ ++I + +  +L  D ++  V     R +K+ KT+ + L +  EV+    FRLF  T          L++   +V F  ++  L ++ L + I K K  ++ + ++LL E +  K+++ +LE+ +L  LSN   N+  ++    +I  L + ++   ++ +K    S   K I    + Y  +A R   ++ + +  + V   Y     ++  L++  I+ SE+ +  S     II+ +T +   Y    + + +K +F+L+L       TN V       L S   V       F+K   +   NS  KKP DW+ +   +N+  L+A +  F+DI ++++++  +  W+  +D E+PE + + +  +++ ++ ++++C+++T R DR + A+  +I   L  +F  +V
Sbjct: 3293 ERMAKVQAKLDEMQAQFDAAMAHKQALEDDAAATQRKMDSANALIGALAGEEARWTAQSKEFDVQIQRLTGDCALASAFVSYLGPFNKEFRELLLNRDFYGDCMKLNVPVT-----PHLQITKFLVDDSEVGEWNLQGLPTDELSIQNGIMVTRAS---RYPVLVDPQGQGREWIKNREEANQLKTTQLNDKLFRNHLEECLAFGRPLLIENIE-EEL--DPLLDPVLER--RLVKKGKTWVVPLADK-EVDFTETFRLFCTTRLPNPHFTPELSAKVTVVDFTVTMAGLEDQLLGKLISKEKKELEDQRQQLLEEVQSYKKRIKQLEDDLLCRLSNSQGNL--LDEHQELIDVLAVTKQTAQDVSEKLANASETNKRINEACEEYRPVAHRATLLYFLIAEFSVVNCMYQTSLAQFNQLYELAIDRSEKANMPSKRIHNIIEYMTYEIYLYVQRGLFERHKIIFALML-------TNKV-------LTSAGKVKATDLDVFLKGGAALDINSVRKKPKDWIPDLVWLNIIALSA-MDAFRDIPDSVFRN--DGLWRQWYDQEAPEMAKVPD--YEDRLNKFERMCVVKTFREDRTLIAAADYIAEALGQRFVESV 3873          

HSP 3 Score: 79.7221 bits (195), Expect = 9.194e-13
Identity = 96/423 (22.70%), Postives = 176/423 (41.61%), Query Frame = 3
Query: 13944 SWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYS-PNVKFSEIKKAFLNISPFLFESAEACHLSSNL---LTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTIESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISD------ADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSG-NYKDVKCLIEFTNKDKD--HIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITIS-KEGITSSKWMLRGVFI 15170
            +W  +RY +S I YGS++T + D++ + +  + +     ++  +E  K         Y  P+    E   +++   P   ES E   L  N       +  ++ ++  +D + +     S +S        E+ + +IC++L SK P    +   +   K         TL   + +   +  + LN + +     +  L   I+         +  + +L   ++P++WL+     K +   +  +W + LL +Y  + + +  N  +   YW+  F  P+  L   K+EV+    R  R      DV    E T++ KD   ++E   +G+YV+GL+L     D     L D   K +  PLPV H+   L   DK + S  Y  P  +   A++      T S +     SKW+L GV I
Sbjct: 4085 TWETVRYMISAIQYGSRITDDFDKLLMDTFAEKYFLQPVLQPSYELFKDTRSSDGFSYRVPDSTDIETFGSYIETLPGT-ESPEIFGLHPNADITFRTLQVQESIVTILDTMPKGAGSGSGLS-------REDVVDKICEDLLSKAPPLFDKEETKEKLKKLPG---GPTLPLTVHLRQEI--DRLNIVTRLTTTTLKNLALAIAGTIAAERGLIDALDALFNARIPQQWLS-----KSWEASTLGNWFTGLLQRYDQLNKWL--NLGRPKAYWMTGFFNPQGFLTAMKQEVN----RKHRDKWALDDVVMSSEVTHRPKDFESLKEGAPEGVYVYGLYL-DLRLDGRENRLMDSDPKKLFNPLPVLHVDGVLAK-DK-KRSGLYEAPKPYRVKARKGLNFITTFSVRTEDDKSKWILPGVGI 4480          

HSP 4 Score: 61.6178 bits (148), Expect = 2.908e-7
Identity = 80/371 (21.56%), Postives = 150/371 (40.43%), Query Frame = 3
Query:   72 LKMDERHWWLATRVNESLTDKIKSNVSELETAFLEFNNSNCINSFFDEDGPLVLYFAKCINSS-LKSVHVSSEIKDLNDKSLFPSEKL-TILLVIKKRXXXXXXXXFENELFCIELKN-YILQNITTIFTHGFIPLLMTKYN----SCDNTEKIYPLTSQLNSMWQ--------SVQNYTDQLYLNTNME-EPIHATIDLNKELQDPLKQFETFVTDVMSEIEVILEEVNDRTSEQDIFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIRRQILSIINNKI 1136
            + +D RH  +  ++ E+    +  NV E         +   +NSFF   GP  L F   +    LK   V           + P E++   +   +     I+    E ++   EL   + L+N   I +  ++P++  +      S +  E     T++  SM           V+   D  Y++   +  P   T     +  D L++ E  +T+   E E++L + N     ++     E+E W+ R     ++   LK K  K  +G     K+K   +WR L+  IT+A N SKD +KYL T  +E  +   Y    + +  ++P +   ++   + +R +S +  M    + I  Q++     +I
Sbjct:    1 MALDNRHRLIVGKLAEAFG--LPENVIEKTLT----QDKQAVNSFFTPAGPPSLVFVYQVKEDKLKDGSVGPVDNKPTLHRIGPHERIHNSVYFTRLNPKGINEKTLEADMGSGELSVLWALENFKAIVSDLYLPIMQEQQQWGKMSTEYLEDFLSSTAKFGSMLTEAVATVSGGVEPMPDPRYIDQYGDLRPAGITQAAGDD--DTLQEMEECLTEWCREAELLLNQTNKIKDGEERGPDTELEYWRTRMSNFNSITEHLKTKECKLVLGICSHAKTKAYLRWRGLDVQITDAANESKDNVKYLAT--LEKSMEPMYQGRVTDITESLPALMTNVRMMYTIARFYSTAEHMTRLFTKITNQLVRRCKEQI 361          
BLAST of Dynein heavy chain 5, axonemal vs. UniProt/SwissProt
Match: sp|Q96JB1|DYH8_HUMAN (Dynein heavy chain 8, axonemal OS=Homo sapiens OX=9606 GN=DNAH8 PE=1 SV=2)

HSP 1 Score: 609.757 bits (1571), Expect = 4.996e-173
Identity = 538/2156 (24.95%), Postives = 975/2156 (45.22%), Query Frame = 3
Query: 3618 RLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDL--HTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYIS-TGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKF----NTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLA-----TLTCTHDLGY----EFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYS-DSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRR---VNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQN-HKELSINSVTIAFQNSLKVLSQMLVDNKEIGGEL---HIQRLFVFCFIWSLNSQISDLNKQAITTLLKRE--TLVLPD--DDNSICIFDYYVDESGEWDLWSSLLMDEGEYL---SLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFEC-HIDSIEN-----CQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATL-QAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGK----DSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKL---ETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFD-LIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            R      +++  ++  LW    D +  +E LA   +   ++ +I      +  +  L   I +  L + T+  +  L      W+    + L++E K+ +     +    +++L + + +L+ +   +  L  I D ++++D    PIE  Y  L  FE+ + + E   +  LR  ++ L   A S +  L+  +   F   L + ++ F  +VI F   ++ E P +    P E   +L+ F+  +     K  T  +  +LFGL V  +  L   +++L LL +LY LY         + + LW  VD++ +  +L EF + C  LP  LK+ +++ +LK +ID   +   +L  + +K ++ RHW ++ ++TG  F +E+ +F   ++   PLL++K +I+ IC  A KE ++E KL Q+ E WT Q L F +   +G ++L+   +  ++  +EDS ++L ++ ++R+  P K     W  KL   S++++ WL VQ LW+ LE VF+   I K L QE KRF+ +DKS+IK M+R +E  NV  CC+ +E +    L ++ + LE C  SL GYL +KR LF R +FV D  +L IL  ++D   I  HLP++   +N++  H     R    I  + S   E+IVL+N +  K  V  WL  L      S+ N+   A   IS +G  L      FP+Q+    + + W+++   A+   K D+K +    +KF    NT IS           ++T D ++   R +  ++    ++ RD   +L    I+   DFE  K               +F        T+    D+ +    EF G    +  TP T++  +TL  +L      +  G + +GK+   +++ R   +Y V  +C   M    L     G+A +G WG  D    ++   LS+A   I  +  A K++       + + + L      F T   P  +    LP N+  +FR VA+  PD   I++       +  +  LA + Y + K     + +       LR+I++ L                        T GS           +K   P  S                   E ++V+  + ++ L  +  E+E     ++ D F G   DS++         +L NA+  + ++           K VQLY       GL+  GP+ SGK+T + I + A                      E   P      +P+ +                  +MFG   T   D+ DG+F+ LWR+     + + I +++ DG +   W +NL S+LDD  TL L +G R+P + + K +FE++++++ASP  VSR G+VY  S+ + WR I   WL+ + + E      +++K+ +    Y+  N + ++ +       Q SL +L + L+ +KE GG     H+ +LFVF  +WSL + +   +++ +   L++    L LP+    ++  ++++YV + G+W+ W+  L  +  Y    S+     +LV  +  +R  + +D   +    V L G +G+ K++++  + +K D          +S  T+    +  +E+ ++ R G  YG    + +T+ I+D+N+P   E         NE++RQ++    + +   P +   + D  +I ++       + +  RL R F      +P  + +  I  G+  C + D   +     C++ ++    L+S  + L++   + ++   T  + H  FNLR ++ I  G+ +   +  +S P LL  + +   RV  D  I   D +WFNA L +A+ +N+  G  ++  +  E  F+ F  E       +   ++        PKI   M   +    +L  ++  +Q +F +     S++L+   + +  +I I R I +   G+ +L+G  GS    +  +A  IA   I ++    + N   L D +K++ +  G++GK    + T   +K    L+ LN+L+ SG+   LF  DEM  +   +   MKRE         FD L E F SR R++LH++LC  P  +       K+PG++S   ++W        L+A A+YF++
Sbjct:  997 RKAAHEALQDFQKYKTLWTEDRD-VKVKEFLANNPSLTEIRSEILHYATFEQEIDELKPIIVVGALELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSYMIAFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYAILNRFEVEVTKEESEAVDTLRYSFNKLQSKAVSVQEDLVQVQPK-FKSNLLESVEVFREDVINFAEAYELEGPMVPNIPPQEASNRLQIFQASFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMSSISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDE-TMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDR----IMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLIS-----------QTTHD-LSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLK-------------QSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMN-PGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLR-----------------------TLGS-----------QKRARPEDS-------------------ELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTY-------AELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKA--------------------QTECGRPHREMRMNPKAITAP---------------QMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENI-FLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQ-SLNLL-EGLIPSKEEGGVSCVEHLHKLFVFGLMWSLGALLELESREKLEAFLRQHESKLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKL--QPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQIT---NEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIF-GIIGCGYFDPCRSFKPQICEMIVN----LVSVGRVLWQ--WTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENI--GSDAASCILPEPYFVDFLREMPEPTGDEPEDSV-----FEVPKIYELMPSFD----FLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISR-IIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHP--PTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLS 2995          

HSP 2 Score: 103.219 bits (256), Expect = 8.211e-20
Identity = 103/474 (21.73%), Postives = 206/474 (43.46%), Query Frame = 3
Query: 13776 PVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFES---HSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTI-ESIQERLKKVT-----NNFIYSKT--LMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGV 15164
            P+++  + L S ++ R  +  LG+     I    N ++    VQ + N  +       +SWN +RY + E+ YG +VT + D+  +      W +       F F    Y  P +  + +  F  I+      +P +F      H ++++  + N+   ++E I  +     +       +  T+ E  ++ + +++ SKLP   I   ++ RL K+      N F+  +   + + + +  S   ++   I+ T  +IM+E    + DA    + ++   ++P+ W  ++       G+    W + LL +       I   +  V  +W+  F  P+  L   ++EV+    R  +      V    E   + K+ I  PP +G+Y++GL++ G  +D+  G+L + + K + T LPV HI F +N    P++   Y CPI+          + +   +  ++   W+LRGV
Sbjct: 4048 PMLYTVAFLHSTVQERRKFGPLGW----NIPYEFNSADFSASVQFIQNHLDECDIKKGVSWNTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCF-YTGYKIP-LCKTLDQYFEYIQSLPSLDNPEVF----GLHPNADITYQSNTASAVLETITNI-----QPKESGGGVGETR-EAIVYRLSEDMLSKLPPDYIPHEVKSRLIKMGHLNSMNIFLRQEIDRMQRVISILRSSLSDLKLAIEGT--IIMSE---NLRDA----LDNMYDARIPQLW-KRVSWDSSTLGF----WFTELLERNAQFSTWIFEGRPNV--FWMTGFFNPQGFLTAMRQEVT----RAHKGWALDTVTIHNEVLRQTKEEITSPPGEGVYIYGLYMDGAAWDRRNGKLMESTPKVLFTQLPVLHI-FAINS-TAPKDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGV 4483          

HSP 3 Score: 97.4413 bits (241), Expect = 4.378e-18
Identity = 132/613 (21.53%), Postives = 279/613 (45.51%), Query Frame = 3
Query: 11412 KKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDE-RAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSK-IEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSDLHNR--LESCLASGQCMIIADCDIHQ---LAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSI----DNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSE-------RLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLI-SPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTV 13193
            + E   ++++++  + ++  +  +     +++     L++ +   + +W   SK+++ +   +    L+ + +L+Y GP N      F ++ +       L   +   ++ + +   L     I +     LP  +  I N   +   +    + L+ D   +  +W+       +  V S +  + R  LE  L+ G+ ++I D  IH+    A D ++ +       F+K   TFK+ +  + E +    F+L++ T          + + T ++ F  ++  L N+ L R I   K  ++ E  KLL +    KRK+ +LE+ +L  LS       S+ +  ++I  L+  ++  A + +K  + +  +  I    + +   A R + ++ + + M+ V   Y     ++L LFD  +  SE       R++N  II+ LT +   YS+  + + +KF+F LL++++I      V+  + + LI   +++ LK+ P              KP+ W+ + + +N+  L+  LP F +I+  + ++  E  WK  FD ++PE   I+   + +S+D   KL LIR+  PDR +  +  +I ++L  K+   V
Sbjct: 3319 QAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFN----QIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKAT---RYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIED--IHEELDPALDNVLEK------NFIKSGTTFKVKV-GDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSA---TKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITN--IIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACP-------------PKPYRWILDMTWLNLVELSK-LPQFAEIMNQISRN--EKGWKSWFDKDAPE-EEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPV 3893          

HSP 4 Score: 77.7962 bits (190), Expect = 3.847e-12
Identity = 55/283 (19.43%), Postives = 128/283 (45.23%), Query Frame = 3
Query: 2040 MNNFDKTFSIFLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAGM 2888
            +N  +     F+N  F + + + +AL ++ +F  L     +   I H I  +   + +++    + Y   K+       M  +   + W+++L   I  P+  F    ++    + +++++QYNK+S  L+  +  Y   W+  +      L+  L V      K+ +N    +L ++ ET+ MI+++  +   A  LLK E ++K     L   + Y++ + Q +    + L    +K V    + G + L+W+++ ++ F  +V  V+     ++ +++ +
Sbjct:  433 INGLEVQIQAFMNSSFGKILSSQQALQLLQRFQKLNI-PCLGLEINHTIERILQYYVAELDATKKLYHSQKDDPPLARNMPPIAGKILWVRQLYRRISEPINYFFKNSDILSSPDGKAVIRQYNKISYVLVEFEVVYHTAWIREISQLHYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKRLLKLESKLKADKLYLQGLLQYYDELCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLTLESFFQEVELVLDMFNQLLKKISDL 714          
BLAST of Dynein heavy chain 5, axonemal vs. UniProt/SwissProt
Match: sp|Q8VHE6|DYH5_MOUSE (Dynein heavy chain 5, axonemal OS=Mus musculus OX=10090 GN=Dnah5 PE=1 SV=2)

HSP 1 Score: 593.193 bits (1528), Expect = 5.314e-168
Identity = 531/2161 (24.57%), Postives = 963/2161 (44.56%), Query Frame = 3
Query: 3591 IISLKYSESRLKLQSTVENLNEFDFLWKMTSDK--LDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFS-SSR--EEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYIS-TGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISR-IPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGY----EFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTF-------QGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWR---RVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHK-ELSINSVTIAFQNSLKVLSQMLVDNKEIGGEL---HIQRLFVFCFIWSLNSQISDLNKQAITTLLK-RE--TLVLPD-DDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLT----GEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSII----RGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNC--ERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSH---LSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            ++S   S ++ ++ ++++    ++ +W+   +   + F   +A+       + +I     L+  +   P+ I +  + + T   +  L +    W    G++ + + +  ++      E   ++L + + +L+ +   +  L +I +  +  D    PIE  Y  L  + L + + E +++  LR  W  L+  A   +N+L    +  F +EL   ++ F  +  QF   +D   P  +G  P E   +L  F+NQ+     K  T     +LFGL V  + +L  +K  L LL ++YSLY    +   ++ D LWS V+++ +  +L EF + C  LP  LK+ +++ +LK  ID   +   +L  +AS  +  RHW ++  +TG +  +   TFK  ++   PLL+ K+EI+ IC  A KE ++E KL Q+  EW  + L F     RG ++L    T+ ++  +EDS +LL ++ ++R+  P K +  +W   L   +++++ W+ VQ LW+ LE VF+   I K L +E KRF  +DKS++K M R +E  NV QCC+ +E +    L ++   LE C  SL GYL +KR  F R +FV D  +L IL  ++D   I  HL ++F  +  +     F + +  D+I S SSR  E I L+  +  +  V  WLN L  E + S+  +   A   I   G  L E    FP+Q+    + + W+ +   A+   K DKK +    + F   ++  I IT        T D +++++R +  ++    ++ RD   +L    ++   DFE  K  +           ++    T+    D+ +    EF G    +  TP T++  +TL  +L      +  G + +GK+   +++ R   +Y V  +C   M    L     G+A +G WG  D    +D   LS+A   I  I    K+   +    + + + +      F T   P  +    LP N+   FR VA+  PD   I++       +  +  LA + +T+ +     +++       LR+I++ L    A K+                                   SPT +                   E  +V+  + ++ L  +  E+E     +++D F        GY             P+L  AI K+ +            K +QL+   R   G++  GP+ SGK+T +   + A+                                      + H    + P +     +MFG       D+ DG+F+ LWR   +  + + I WIV DG +   W +NL S+LDD  TL L +G R+P + N K VFE +++ +ASP  VSR+G+V+  S+++ W  I   +L+ +   E   L +++ +    + ++ IQN + ++ +    +  Q++   + Q L+  KE  GE+   H+ RLFVF  +WS+ + +    ++ +   L+ RE  TL LP   D    +FDYYV  +G W  WS   +   EY+    T    G +LV  +  +R  + +    +    V LIG +G+ K++I+     K D  +  +    +S  T     +  +E+ ++ R G  YG    K + + I+DLN+P   E         NE++RQL+  +   N + P E   + D   + ++       + +  RL R F      +P  + +  I      G +       E  Q   D   +L+  T++L++   + L+   T  + H  FNLR ++ I  G+ +   +       LL+ W +  +RV  D   + +D+ WF+  + ++++  + GE  +  V+C  +  F+ F  +   +      +     A    PK+   +  +N  RE L   + L+ E      ++++   + ++ ++ I R I  P  G+ +L+G  GS    L+++ S         I    + N   L++ +K + R  G +GK    + T   +K    L+ +N+++ SG+   LF  DE+  + S +   MK+E       TN +L E F SR+R +LHI+LC  P  +       K+P ++S   ++W        L+A + +F++
Sbjct: 1119 VLSTVISSTKKEVITSMDRFKRYNHIWQKEKEDTIMTF---IAQNPLLPEFESRILYFQSLEQEINAEPEYIRVGSIALYTADLKLSLTAETKAWMAVIGRHCNRKYRAEMENILTVVEESQKKLSRPIKDLDDIRIAMAALKEIREQQISTDFQVGPIEESYALLNKYGLLVAKEEMDKVDTLRYAWEKLLARASDVQNEL-GALQPSFRKELISTVEVFLQDCQQFYLDYDLNGPMASGLKPQEASGRLIIFQNQFDNIYRKYITYTGGEELFGLPVTPYPQLLEIKRQLNLLQKIYSLYNNVIETVNSYQDTLWSDVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKTIDDFSECCPLLEYMASNAMVERHWQRITALTGHSLDVGNETFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLRQVINEWDNKTLTFSGFKTRGELLLRGDSTSEVIASMEDSLMLLGSLLSNRYNMPFKAQIQKWVQCLSNSTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEIPNVVQCCVGDE-TMGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVK----FHDKI-YDRILSISSREGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQEPGFQLIEFLSSFPAQVGLLGIQMLWTRDSEEALRNAKFDKKIMQKTNQAFLELLNMLIEIT--------TKD-LSSMERVKYETLITIHVHQRDIFDDLCHMHVKSPTDFEWLKQCRFYF--------KEDSDKTMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMN-PGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYQLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRA----------------------------------SPTDT-------------------ESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGY-------------PELETAISKQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGSGKTTCIHTLMKAMTD----------------------------------CGKPHREMRMNPKAIT-APQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHI-WIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGFLKRRSPQEAEILRQLYAETFPDLYRFSIQNLEFKMEVLEAFVITQSTH--MLQGLIPPKEQAGEVDPEHLGRLFVFAMMWSVGAVLELEGRRRMELWLRSREGPTLHLPQLTDAGDTMFDYYVAPNGTWRHWS---LCTPEYVYPPDTTPEYGSILVPNVDNVRTDFLIKTIAKQGKAVLLIGEQGTAKTVIIKGFMSKFDPESHMVKNLNFSSATTPVMFQRTIESYVDKRMGTTYGPPAGKKMAVFIDDLNMPVINEWGDQVT---NEIVRQLMEQSGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSDASMDKIFGVIGAGYYCAQRGFSEEVQ---DALIKLVPLTRRLWQ--MTKLKMLPTPAKFHYVFNLRDLSRIWQGMLNITSEVIKDTDELLRLWKHECKRVIADRFSMSSDVTWFDKAVVSLVEEEF-GEEKAPVVDCGVDAYFVDFLRDAPEATGETPEE-----ADAEMPKLYEPIASLNHLRERLSVFLQLYNESIRGTGMDMVFFIDAMVHLVKISRVIRTP-RGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKEESFLEYMNNVLSSGEVSNLFARDEIDEINSDLTPIMKKEHPRRPP-TNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLS 3128          

HSP 2 Score: 160.229 bits (404), Expect = 4.690e-37
Identity = 281/1310 (21.45%), Postives = 546/1310 (41.68%), Query Frame = 3
Query: 11397 EFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDE-RAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVIS--YSDLHNRLESCLASGQCMIIADCDIH-QLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENC---------------NTIIKYL----KMYEEINANLQ---QKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFD-SMIES------SERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLI---SPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLSLRATSPSSAILMKYLNNSYETNILFNQIHSSVKPRIIQSRVIDYSKEGLQLFYQQLQNQMSNIHEICLDSSLTTSNLTALNSVYIVI---HLSSTEHISSIHKRVMSYIDEMNSFQRSALLKSRDQNVVTYNLFFTLPQNHSGVSSSQMNKMTTVYLDYPSNLRDFLLHLFKIGFLSANSIP-SMSLDLLPVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFES---HSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPF-LFESAEACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPK--STIESIQERLKKVT-----NNFIYSKT--LMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTID-WISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGV 15164
            E +  + E   +++EY   + ++  +  +      ++     L+  +   +E+W   SK++  + + +    L+++A+L+Y GP N E R   L       ++  +    FG + + + + L     IS+     LP  +  I N   +   S  R  +LI  QT+  I W+          + S  +    N LE  L+ G+ ++I D       A D ++ +       F+K   TFK+ +  + EV+    F+L++ T          +++ T ++ F  ++  L ++ L R I   K  ++                  K    +L+D++   R +K +E+                 ++I  L    K  EE+   L+   + E   +S +   + Y  +A R + ++ + + M  V + Y     ++L LFD S+  S      S+R++N  II+ +T +  +Y+   + +E+KF+F+LLL+++I    N V+   +E+L      +S+ LK+ P              KP  W+ + + +N+  L+  L  F DIL+ + ++  E  W++ FD E+PE    +   +  S+D +++L LIR+  PDR +  +  +I +++   +   V   D+  +   + P + ++      S  T    + I +  K   I++R +    +G ++  ++L +Q                  T  N  ++++   HL             + ++DE+       ++   +    T+ L+ T  + H     + +        + P  LR  L   +  G +S + +  S+     P+++  + L S ++ R  +  LG+     I    N ++    VQ + N  +       +SW  +RY + EI YG +VT + D+  + +    W + N    +F F +  Y+ P        K S +      I     ++S E   L  N    I  +  L + +      I  K + S   D T+ E  +  +  ++  KLP+  S  E ++ERL+K+      N F+  +   + + L +  S   E+   +  T  +IM+E    + DA    +  +   ++P +W       K     ST+  W + LL +       + N +    C+W+  F  P+  L   ++E++    R ++     ++    E T   KD I  PP++G+YV+GL+L G G+DK   +L +   K +   +PV  I    N    P     Y CPI+          +     K       W+LRGV
Sbjct: 3447 ELDAKQAELDVVQAEYEQAMAEKQTLLEDADRCRHKMQTASTLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLHDWKKEMKARKIP---FG-NGLNLNEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKAS--RYPLLIDPQTQGKI-WIKNKESQNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEK------NFIKTGSTFKVKV-GDKEVDVMDGFKLYITTKLPNPAYTPEISARTSIIDFTVTVKGLEDQLLGRVILTEKQELE------------------KERTHLLEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIIVLSNTKKTAEEVTQKLEISGETEIQINSAR---EEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIAN--IIEHMTYEVFKYAARGLYEEHKFLFTLLLTLKIDIQRNLVK--HEEFLTLIKGGASLDLKACP-------------PKPSKWILDMTWLNLVELSK-LKQFSDILDQISRN--EKMWRVWFDKENPEEEP-LPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIMDSMGENYAEGVI-LDLEKTWEESDPRTPLICLLSMGSDPT----DSIIALGKRLKIETRYVSMG-QGQEVHARKLLHQ------------------TMANGGWVLLQNCHLG------------LDFLDELMD-----VVTETETVHDTFRLWITT-EVHKQFPITLLQMSIKFANEPPQGLRAGLRRTY--GGVSQDLLDVSVGAQWKPMLYAVAFLHSTVQERRKFGPLGW----NIPYEFNQADFNATVQFIQNHLDDMDVKKGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFTFYQ-GYNIP--------KCSTVDGYLQYIQSLPAYDSPEVFGLHPN--ADITYQSKLAKDVLDTILGIQPKDS-SGGGDETR-EAVVARLADDMLEKLPEDYSPFE-VKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAVDGT--IIMSE---NLRDA----LDCMFDARIPARW------KKASWVSSTLGFWFTELLERNCQFTSWVSNGRPH--CFWMTGFFNPQGFLTAMRQEIT----RANKGWALDNMVLCNEVTKFMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIFAENNTARDPR---LYCCPIYKKPVRTDLNYIAAVDLKTAQAPEHWVLRGV 4614          

HSP 3 Score: 99.7525 bits (247), Expect = 9.491e-19
Identity = 73/281 (25.98%), Postives = 133/281 (47.33%), Query Frame = 3
Query: 2040 MNNFDKTFSIFLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGV-ICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQV 2879
            +N        F+++ F +   T +ALS + KF+    R +I  + I  K   +F NF +DI    + Y + K           +   + W ++L   +E PM  FQ    V +  E + +++ YN+++K L+  +  Y   WL  ++   A L+  LLV      ++ +N    +L +  ET+ M ++   +SP A  L +     K  FS +   ++ +E VK  + P +  L   H+  V +  Q G + L+WT++NI  +L    A I +LE ++++V
Sbjct:  544 INELHNDLQRFMDITFEKIPSTRQALSTLKKFE----RLNIPNLGIEEKYQIIFQNFATDIDTISKLYTKQKYDPPLARNQPPIAGKILWARQLFHRLEQPMQLFQQHPFVLRTAEAKPVIRSYNRIAKVLLEFEVLYHRAWLQQIEEIHAGLEASLLVKAPGTGELFVNFDPQILVLFRETQCMSQLGLPVSPFAAALFQKRDMFKKNFSDMKMMLSEYERVKLKMPPAIEQLMFPHLARVDEALQPGLAVLTWTSLNIGGYLENAFAKIKDLELLLDRV 820          
BLAST of Dynein heavy chain 5, axonemal vs. UniProt/SwissProt
Match: sp|Q9SMH3|DYH1A_CHLRE (Dynein-1-alpha heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1 PE=1 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 1.100e-116
Identity = 471/2199 (21.42%), Postives = 931/2199 (42.34%), Query Frame = 3
Query: 3603 KYSESRLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEAT--QYRETVVE---ELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMY-TDLEIFELPILRSE-ENELIN---LRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSR----RGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPI-IMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIK-SDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTH--DLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNR-----NDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENK-RSIEVIALTKIFDKILDPVIQYIIQ--NHKELSINSVTIAFQNSLKVLSQM-------LVDNKEIGGELHIQRLFVFCFIWSLNSQI----SDLNKQAITTLLKR-ETLVLPDDDN-------SICIFDYYVDES-GEWDLWSSLLMDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLATNSSA-DLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQI-NLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSH---LSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNHSLNEIDLYLSEEKDKDQLAQYLANLHKEVLKFT 10046
            KY+ES  + Q+          LWK   + +  ++  A+  +    ++K+++   +   +    K+ + D + +S     + +      W     Q +     R LD  T  Q R+ + +    L +    LE+L ++L  ++ I    + ++  Y  +E  Y T L     P   S+  +EL +   +R  W+ L+  AE+  +  L E +  F +    Q+  F     +    F    P +   +      +L  + +  +    ++  LV   KLFG+++ ++ EL  ++ ++  L Q+Y +Y + ++  + +  +LWS +D+  +    TE     L     LK    Y  ++ +I        ++  L S+ +R RHW ++M+VTG  F ++  TF   ++  + L +  +EI +I   A KE+ +E ++ ++ + W EQ      + +    RG V+   R T  +L  LED  + L +M  S  + P   E   W  KL  I E +++W+ VQ+ W+ LE++F+    I   L  E KRF+ +D+ + K M    +   V   C+++   +   LK++ + LE C  SL  YL  KR  F R +F+ D  +LSIL  S D  ++  H+  +F     L      R    I  + SS +E     N + I+  V  W+  +  E+ +++  ++ + I + +     + +S+     +      + W+ E       ++  +K S+   A K   Q+S +   +  +        ++   R+++ ++ +  ++ RD +       I D  +F     ++           Q+  +    CT     GYE+ G    +  T  T++  +TL  +L ++   +  G + +GK+   ++LA+      V  +C   +  +++ +   G+   G WG  D    ++   LS+    I  I++A+K          KE I +   T  F T   P  +    LP N+   FR V +  PDL QI +       +  ++ LA ++  + K +   +++       LR++ + L  A             GS + G                     +P  S                   E  +++ A+ ++ LP    ++      ++ D F G        ++     D++ A + +   +  +  S  ++K VQLY V+      ++ G T  GK+  L+    A   L                                   +  H+Y+I P +    +E++G       D+ DGL + ++R +N+      D   ++VFDG +   W +N+ S++DD   L LP+G R+    + K +FE+  ++ ASP  +SR G+VY  S  +G++     WL ++ +  EV  L  +F+K   P + +I++  + +EL           +L +++Q+       + D+  +     ++ +F+FC IWSL + I       ++      +K   ++ L D +        +  +++Y  D + G W  W S L    E  +     ++LV T+  +R+ + L+    A      +G  G+ KS+ + N+    D T   +    +S  T S  ++  +E + E R    YG    K L + I+DLN+P+   +D+   ++P  +L+  +    + +         + D  ++ ++     A + +DPR +  F   +I+ P   +L++I + +   H+  +   +I      +L   T +LY  +   L    T  R H  FNLR ++ I  G+     D   +    L+ W     RV  D LI   D +     L+A++Q  +   +++  +     F  F          K++ N        AP++   + D NS +      + N +  K  +  +NL+  ++ L  +  IHR +  P  G+ +L+G  GS    LS++ +         I      +++A  + +K +   +GS+ K+   L T  ++     L+ +N+++ SG  P L+   E  GL+ +V+  ++++     + T       +  + R +LH++L + P  + +      +PG+++   ++W +   +  L + A+ F    L E  L    E  + Q+ +++  +H+ V  F+
Sbjct: 1112 KYAESWRRHQA----------LWKTDKNSV-LDKFKARDPSAAQFEDKLSKYAKMATEISAQAKDFDQDFIRVSCHALASSVCDEAQAWVRAIAQTM-----RELDAVTESQLRDKIAKYQTALHRPPDTLEELKQVLNTVNTIRGESMVMELRYADLEERYRTRLLYATNPEEESQCAHELASASQVRALWTELLNEAEAV-DWSLEETKKKFSETTRSQVSDFAAITAELWEKFRTTGPGLPTVELASGLDELHKYESNLADALRQREQLVLAEKLFGMEITAYPELAQLESEIRKLAQVYGVYAEHAEAVRQYGGQLWSELDVGKMMAG-TEAILTKLRKLKSLKLLPVYELVEKEIQGFYNSLPLMKELKSEALRKRHWTRLMEVTGQEFDMDPKTFTLGNMFAMQLHKYAEEIGKITNAAVKELTIESEIRKLADVWREQRFELGKYMKGPEDRGWVL---RSTEDILVLLEDMGLNLQSMMASPFVRPFLTEVRAWEQKLSLIGECIEVWMHVQRKWMYLESIFVGSDDIRHQLPAEAKRFDNIDRQWQKIMNDTAKNTVVLDACMAD--GRLDLLKSLSEQLEVCQKSLSEYLDTKRCAFPRFYFISDDELLSILGTS-DPTSVQEHMLKLFDNCAALVFG---RGNKTITGMVSSEKEGFEFRNVVPIEGAVELWMTNVEAEMRKTLYQITKEGIFFYAKTPRTKWISENL-GMVTLVGSQIWWTWETEDVFRRVRDGNKHSMKEFAAKLTGQLSELTSMVRSD--------LSNEVRKKVNTLIIIDVHARDIIDTYVRDSIVDAREFAWESQLRFYWD------RQQDDILIRQCTGLFKYGYEYMGLNGRLVITALTDRCYMTLTTALTYRLGGAPAGPAGTGKTETTKDLAKSMALLCVVFNCGEGLDYKAMGSIFSGLVQCGAWGCFDEFNRIEAEVLSVVSSQIKNIQEALKNDLTRFQFEGKE-ISIDPRTGIFITMN-PGYAGRTELPDNLKALFRPVTMVVPDLEQICEIMLFSEGFDSAKVLAKKMTVLYKLSREQLSKQHHYDFGLRALKSVLVMA-------------GSLKRG---------------------APDMS-------------------EQLVLMRALRDMNLPKFIFDDVPLFLGLINDLFPGMD---CPRVRYPQFNDVVEADLADQGFKVLTEPSEQVDKVVQLYEVMMTRHTTMVVGQTGGGKTVILNTLARAQTKLG----------------------------------KKTHLYTINPKAISV-AELYGVLDKDTRDWTDGLLSNIFREMNKPLPAERDEARYLVFDGDVDAVWVENMNSVMDDNKLLTLPNGERIRLQNHCKLLFEVFDLQYASPATISRCGMVYVDSRNLGYKPYIYTWLNSRAKQAEVDILRGLFEKYAVPSVDWILEGIDGEELVRRPKQAVPVTNLNMITQLCNLLNATITDHPRMSDPQILEAIFIFCTIWSLGAAIVQRPESPDRDRFDAFVKHIASMGLVDGERVAATQLPARSLYEYCFDTNEGVWKSWRSYLQPY-EPPADGAFAKILVPTVDVVRSTWLLNTVVAAGKPCLFVGESGTAKSVTIANYLAHLDSTINIVLNVNFSSRTSSLDVQRAIEDSTEKRTKDTYGPPMGKRLLMFIDDLNMPR---VDTYGTQQPIALLKLFIERKGLYDRGKELSWKNMKDVQVVGAMGPPGGARNPVDPRFISLFSVFEIQFPSNENLRTIYQAILSRHLAKLPTDEIRDQLGERLTDVTLELYNFIIDKL--PPTPSRFHYIFNLRDLSRIYEGLLLTVGDVFKTPEQFLRLWRNECLRVLHDRLISTDDKRVMTERLEALVQQKFPN-LAAHTLASPVLFGDF----------KNVINELQGEGEVAPRMYDDLGDYNSIKPLFEDVMTNFYNRK--RKPMNLVFFEDALEHLTRIHRTLRLP-QGNCLLVGVGGSGKQSLSKLAAFTAGCEVFEITLTRGYDELAFREDLKRLYAMLGSDNKRVMFLFTDAHVADEGFLELINNMLTSGMVPALYDGAEKDGLIGSVRAEVEKKG---LLATKESCWSYYVDKCRNNLHVVLAMSPVGETLRSRCRNFPGMVNNTVIDWFEPWPEQALTSVASVF----LAEEAL---PEALRPQIVEHMVTVHQSVRTFS 3145          

HSP 2 Score: 90.5077 bits (223), Expect = 5.406e-16
Identity = 124/618 (20.06%), Postives = 260/618 (42.07%), Query Frame = 3
Query: 11397 EFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERAIFI-QCLISSAYLAYCGPLNFEQRSKFL-DFCVASARSSGL-VTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWL---DRYLIHYNPVVISYSDLHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYE-EINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSERLSN-----KSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNES-KTSNSKKPFDWMSEESLMNV---------KILA-ACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKF 13181
            E ++L  +   L +++     ++  ++ +   +  RL     L+  +    E+W       E  R   I  CL++S++L+Y G      R   + +      ++ G+ VT  F      +   L S++E +   S  LP  E  I N    +  +    W L  D   +A++W+   +  ++       + SD   +LE  +  G   +  + D +    D ++  V          K   K+    + EVE   NFRL++ +  S       ++  T ++++  +   L  + L+  +   +  ++   + L+++  + K  L  LE+ +L +LSN   N+         ++  K+   EI   L+  +   +  +++   Y   A R A +F + + ++ +   Y      +L +F+  + SS R ++     ++IID LT     Y+ L + + +K +FS  ++ +I          + +  + P  +       F+K N S + +  +KPFDW  +    ++         KI A   +     +  ++  +S E  W+  +D E+PE +  +   +++ +  ++KLCL+R LR DR+      F+   +  K+
Sbjct: 3424 ELQSLNDQLGKLRTQFEEKTAEQQDLKAKADLMERRLIAASKLIAGLGSERERWTRDIADLESRRDRLIGDCLLTSSFLSYTGAFTATYRHAMVYEMWQDDVKARGVPVTQPF-----RLEALLTSDVETTGWASEGLPSDELSIQNGILTVRAN---RWPLCIDPQMQAVNWIKSREGKMLEGKVKTFNDSDFLKQLELSIQYGFPFLFENLDEYI---DPVIDPVLEKNLVPGDGKFVIKL---GDKEVEWDSNFRLYMTSKLSNPHYGPEISGKTMIINYGVTQQGLTEQLLNVTLRHERSDLEEAREALIKQMSENKATLQALEDTLLRELSNAQGNILDNSELIATLESAKLKAVEIAEKLEASKVTAAEIEETRVRYSPAAKRGAILFFVIAGLSAITNMYEYSLASFLVVFNGSLHSSRRDASIEGRLRNIIDTLTYDVYAYTCLGLFERHKLMFSFQMTCKI---------LEGDTPLDPQLLDF-----FLKGNLSLEKAARRKPFDWFPDAGWQDLMRLVELGQKKIGADGRMHALGSLANDV--ESDEAAWRTWYDLEAPEEAE-LPCGYQSFLSDFEKLCLMRCLRMDRVTVGITRFVIGVMGEKY 4010          

HSP 3 Score: 70.8626 bits (172), Expect = 4.590e-10
Identity = 71/417 (17.03%), Postives = 177/417 (42.45%), Query Frame = 3
Query: 1857 LNLSTENTADVSLLEVINKTRSLTLSNMTSTFNILEITNLDRSSLTDNMHIGKTSEMHEEIMNNFDKTFSIFLNLLFLRPMRTGE-ALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRF----QDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAK-LKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAV-NYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAGMHSEFSKLLKYLATQKIYNFNHLLSKNWDSNEFTEAINKDLLAKKSTVQRTLEACSNILKEITEIIS 3086
            L   T +TA +    V+++  ++     + +FN+ +  N                ++ E      D +F         R +R+ E A  ++  F  +K + +I+  + +K  ++   F  +I    + ++  K+          V   + W++ LL  ++  M +     ++I   T++ +  ++  ++   +++++  +  + + W  +++    + LK  +       N+V++N   +L+ +I ETR + R+   +   A+ +   E +   +   LN  +  Y+E++ Q + P    L +  ++ +    Q G + L+W ++ I  F+      I   + ++ QV        +++  +A  ++       ++  D  EF E I +  LA   ++ +     S +L +I E+++
Sbjct:  558 LKTVTGDTAGID--RVVHRVVAMYEPIESISFNVFDYGNQHEWKAAKQQFYADNEDIKEATRELIDTSF---------RKLRSAEGACELLQSFKSIKSKGAIQKQVMNKFNDILEQFAREIEQTADIFERNKDAPPVTKNQPPVAGAIKWVRSLLERLKRTMAKLLSTEEEIIRTTELGQ--AVESKFKSFARSVMLTEKKWFSSWSDSINGVAMQHLKQTIFRRSAATNRVEVNFHPDLVRLIRETRYLDRMGFPIPEIALNVALQEDKFLQWLEGLNSMLFKYYESIDQ-LTPVERELMERKLEELESCLQPGFTILNWNSLGITEFIGTCDKAIATFQQLVKQVQKNSGIIEQVVYAIAGAQLVTEPEEGAEVMDLQEFYEDIERQRLAALESLVKKYRTISPLLGKIEEVVA 960          
BLAST of Dynein heavy chain 5, axonemal vs. UniProt/SwissProt
Match: sp|Q8IVF4|DYH10_HUMAN (Dynein heavy chain 10, axonemal OS=Homo sapiens OX=9606 GN=DNAH10 PE=1 SV=4)

HSP 1 Score: 421.394 bits (1082), Expect = 4.968e-116
Identity = 557/2783 (20.01%), Postives = 1134/2783 (40.75%), Query Frame = 3
Query: 2286 VYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCV-AKLKNPLLVVDLV----------GNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAGMHSEFSKLLKYLATQKIYNFNHLLSKNW--DSNEFTEAINKDLLAKKSTVQRTLEACSNILKEITEIISIVEKLDPNSSLYESEDLIFGQMKEMYNKSLSQSLYRSIINNLVYL--AICSNCQKEHLELLTSRAE--YDPVTGINDNLCSSYGEEVFCINDIKPIYDSDHAESKTLIKFILLVKYEIPMIKFEPELDAIQSIIEQMGQDIMAFHNDVSDFSGRKLNLYIKLESDLFYEFSQIISLKYSESRLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSR----RGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCC-ISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEI-KSDKKSLSHLAKKFNTQI----SRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNR---NDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLEN-KRSIEVIALTKIFDK----ILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQML-VDNKEIGGELH----IQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSI------------CIFDYYVD-ESGEWDLWSSLLMDEGEYLSLQLTG--EVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFV-YSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETS---NDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLS-----AVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNHSLNEIDLYLSEEKDKDQLAQYLANLHKEVLKFTVTPSIVSGKSVKIGKIIMNDKKKEIYKYDSTSLAPYSQLFLREKLRNLNDNSIQKKIYNGPCTFHRFLYILRRLLHQKTIEKTQSTQTISRALNSIKQTKHDITTINNLISHQKVKFNEISIKSQQLLKTL 10439
            V   + W + L   I+  ++RFQ+++E+      + + ++Y +V + +  ++      W+   +  + A +K  LL    +          G    IN    L  IINET+ + ++   +   A  +   E +   + + +   ++++  +  ++      L ++H + +++ F++G   L+W ++ I  ++      IG  ES+++Q+     + S  L  +    ++ +    S+       EF E I ++  +    + R   A       I  +++ VE L  +++  ++  L      + + K + + L + I+ NL      I  N    H E + +  E    P T   D +C        C+ +   I       +K  ++++     E P  K E E      ++      I+ F+ND+S      LN  I        E + +I        + L   ++    +  LWK+    +  E+  AKK    +  EK+     +   + R P   +  C+ +  +     +      W    G+ L++ AK  L    +  E + + L++    LE L  +L  + +I    L ++  Y+ ++  Y  + ++ L    +E+  +  +   WS L   + +  + L + KR  F +    ++  + V++ +F   F  E P   G D  +    L  +  + + +E+ +  L    KLF L +  + EL  +++++  L  +Y LY+     ++ ++  LW  +++  +   +  F      LP  ++       L+ K+        +L +L ++ +R+RHW ++M+ T   F++   TF   ++  + L ++   ++ I   A KE+ +E  + +I + W         + +    RG ++  V   + ++Q L+D+   L ++  SR + P      +W   L  I EV+++W+ VQ+ W+ LE++FI   I   L +E K+F+ +DK + + M    +   + +CC   N  S    L+N+ +GLE C  SL  YL  KRN F R +F+ D  +LSIL  S+ +  +  H+  ++  +  L  +        +  + S+  E +     +  +  V +W+  + NE+  +   ++ +AI       S  +    +   +  +A  + W+ E+     +  K +K+++ +  +K + QI    +RI + L++N             R++  ++ +  ++ RD + +     I +  +F+    ++      D   ++   +   T T   GYE+ G    +  TP T++  LTL  +L      +  G + +GK+   ++LA+      V  +C   M   ++     G+A  G WG  D    +D S LS+    I  I++A+  +  T    E + I L      F T   P  +    LP ++   FR V +  PDL QI +       +  ++TLA ++  + K A   +++       LR++ + L  A   K+                 G S L                                     E  +++ A+ ++ LP    E+      ++ D F G      +       PD  +A+ +  +    ++    ++K VQ++  +      ++ GPT  GKS  ++    A                                     L  +  +Y + P +     E++G       D+ DG+ + ++R +N+        +I+FDG +   W +N+ S++DD   L L +G R+    +   +FE+  ++ ASP  VSR G+VY     + +R     W+      +E   L  +F+K    ++D +++ I+   +   +   TI  Q  L +++Q+  + +  + GE+     ++  F+     SL + + +  +      +KR   +   D   +             ++D++ D +  +W  WS L+    EY+         +LV T+ T R  + L+   +    V  +G  G+ K+    N + K+     NI   V +S  T S  ++  LEAN+E R    YG    K L + ++D+N+P+   +D    ++P  +L+ LL    + +         + D   I ++       + +DPR +  F    +  P    L  I   + + H  +     + +  + +L   T  LY+ +   L    T  + H  FNLR ++ +  G+   N +   +   +++ W     RVF D LI +TD +     + +++   +  ++        R+ I F              + +   H   P+I   + D  + +      +  + E   K  +NL+  D+ L  +  +HR I +   GH +L+G  GS    +  +A   A   + ++  S   ++ +  + +KS+  ++G E K    L T  ++     L+ +N+++ SG  P LF  +E   +LS     A++  M   K S        + + F ++   +LHI+L + P  D +      +PG+++   ++W        L A A  F+ ++       +   ++ + + +++  +H+                                     S+  YSQ FL +KLR  N        Y  P  +  F+    +LL +KT       + +   L+ +K+    +  +N  ++ QK+   E S   + LL+ +
Sbjct:  568 VAGAIYWERSLFFRIKHTILRFQEVQEILDSDRGQEVKQKYLEVGRTMKEYEDRKYEQWMEVTEQVLPALMKKSLLTKSSIATEEPSTLERGAVFAINFSPALREIINETKYLEQLGFTVPELARNVALQEDKFLRYTAGIQRMLDHYHMLIGTLNDAESVLLKDHSQELLRVFRSGYKRLNWNSLGIGDYITGCKQAIGKFESLVHQIHKNADDISSRLTLIEAINLFKYPAAKSEEELPGVKEFFEHIERERASDVDHMVRWYLA-------IGPLLTKVEGLVVHTNTGKAPKL--ASYYKYWEKKIYEVLTKLILKNLQSFNSLILGNVPLFHTETILTAPEIILHPNTNEIDKMC------FHCVRNCVEI-------TKHFVRWMNGSCIECPPQKGEEE-----EVV------IINFYNDIS------LNPQI-------IEQAVMIPQNVHRILINLMKYLQKWKRYRPLWKL-DKAIVMEKFAAKKPPCVAYDEKLQFYSKIAYEVMRHPLIKDEHCIRLQLRHLANTVQENAKSWVISLGKLLNESAKEELYNLHEEMEHLAKNLRKIPNTLEDLKFVLATIAEIRSKSLVMELRYRDVQERYRTMAMYNLFPPDAEKELVDKIESIWSNLFNDSVNVEHALGDIKRT-FTELTRGEIMNYRVQIEEFAKRFYSEGPGSVGDDLDKGVELLGVYERELARHEKSRQELANAEKLFDLPITMYPELLKVQKEMSGLRMIYELYEGLKVAKEEWSQTLWINLNVQILQEGIEGFLRALRKLPRPVRGLSVTYYLEAKMKAFKDSIPLLLDLKNEALRDRHWKELMEKTSVFFEM-TETFTLENMFAMELHKHTDVLNEIVTAAIKEVAIEKAVKEILDTWENMKFTVVKYCKGTQERGYILGSV---DEIIQSLDDNTFNLQSISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDNIDKVFKRIMGETLKDPVIKRCCEAPNRLSD---LQNVSEGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPL-CVQEHMIKMYDNIASLRFNDGDSGEKLVSAMISAEGEVMEFRKILRAEGRVEDWMTAVLNEMRRTNRLITKEAIFRYCEDRSRVDWMLLYQGMVVLAASQVWWTWEVEDVFHKAQKGEKQAMKNYGRKMHRQIDELVTRITMPLSKND------------RKKYNTVLIIDVHARDIVDSFIRGSILEAREFDWESQLRF---YWDREPDE-LNIRQCTGTFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYRAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALIHQLTTFQF-EGQEISLDSRMGIFITMN-PGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLEAKTLAKKMTVLYKLAREQLSKQYHYDFGLRALKSVLVMAGELKR-----------------GSSDL------------------------------------REDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRY------PDFNDAVEQVLEENGYAVLPIQVDKVVQMFETMLTRHTTMVVGPTRGGKSVVINTLCQAQTK----------------------------------LGLTTKLYILNPKAVS-VIELYGILDPTTRDWTDGVLSNIFREINKPTDKKERKYILFDGDVDALWVENMNSVMDDNRLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKYRPYWKKWVNQIPNKVEQYNLNSLFEKYVPYLMDVIVEGIVDGRQAEKLK--TIVPQTDLNMVTQLAKMLDALLEGEIEDLDLLECYFLEALYCSLGASLLEDGRMKFDEYIKRLASLSTVDTEGVWANPGELPGQLPTLYDFHFDNKRNQWVPWSKLV---PEYIHAPERKFINILVHTVDTTRTTWILEQMVKIKQPVIFVGESGTSKTATTQN-FLKNLSEETNIVLMVNFSSRTTSMDIQRNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPR---VDEYGTQQPIALLKLLLEKGYLYDRGKELNCKSIRDLGFIAAMGKAGGGRNEVDPRFISLFSVFNVPFPSEESLHLIYSSILKGHTSTFHESIVAV--SGKLTFCTLALYKNIVQDL--PPTPSKFHYIFNLRDLSRVFNGLVLTNPERFQTVAQMVRVWRNECLRVFHDRLISETDKQLVQQHIGSLVVEHFKDDVEV----VMRDPILFG-------------DFQMALHEGEPRIYEDIQDYEAAKALFQEILEEYNESNTK--MNLVLFDDALEHLTRVHR-IIRMDRGHALLVGVGGSGKQSLSRLAAFTASCEVFEILLSRGYSENSFREDLKSLYLKLGIENKAMIFLFTDAHVAEEGFLELINNMLTSGIVPALFSEEEKESILSQIGQEALKQGMGPAKES--------VWQYFVNKSANNLHIVLGMSPVGDTLRTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLGYN------PMIPAENIENVVKHVVLVHQ-------------------------------------SVDHYSQQFL-QKLRRSN--------YVTPKNYLDFINTYSKLLDEKTQCNIAQCKRLDGGLDKLKEATIQLDELNQKLAEQKIVLAEKSAACEALLEEI 3089          

HSP 2 Score: 128.642 bits (322), Expect = 1.763e-27
Identity = 269/1307 (20.58%), Postives = 521/1307 (39.86%), Query Frame = 3
Query: 11397 EFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERA-IFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSK-IEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSD--LHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRN-VKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESS-------ERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNES-KTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENH--WKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLS--LRATSPSSAILMKYLNNSYETNILFNQIHSSVKPRIIQSRVIDYSKEGLQLFYQQLQNQMSNIHEICLDSSLTTSNLTALNSVYIVIHL-----SSTEHISSIHK--RVMSYIDEMNSFQRSALLKSRDQNVVTYNLFFTLPQNHSGVSSSQMNKMTTVYLDYPSNLRDFLLHLFKIGFLSANSIPSMSLDLLPVIHNCSLLMSIMKSRSSYLSLGF--------QDSETIVKITNPSNLYEIVQRMCNWFESHSNISWNILRYFVSEIIYGSKVTSENDR--ITI---ASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAF-LNISPFLFESAEACHLSSNLLTKINSEKILIEKIDKVS-QTINEKSTISFQIDLTKVENELFEICKNLASKLPKS-TIESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNELG--NEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLL-AIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITS---SKWMLRGVFITIN 15179
            E   ++KE   L ++Y   I ++  ++ E + +  RL     L+  +     +W     +    R  +   CL+ +A+L+Y G   +E    F D  V     + ++      S+   +   L  ++EIS+  S  LP  E  + N       S    + L  D  ++A++W+ R     N  V S++D     +LE  +  G   +  D D +    D ++  V     + + + + F IL   + EV+   NFRL+L+T  +       +     ++++  ++  L ++ LS  +   +  ++ + + L++E  + K  L  LE+ +L +L+    N + +++  +T+ +      E++  L+  E       +  D Y   A R A +F + S M  V   Y      +L +F   ++ S       +RL N  I+D LT     +    + + +K +FS  ++I+I +    V   + ++              F+K N S + S  KKP  W+S++   ++ +L+     F D    +  D + N   W+  +D +S E   +    + N+I  +QKL ++R  R DR+ +A   ++  T+  K+   V P  I        ++P S I+      S     L      S                G +L +  +      +    L++++       L + ++++        S E I+  H   R+    D    F    L KS    VVT       P N       ++N M   Y              FKI     +  P  +    P+++  +   ++++ R  +  +G+         D +  ++I N        QR          I W  L+Y + E++YG +     DR  +TI     + DF   +      F   ++ Y  P  +     KF E  +A  L  +P +F      H ++ +     + + +   + ++  QT    S IS        ++ + ++ K + +K+PK   ++ +++RL   T     S  L++EL  ++ +   +   + + ++ +  E+G  NE+ D    V  SL    +P  W  +   P      S  +W+   L ++   + ++   + + +  WL     PES L A+ +          DRS  +  V        +D D + E    G +V GL+L G  +D   G L     K +   LP+  I        K +N+  +  P++  S  +    + +    +  T+   S W+L+GV +T+N
Sbjct: 3281 ELAAIQKELETLGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENIRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWE----FRDEMVNRIWQNDILEREIPLSQPFRLESLLTDDVEISRWGSQGLPPDELSVQNGILTTRAS---RFPLCIDPQQQALNWIKRKEEKNNLRVASFNDPDFLKQLEMSIKYGTPFLFRDVDEYI---DPVIDNVLEKNIK-VSQGRQFIIL--GDKEVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVDLVHTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFLEVFRLSLKKSLPDSILMKRLRN--IMDTLTFSIYNHGCTGLFERHKLLFSFNMTIKIEQAEGRVPQEELDF--------------FLKGNISLEKSKRKKPCAWLSDQGWEDIILLSEM---FSDNFGQLPDDVENNQTVWQEWYDLDSLEQFPV-PLGYDNNITPFQKLLILRCFRVDRVYRAVTDYVTVTMGEKY---VQPPMISFEAIFEQSTPHSPIVFILSPGSDPATDLMKLAERS-------------GFGGNRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHPDFRLWLTTDPTKGFPIGILQKS--LKVVTE------PPN-----GLKLN-MRATY--------------FKISHEMLDQCPHPAFK--PLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQR-------DPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTIYMDEYLGDFIFDTFQPFHFFRNKEVDYKIP--VGDEKEKFVEAIEALPLANTPEVF----GLHPNAEIGYYTQAARDMWAHLLELQPQTGESSSGIS-------RDDYIGQVAKEIENKMPKVFDLDQVRKRLG--TGLSPTSVVLLQELERFNKLVVRMTKSLAELQRALAGEVGMSNELDD----VARSLFIGHIPNIW--RRLAPDTLK--SLGNWMVYFLRRFS--QYMLWVTESEPSVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLFTQVTKF-----QDADEVNERAGQGCFVSGLYLEGADWDIEKGCLIKSKPKVLVVDLPILKIIPIEAHRLKLQNT--FRTPVYTTSMRRNAMGVGLVFEADLFTTRHISHWVLQGVCLTLN 4469          
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Match: A0A3M6TXG6 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00002040 PE=4 SV=1)

HSP 1 Score: 1831.61 bits (4743), Expect = 0.000e+0
Identity = 1440/5373 (26.80%), Postives = 2537/5373 (47.22%), Query Frame = 3
Query:   78 MDERHWWLATRVNESLTDKIKSNVSELETAFLEFNNSNCINSFFDEDGPLVLYF--AKCINSSL--KSVHVSSEIKDLNDKSLFPSEKLTILLVIKKRXXXXXXXXFENELFCIELKNYILQNITTIFTHGFIPLLMTKYNSCDNTEKIYPLTSQLNSMWQSVQNYTDQL--YLNTNMEEPIHATIDLNKELQDP--------------------LKQFETFVTDVMSEIEVILEEVNDRTSEQDIFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIRRQILSIINNKIQAIVGFNQAPEDLWKRVQDEICEGSIESFLNMSLSQVKIILPKEDLLSNVEAFNSILHNNEIRTNTILGLLKFSNIIHDIFLENVTNLRETLNVSNSTKYSLHV--PNKSTENI------NITIP---------RFDQASE-------------NGIGIYDDNKIFSNWLVINGEVKKFIEICNHQLKFEKILSMKMVRISTLKFDIIHLLEKASKTQNAMQYSHKTV-----NSSDDEPEENNLSDGSEEESSAIKQNWSYSTLASSRDSLEWLLNLSTENTADV--SLLEVINKTRSLTLSNMTSTFNILEITNLDRSSLTDNMHIGKTSEMHEEIMNNFDKTFSIFLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESY--KEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVA-----GMHSEFSKLLKYLATQKIYNFNHLLSKNWDSNEFTEAINKDLLAKKSTVQRTLEACSNILKE-----------------ITEIISIVEKLDPNSSLYE------------------------SEDLIFGQMKEMYNKSLSQSLYRSIINNLVYLAIC---SNCQKEHLELLTSRAEYDPVTGINDNLC--SSYGEEVFCINDIKPIYDSDHAESKT-----LIKFILLVKYEIPMIKFEPELDAIQSIIEQMG-------QDIMAFHNDVSDFSGRKLNLYIKLESDLFYEFSQIISLKYSESRLKLQSTVE----NLNEFDFLWKMTSDKLDFEESLAKKDTYNSL-KEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQ--------GLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDL-HTDPAFREPLQID---KIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIK---------------------MKTTVMDSVGNQKFQLATLTCTHD------------LGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSS-----------------FIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKET-IPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNRN----DLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLATNSSADL-----LDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAV-AMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNF--DLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN--HSLNEIDLYLSEEKDKDQLAQYLANLHKEVLKFTVTPSIVSGKSVKIGKIIMNDKKKEIYKYDSTSLAPYSQLFLREKL----RNLNDNSIQKKIYNGPCTFHRFLYILRRLLHQKTIEKTQSTQTISRALNSIKQTKHDITTINNLISHQKVKFNEISIKSQQLLKTLINKVTLLRIILAKKGDNSYLNEILIKNANISVSELYKDPLLIDAERDELDDEFERIREESLKNRKNIIKGTLEKTRKEYFALKKDLAYATEQVCYWKSKIDRQVIDRIKSFQNPPSLVIDVIEMIFILIGKQ-------------IQNTRKDSNADDDET----NDEKSNA---------------------------------RSRWKRMQQFMADPVKFVDIIHNVSWTDGLNPDVYNGVKSYLATSKDGQLGVTGEGTMLNQAENVNIKAKKNKQM-TPELSESENLINRSISVSATKYASEDXXXXXXXXXXXXEYTEKCEPLRQALQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGL-VTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSDLHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPS-SVALKS--NPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLSLRATSPSSAILMKYLNNSYETNILFNQIHSSVKPRIIQSRVIDYSKEGLQLFYQQLQNQMSNIHEICLDSSLTTSNLTALNSVYIVIHLSSTEHISSIHKRVMSYIDEMNSFQRSALLKSRDQNVVTYNLFFTLPQNHSGVSSSQMNKMTTVYLDYPSNLRDFL---LHLFKIGFLSANSIPSMSLDLLPVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFESHSN-----------ISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSNLLTKINSEKILIEKI----------DKVSQTINEKST-----------------------------------ISFQIDLTKVENELFEICKNLASKLPKS-TIESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNEL-GNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHIT-------FTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGVFITINPF 15185
            MDERHWW AT++ E+       + + LE    E    + IN F   +G   L+F   K   +SL  + ++++S    L  K +   E + +  +       I  +  E E+FC E+K   L + +++ +  F P+L  + +   ++E             + V ++ +QL  Y NT + E   ATI   + L+ P                    L ++E  V D ++ IE IL +  +   +     + EM+KW+ R  +L ++  QLK K  K  I  L++ KSK++K+W+ +++ IT+A N +KDK+KYLE+ +     +    SL +    T+P +   ++Q ++ SR ++R+G +G   S I  Q++    + I++     +  + LW +VQ+EI   S  S  +++ S+ K    KE L  + + F S       R N  L +       H  + + + +LRE L  S+S   +  V  P  +  ++      N+  P          F Q+++             +GI   D+  I ++              CNH      I SM          D+IH L + SK  N +Q   +       NS D E ++       + ++  ++   + +++ S  D           N  DV  S+LE +++          S      I+ +    L D +H  ++                         PM       +V+   +L     ++G    +  E + +F + +    ESY     K     +    LV   + W + LL  IE PM  F++ K VT  +++  IVK YN+++  L+  ++ +++ W S +D+  + LK  LL       ++ +N+   LL +I E+++++R+  QL  +A+++LK E R+K +   L   +  +  V Q++   +  L   H++ V+   Q G S+L+W+++NID +LH+V +    L+ +++ V      G+  +  ++ + +   K     H+    W+  +F E  NK +  +   +   ++   N L+E                 I+   S+   LD   ++                          +++ + G +   Y   + Q++  SI+++L+ +  C      +K  +E+ + +         +DN    S Y E V           S ++E  T     L++F + V++ IP I  +P L  IQ  ++++        + IM +  DV++   R +    ++   L          + S S   LQ TVE    N   +DFLWK   D     +     D   ++ K ++ ++  +++++  +P  + +  + ++T   +  L      W+ ++   LH+EAK  LD+   +R ++ E L Q V  L++LN    +L ++ D++  ID IY P+E+MY  L  + L + R E  E+ NLR  W  LI++AE  R++LL +KR +F QELDK++K F V VIQFRN FD + P + G  P E   +L+ F+  Y+ +E K+ TL ++  LFG+    F EL+   E+L LL  LY L+Q+F  F++ F D LWS VDL     ++  +W ECL LP +++E ++Y E++  I + + +   L  L SKEIRNRHW+QVM VTG++FQLEA  FK   L  I LL+++  I+ IC  A +E+ELE K+   EEEWTEQVL F++   RGLV L    T  LL  LED+Q  L  M  SRHI P++DEAA WA KL EISEVL+ WL VQ LW +LE VF +    KDL QEY RF R+DKSY+K M+R     +V    ++ +  +    K            G E+    L          FA  +      I  I+  ++     G+  PSI T+  ++ + +P +   L  +    + S   E + L  K+ +   V  WL  L   I ES+ +   D I+ I +G SLEE                 W   I   + +I+ D+K++ + +++F + IS++P  L R SWK TD P+T+  + RL ++    +YLRD L +L  +K+RDV DFE  + I+                     ++  V  +  ++  ++      H+             G+EF G   ++A TP TE+  L+L  ++ +    S++G + +GK+  ++ LA L  RY V + C   MS+ ++   + G+A  GCWG++D    ++   LS+ +  I  +  A++   +T ++ + + + ++   + F T C    ++E   P  +   FR VA+  PD   IL+ +C    ++  + LA RL  V       ++       +L S V  +  A             G+ +  Q   GS L     + V+  +  P+S+                   K K   TP +L++AA+ EH+ V++++ + + P ++PE       +L+D F G     +     T +  D    ++   + +        + K  QL+ + + H+G+I+ GP  +GKS+ +   +  L+  +                       L +H +      +H +  I P++    + MFG  ++   DF DG+FT  +R+ N++     + +W+  D  +   W++ L S LD    L+L +G RL  S+ VK +FE + + DASP  VSR GVVY    ++GWR +   WL N+   E   L + F+K +D + Q++    +          F   L +L  ++  N +IGGELHI+RL++F  IWS    + + +++  + LL   T  LPD D  I +FDYYVDESGEWD W S + +   + +  L GEV VDT+ T+R + F+++ + +  N+ L GP G GK+ ++ +   K +     + R+VYS  + ++ L+ F+E NI HRQG +YG K+ K L + I+DL+LP   + D    +  NE+LRQ+L+  V+ N+K PF++  L    ++V+ A N  ++L     +  RL RHF   ++  P    L +I+  V E ++   +   +  +   Q++ A+  L   +  VL+ S T GRCH  FNLR I  +  G+K+ + + ++ E  ++  W +   RV +D +    D+KWF  TL+ II+  +  E+ + + +    FITF  +               T    APKI + A+N+I      L S +  + ++F    ++LM + +V+  ++ +HR ++    G+ +LIGS+G+HL+ + ++AL + + PI  ++ S     +D ++S +RQ G +GK + +L TA +L+  + LD LNSL+ISG+ P LF  DE+  LL A+  ++K++       +NF  D ++ F +R++ +LHI+LCLPP + ++    + YPGIL    ++++KD     L  +A++++   + L++I      E+ +D++   L+ +H  VL+            +          + E    + ++  P S   L EK+    ++   ++I   ++ GP T+ +F++  R +   K  E  +    ++RA+ +++ T+ D   I ++IS  K K +  ++KS +LL+ L  K T L  + AK G  S      +   +  + E     LL D E DELD+EFE++++ ++K+R+  +   +     E    K  L  + EQV +W  K+DR + +R+++FQ+PP +   V+ M+ +L+G+                 TR D   D   +    +DE S A                                 RS WK +QQ M D  KFV+ +H+V W +GL  D+  GV+S+LATS  G++  +   T    A     ++   + M TPE         + I+++A KY+SEDAA+LV+Y VALV   E    L +A                                        +  +L++    L+ EY+  +  +  +  ++++ SERL     L+ ++K ME +W+    +Y     +   C+ ++A+L YCG +  ++R +   F +   R +GL V  +    +  + +FL  +I +   E+  LP     +D       E    +W L+CD  R AI+W+   L      ++ Y +L   LE+CL  G  +++ D D+++L  D     + R ++RFL     FK+++   HE+EC P FRL L T  S+  +P  + +   +V F+ S   L   FL RF+   KP +     +++ E   +   L + EE +L+ L +G R + ++     +    K +EEI     +   + +S  +S + Y  IA R A +F +A  M  +   Y     ++L +FD+ I+ SER + K+++++LT+     +  ++ + ++ +FSLL +IE+  ++  V     E+LI PS   A+K+   P  + +  S+T  SKKPFDW+ +E    +++LA     F+D  E M +D +E  W+ + + E PE   + + L  +     Q+  +IR+LR DR+M A+  FI + L  K+  T  P D+  + R +   + I++ Y   + E N++   +    + + ++  V+  +  G+     + +     IH+  +               ++++H     H S    R+++ +D   SF +    K+ D     + L+ ++ Q H  + SS +     V  D P N +D L   L       +  +  P        ++HN  +L S+++ R+ +   G+     +  +   + L++ +      F+ +++           I WN LRY ++E++YG  V+ E DR  ++++ D+W++  AV++EFE  K+KY  PS L+S NVK + +  A   ++    E  EAC L  +  T++  E+ +  ++          D ++  + E ST                                   +SF+   ++ E +L E+C  + +K+PK  + ES+ ER+KK      ++  ++ E+     +   +   +   +      L G+ IS+  +     +   ++P KW            +S   W + L  ++ HI+R+I+  +++V  YWLGAF  P   L+I K+E    +    R    +      E T +DKDH+REPP DG++V+G++LWGC ++K TG+L D   K   TPLPV HI         +LND  +   S  Y CP +     ++EP++ + +  + + S++W LRG+  T+ PF
Sbjct:    1 MDERHWWFATKLQETFHVGPYDSPTMLEDFMAEQTTLDYINDFLAPEGHTKLFFYCPKADPNSLLPRKMNIASSCAKL--KEVMDGEAICLYFIRSNLERVIDPTCVEKEVFCGEIKENPLVHFSSLLSEIFSPILHAQKDWGHSSE-------------EEVSHFLNQLDKYTNT-LSEYATATIAPQQILKKPESQVTSDFKQNRAAAVNPSILLEYENLVLDWIATIENILTDGLEERFDPFAGPLSEMDKWKRRQKVLTSVTDQLKSKECKGVIAILITAKSKVLKRWKAIDASITDAFNETKDKVKYLESLRKYFDQLNVGNSLVNICGHTLPGLMASVRQMDAISRYYARNGYLGLLFSKITNQLVLAARDYIESSTTILEE-DKLWTKVQEEIDSSSSHS-AHLTKSKGKRKANKEILFGSDDGFLS-------RLNVCLSM-------HKQYRDMIRSLREGLGGSHSLSMTPSVLQPGGAKRSVITNSNSNLMSPIAAGSPIRLSFSQSTKMKGDHESITSHGSSGIAFTDEESIIAH----------LDNFCNH------IRSM---------IDVIHTLSQFSKLANEVQNLPRVTGDVITNSHDVEDDQVTSEMYFKTDAGGLRPAGAAASIGSGSD--HSYPGSHGSNKPDVLKSMLESLDEEEEEVKEVYNSGTEFQSISQI----LLDTIHSIRS-------------------------PME-----GVVTTETFL----DVEGKGKERFEEQYTSFVAGVQ-QMESYICNYLKESPPLVRNSPLVAGAITWSRGLLKKIEDPMKIFKENKFVTSYRDFGRIVKFYNRIATALVKFENLWLSLWKSRIDSACSGLKISLLAFHPETKQLVVNADGRLLELIQESKSLMRMGIQLPESALDVLKQEHRLKSYKQSLELVLQDYYKVCQNVPSALYKLLTPHMESVLHYLQPGVSTLNWSSMNIDAYLHQVHSANSRLKEVVDSVKEVVSEGIERKIEEIRRVILFDKKLATAHV----WNVEKFVEEENKAVTQQGKRLHEMVKEVENALQEVVATANQRRISSPASPQISPSPSMSLGLDRTGAMTPRFTRIGTIMSSAPGTRAATAVSGLTDESVIGDIFGHYCSLVYQAVLESIVSSLLIIGDCVKPPGRKKSGIEVESRKISGSSWDDSSDNGSENSDYAESV----------SSQYSEWSTTNQEELLQFEVNVQFNIPDIVIKPSLQTIQDGVQRVAVHLVDVSRTIMWWAADVNESFHRSVAQDHQVNKTL---------EELSTSVTSLQQTVERQLFNFRRYDFLWK--DDMHALYQVFVDNDPGTTMFKLEVERLQAIEHDVVEIPDRLMVGSVCLNTSPIKDSLHGFAVAWKMRYSTQLHEEAKIELDKIVTHRNSIYERLSQPVVTLDELNSAFQLLQELGDMENTIDDIYLPVENMYGKLREYNLCLPRIEVQEVDNLRDEWVKLIELAEKVRDELLVQKRGMFEQELDKEVKAFVVNVIQFRNSFDSQGPGVPGVRPAEAVMRLQDFQQHYTQFEAKRKTLDSVQMLFGIVPTPFAELDKTGEELELLGLLYGLFQQFISFDQRFRDTLWSEVDLVVANQEMEHYWQECLRLPQRIQEWDAYKEMRDAIKHYLDVFPTLHKLNSKEIRNRHWLQVMSVTGSSFQLEAHIFKLVHLLDIGLLQHQAAIEEICRCASRELELEAKMRSTEEEWTEQVLTFENFKNRGLVCLSHSNTEHLLDLLEDAQATLALMLTSRHIGPLRDEAAAWAIKLKEISEVLEQWLTVQDLWQHLEEVFSHGGTAKDLPQEYNRFARVDKSYMKMMKRACIFNSVRDVMLTQQEPETVAQKKSSIISSLRSRSGREDLISPLP---------FADTFGSRFRKISDIVVQASKESVPGVRKPSILTSTLEVRNAEPDWHSHLPNNLAVAVTSEQGETLELITKVPLVSSVDVWLAALLRSITESLRSSIVDCIQDIDSGLSLEE-----------------W---IFKGIGDIRIDRKAMPNASRRFWSLISKLPNLLARGSWKHTDSPMTSYHKLRLETLVSQGMYLRDVLEDLGRRKLRDVVDFEWKRNIRFYGTDNSRAPGRSPSLTLLPSLEGAVSRAASSEPPKITAGVQEHEDLYIHMLDAQLSYGFEFYGCDVSLALTPITERCFLSLTQAVWNVFGGSLVGPTGTGKTETVKGLASLLGRYLVSQSCSPKMSSTAIGKIIVGLAEEGCWGLMDEFHKINMECLSVMLFEIQAVLLALRGGLSTCTLEDGKDVTVKPNFSIFLTICSNGHNYE--FPPEVRALFRSVAMVMPDTSLILRAHCAGQGFKSPKILADRLKLVADVCKEQLSGKSHHNFSLSSFVGVIQHA-------------GNRKSSQGPLGSKL-----NAVQADLARPSSTQSVATQFGAGKDRGSQFGQKDKKPTTPSALTSAARLEHSFVLQSLQDCIGPRLSPEELNVFNMVLRDVFYGLPKPPAPAFHITKVVQDFETVLLAHTREKGFVPHQPWIAKIHQLWTLSKVHRGIIVAGPPGTGKSSCISGLVETLSECS-----------------------LTKHKNTGSQMHTHKLQRINPLAVSDPALMFGKVNSSS-DFEDGIFTAYFRKANKDHSVHKMTTWLCLDAPLHQGWAEFLSSALDKGEYLNLLNGERLYLSEYVKLIFETDDLTDASPSTVSRCGVVYMDETVLGWRPLAEAWLANRSPQESHCLQRAFNKTVDVISQFVHYEARPFMKVCEVGLFNTCLALLKALIEGNTDIGGELHIERLYLFSLIWSFGGLLDEQDRKKFSELLLSLTTALPDYDQEISVFDYYVDESGEWDPWQSRVPEVSYFDAADLLGEVFVDTVDTIRTRQFMELASASGRNILLTGPAGCGKTSLISDFLDKQEDKNQIVKRYVYSGTSGAASLQHFIEHNIYHRQGFVYGAKKGKILNMFIDDLSLP---QRDQYGTQEVNELLRQVLDEKVLFNTKKPFDRRVLE--GVVVTAAMNMQSELVTSEQIPERLKRHFAVFRLPAPSEESLFTIVTSVLEANMAQNQGMGLPQEFHEQIVMASCMLLNSLQDVLRPSPTPGRCHYLFNLREITRVFQGLKNCSEEMQADEEYVVSLWQHEVTRVIKDRICRSLDIKWFEKTLKTIIKENFP-ELPANSPS--PLFITFPLDAGLYAQRP------VTQGRVAPKILLQAINNIEDVSACLQSYLKRYNDEF--SGLDLMISSHVMFHVVRLHRILSYKNRGNALLIGSIGTHLNSLAALALYMLEYPIHPVDCSYPNTFLDGLRSAVRQAGCDGKTTTVLFTAPDLRDDMYLDALNSLLISGEYPPLFSVDELDSLLQALMPAIKKK------FSNFLADPMKFFITRVKANLHIILCLPPTHKLLRIGPSCYPGILYGCQMDFVKDWPQYALEGEASHYLKKYNVLDDIS-----EQTRDKVVVSLSTIHGHVLRECHQIPWAGDDHLLT--------RAESPPEEPSASEPRSLSILLEKINLKHQDNGGSNIIGDVFVGPTTYIQFMHCFRHIFRDKRKEANERVDQLTRAVATLELTRQDSVVIKDVISDTKKKLSVATVKSDELLEALTAKATALEKLKAKLGIGSATLSAFVALIDSEI-EDDDLALLQDDEADELDEEFEKLKKTNIKSRQLKVLEAISHAEDEVKETKVALKKSEEQVKHWMHKVDRSLCERLRAFQSPPPMAGMVMVMVMVLLGRPEFAPGIGGAGSTLPPPTRHDRRGDHSSSLGTGSDEASRASSAPHKKRGFKEQSQKGGAQAPLLGVNAEGKVDRSTWKAIQQIMNDSQKFVESLHHVPWKEGLPDDILKGVQSFLATSSGGEVSDSDLRTAAPGASASTYQSSPGRTMITPEKKP------QGITITAAKYSSEDAAVLVEYTVALVNTPEPEVELTEA----------------------------------------DLPDLQETVTKLQKEYDDAVVVKHDLSNDVRSCSERLKAATDLLHSLKYMEREWKAYVDEYTSSEILLSNCIAAAAFLTYCGAMGVDRRKRMGKFFMQVCRDNGLKVQYQHLFDRHTLPEFLKGKIVLKTWENLQLPTDPISMDTICIFSQEESSDSWALLCDPQRIAITWVLTML--GQSTLVKYKELRGHLETCLMEGTTLVVTDVDVNELEFDSRFYFILRSRYRFLTSSTPFKLMV-GEHEIECQPGFRLVLATTFSSKSVPSSIAAYVNVVEFSQSRDGLEEMFLDRFLRLEKPRMQETRTQVVDEMVTLMEGLREAEENILECLGSGHRLLYNLAATKKLASIKKQHEEIVEGQTRSRGIENSILQSREGYRPIARRAAVMFDVARIMAEINTSYQTSLAQFLMVFDAAIKHSERTAVKAVVERLTQSAFYTAARALFERDRPLFSLLCAIEVEDSSGRVGPGDREFLIHPSFGAAVKTALQPSAVSEAASRTL-SKKPFDWLLDEQYSYLQLLATHFEWFQDAFEKMTRDGRETQWRQITEHEKPELVALPDGL-DDKFTLIQRFMVIRSLRGDRLMPAATCFITSVLGKKYT-TEMPLDLPFAYRQSESRTPIVLLY---TQEANMVEKLVIEGAQRKQVELHVLALANVGI----GEERAARKTIHKAMVQGH------------WVLLH---NAHNS---PRLLAALD---SFMQET--KTVDSE---FRLWVSV-QPHPDIPSSLLQSAVKVVADSPKNTKDSLQRSLQWVDSELMRVSVRPEWPA----LLHNLCMLHSLVRLRTRFGLTGWNKPMDLRNVGT-AELWQGLDLAVREFQDNADMAWQGAGSTRPIQWNGLRYMLTEVVYGRGVSDEFDRQGLSAMIDYWISPAAVKREFEASKIKYKLPSALFSSNVKLNSVWSALEGLAGESLEVPEACGLHPSPETQLGDEQYVFTRLNYLLDRMASSDTLTHAVTEPSTLLPSSGVIQQSSSAHTTGAGSISIAGAGVFASASLVSFR---SRKEVDLNEVCTTMLAKIPKVWSKESVYERMKKTGGPNSFNLFVIAEMECMHRLLACVRETLLSIKAATEESLCGDRISEELLDSADDMYHMRIPSKWSQLGGESSPPPTWSLAAWFTDLGNRFSHIDRIIVQGRERVPAYWLGAFFNPRRFLSIIKQEAVRNY--EGRVSGTEPFVYQTEITGRDKDHLREPPLDGMFVYGIYLWGCAWEKTTGDLLDAPPKSGPTPLPVVHIVALPQTEKASLNDPVRAAVS--YSCPCYSSRICQREPVMLLDVDNKDVPSTRWPLRGLSSTLRPF 5043          
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Match: R7U2K2 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_220835 PE=4 SV=1)

HSP 1 Score: 1700.64 bits (4403), Expect = 0.000e+0
Identity = 1165/3887 (29.97%), Postives = 1978/3887 (50.89%), Query Frame = 3
Query: 3120 YESEDLIFGQMKEMYNKSLSQSLYRSIINNLVYLAICSNCQKEHLELLT---------SRAEYDPVTGINDNLCSSYGEEVFCINDIKPI-YDSDHAESKTLIKFILLVKYEIPMIKFEPELDAIQSIIEQMGQDIMAFHNDVSDFSGRKLN--LYIKLESDLFYEFSQIISLKYSESRLKLQSTV-ENLNEF---DFLWK--MTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPI-IMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDL------------------HT--------DPAFREPLQIDK-------------------------------------IFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVG--QTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLM------EKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLATNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREY---LVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNHSLNEIDLYLSEEKDKDQLAQYLANLHKEVLKFTVTPSIV--SGKSVKIGKIIMNDKKKEIYKYDSTSLA--PYSQLFLREKLRNLNDNSIQ----KKIYNGPCTFHRFLYILRRLLHQKTIEKTQSTQTISRALNSIKQTKHDITTINNLISHQKVKFNEISIKSQQLLKTLINKVTLLRIILAKKGDNSYLNEILIKNANISVSELYKDPLLIDAERDELDDEFERIREESLKNRKNIIKGTLEKTRKEYFALKKDLAYATEQVCYWKSKIDRQVIDRIKSFQNPPSLVIDVIEMIFILIGKQIQNTRKDSNADDDETNDEKSNA-------------------------------RSRWKRMQQFMADPVKFVDIIHNVSWTDGLNPDVYNGVKSYLATSKDGQLGVTGEGTMLNQAENVNIKAKKNKQMTPELSESENLINRSISVSATKYASEDXXXXXXXXXXXXEYTEKCEPLRQALQKXXXXXXX-----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGL-VTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSDLHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPS--SVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLSLRATSPSSAILMKYLNNSYETNILFNQIHSSVKPRIIQSRVIDY-SKEGLQLFYQQLQNQMSNIHEIC---LDSSLTTSNLTALNSVYIVIHLSSTEHISSIHKRVMSYIDEMNSFQRSALLKSRDQNVVTYNLFFTLPQNHSGVSSSQMNKMTTVYLDYPSNLRDFLLHLFKIGFLSANSIP-SMSLDLLPVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFESHSNI------------SWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQI 14309
            YE E+ +  ++ + Y   +  ++  +   +LV LA  S C  E +   +          R   DP + +   + S     V  ++ +  + + ++ +   T ++F + VK+ IP I  EP LDAIQ+ +  + + ++     V     + L    +  ++SD   E    I ++ S+    LQS V +++N F   DFLW+  M  +  +F E    K    ++  ++ ++L ++  +  +PK + +  + + T   +  L      W+N++   LHDEAKR LD A  YR  V + L+  V  L+QLN  L +L+++ D++ KID IY PIE+ Y  L  FEL + RSE  E+  LR +W  L+ +A+     LL EKR  F QELDKQ+K F VEVIQFRN FD + P++ G  P E  ++L+ F  +YS+YE K+ TL ++SKLFG+  + F EL+   E+L LL  LY L+QKF +F+  F D LW+ V+L     ++  FWDECLALPSKLK+ ++Y ++K  I     +  +L  LASKEIRNRHW+QVM VTG++FQLEA  FK S L  I L+ ++ EI+ IC  A +E+ELE+KL   EEEWTEQVL F+ + +RG + L+   T  LL+QLED+Q LL  M  SR++ P+++EAA WA KL E+ +VLD WLEVQ LW  LE VF N   + K+L QE KRF R+DK + K M+R Y+T+NV QCC   +  K   L++I Q LE CF SL GYL  KR  F R + V D T+L++L+  + + ++  H  S+F+A++D+                  H+         PA   P++IDK                                     + SS  E + L +K+ +   V  WL  L   ++ ++          IS     +E   K+ +Q+C   L  +W+ E    ++EIK D+K+LS+L++KF + ++++P+ ++R+S    D+ + AL R R+  +    ++LRDS+  ++ +++R+  DFE  + +++   V D        L  L      G EF G+ PTIA T   +K  L+L  ++   + + + GES  GKS  ++  A++  ++ +   C     + SL   + G+A +GCWG  D++E ++P  +S+ I  +  I DA++  +   +                               G+  E    VA   PDL  +LK  C  +  +    LA RL TV + +   +++     +++ +I   L +    ++ ++ +EK+   +    Q +  ++++      ++++      S  K +   TP  LSAAAK EH LV + +++++ P +TPEN    ++I+KD F G  +S   +   +    LL+    E  L   +  S L+      +K +QL+ + + HQG+IL GP  SGKST +   + AL                   A    S   AR    +    +H +  I+P   +  S +FG+ + +  D+ DG+FT +W++ +RN   +WI  DG +   W  N  SILD    LHL +G +LP S N+K +FE + + +ASP +++R G+++   +++GWR I   WL+N+   E+  L + FDK +DPV  Y++   K     S    F  ++ +LS ML DN EIGGELHI+RL++FC +W+    +   +++    LL   +  LPDDD  IC FDYYVDESGEWD W S + +      L L GEV VDT+ T+R +  +++   +S NV L+G  GSGK+ ++++     D       + V S  + + QL+ F+E+NI HRQG +YG KE+KHL L ++DLNLP+P   D   ++R NE                                              RHF  + + +P G  L S++ GV E  +    +  +  D    ++ A+ +L   + SVL+ S   GR H  F LR   +    ++    +S + E L+   W + + R+ +D L   TD+ WF  T+   ++  +    S    N   +F+TF        +++  Q   TT   S  ++ V +  + S +E    L + +N + E+FG   +++M ++N++  II +HR I    +G  +++G +GSHL  +  +AL +A IP+  +++S +   +D ++S                  R+L + L +D +NSL++SG+ P LF  DEM GLL A+  +MKRE S+ T+    D  + F SR+R +LHI++CLPP + ++  + N+YPG++S   + W+ D     L+ +A YF+N S    D    E    + +   +AN+H  VL+          + + + + ++ +N+KKKE+ K  + +L   P+S+  + E ++ L    ++     +++ GP ++ RF+   + +  +K  E+TQ   T+ +AL+++ QT+ D   +   I    +KF     K+  LL  L  K T L  + A+ G ++ L+  L  N      E   + LL + ERDE DDEF+R+R  +LK R                A K +   A + V +W+ ++DRQ ++R+K+FQNPP LV  V+EM+  LIGK++ + R ++ AD+  T +E+S                                 R++WK MQQ + D  KFVDI+HNV+W DGL  DV   V+SYLA S+DG LGVTGEG++L+ A+      +K + +  +         R IS++A KYASEDAA LV Y +A+VEYT  C PL+ A+++ HELE E       + E   ++  KE E         +L +++   L++E +DL++ ++  + ++  +E EL ++ ERL     ++ ++KP E  W+   +++     +    L ++A+L YC  +N + RS+  +F +       L +  +     + +  FL   + + ++   NLP     ++N+  ++       W L+CD     +S L  YL +   V +SY+ L ++ ++CLA G  ++I D D+H+   D+  R +   + +F+  +  FK+ +   HEVEC P+FR++LHT S   E+P  L +   L+ F+ +   +  + L RF+ + K  +D E + LL E+    + L +LE++M+  LS+ +R +  +     + +  K +EE   +  + +    +  ++ +++  IA + A  F     M  +   Y V F + L LFD  +  S+R + K+++D+L       +   + + +K ++ LLL++E+      V   + EYLISPS  SV + +      Q+ SK   +KKPFDWM+E+   N++ILA     F+D+ + M KD +E  W+ L +S+ PE   + +R+  +     Q++ +IR +R DR+ Q S LFI N L+ K  G     D+  +LR  +P + +LM Y                + +    +  V+++ +++ + +    L      I ++    L  ++ T     L + +  +HL                   +NS +   L+ S  + +      +   +  + + ++ +     + +D P  +RD L+  F    + A ++  S  +D LP++HN   L   +K RS +   GF       +I   S L E +    + F  + ++            SW+ LR+ V+E+  G+ V    D+ ++ ++ ++WL+SNA +K+FE P++KY  P+V ++ NV+ +++ +A  + +PF  ESAEAC+L  +  T +  ++ +  +++K+   +    +++ ++
Sbjct: 1068 YEEEETMVNELLDNYRHQIYAAILLATTRSLVTLAESSGCDGEVIRAASVLSFDKNSSHRLLSDPTSRVASAI-SDKSRPVSVLSLLSNMTWTTEKSSEVTHLQFEVNVKFAIPNIVLEPNLDAIQTALNFVARSLLQVPRSVKWTGDKDLGSKFFELVQSD---EVVDEIMMQISQVVEDLQSVVKQHINHFGIYDFLWQDDMYGNYYEFIEHDPGK---AAIHREVERLLKIERKVLSIPKSLPVGPICLMTSPVQDALHGFAMAWKNQYASVLHDEAKRKLDAAVLYRANVRQRLELPVLSLDQLNSTLHLLEEVRDMENKIDDIYLPIETHYAKLREFELRLPRSEVEEVDQLRDHWQELLSLADGVCLTLLKEKRGAFEQELDKQVKNFVVEVIQFRNAFDAQGPAVPGIPPSEAVKRLQDFLQRYSLYEAKRKTLDSVSKLFGIPCKPFPELDKTGEELELLGLLYGLFQKFIRFDDQFRDTLWAEVELQVATHEVESFWDECLALPSKLKDWDAYNDMKNSIQLYRDLIPLLHKLASKEIRNRHWLQVMAVTGSSFQLEAAVFKLSHLLDIGLITHRPEIEEICRSASRELELEVKLRMTEEEWTEQVLNFEPYKKRGPMYLDKTSTERLLEQLEDAQALLAQMLTSRYVGPLREEAASWAEKLKEVGQVLDQWLEVQDLWQYLEAVFSNETSLSKELPQEAKRFARIDKGWTKMMKRAYDTRNVLQCCYGEDVPKGVVLRHIYQELEICFKSLIGYLDVKRRAFPRFFVVSDQTLLAMLSRPHALDSVRPHFKSLFSAISDVTLERQQLSASELELQGSPHSSSPRRNPFSPAVESPVKIDKRLTQVLNLNRSQASLYVSTILPSENINEESITMEATAVMSSEGEFLPLIDKVPLTGGVEVWLENLRTSVKSTLHEQLLSICYDISNNVPCDEWPNKYTTQVCRLGLLYYWTRECEVGITEIKFDRKALSNLSRKFGSTMNKLPLAVSRSS--KGDEKLIALYRLRVEQLLTNSIFLRDSIDAMATRRLRENTDFEWRRNLRL--YVHDVDDQPTPCLYMLENCFPYGCEFYGAQPTIALTAFADKCFLSLTSTISSFQGAMVSGESGVGKSETVKGYAQIMGQFLMVFQCSPKADSSSLSKMVEGMAMDGCWGCFDDIETLNPEGVSVLIDHVQSILDALRSAAKHCTF------------------------------GDGQEASHSVA-KQPDLGIVLKAKCSSYGLKSPHVLANRLRTVAELSRDQLSDDQHHELSVEAICGVLRRVVL-RRRVLKEEKSFDKKPSDMQESRSNSVLSTSNHNLQQQQSVANISGQKTRKAGTPNPLSAAAKIEHGLVGQLLMDMIGPRLTPENLAIFRQIVKDIFSGLPESPPGSAIMSANRSLLDV---ETALENTAAESGLVVHKAWKDKCMQLFAISQVHQGIILAGPPGSGKSTIVQTLVDAL-----------------CTAPRGLSRGSARSQVQDGSEANHKLQKIFPAVVDDLSLVFGHLN-QNHDWVDGIFTSVWKKASRNQSTTWICLDGPLHSSWVDNFSSILDASKMLHLANGDQLPLSNNIKLLFETDDINEASPALIARCGILFVDKDVVGWRPIAKAWLDNRTQQELHVLQRAFDKTVDPVAHYVLDECKPRMRLSEVGMFCTTINLLSAMLADNIEIGGELHIERLYLFCLMWTFGGMLETKDRKGFNELLSSLSTALPDDDRDICFFDYYVDESGEWDPWQSRVPEATNPEHLNLLGEVFVDTVDTIRTRLLMELACASSQNVLLVGAPGSGKTSLINDFLSSQDYQQRVTTKLVSSGSSTAKQLQHFIESNIHHRQGFVYGAKENKHLQLFLDDLNLPQP---DEHGVQRSNE----------------------------------------------RHFTVLSLPVPSGDSLTSVVHGVLEASMLHGGHAPLESDLHQAVLKASCRLLTDLRSVLKCSPLPGRYHYLFTLRDFVNCFQCLRRLPDESRADEKLVASLWKHETERIIKDQLCRYTDIAWFEETMTETLELCFPKVAS----NLFPHFVTFPI------DARTYQRPVTTIS-SRKEVKVMLQPVESLQELHGCLQTHLNRYNEEFGNVHLDIMLSENIIFHIIKMHRVICYHHSGSFLVVGPIGSHLGTLIQLALHVASIPLHAIDSSKENNFLDGLRS----------------AGRDLINPLYMDAINSLLVSGEYPHLFTNDEMEGLLQAIGPAMKREHSNFTV----DPAKYFVSRVRTNLHIVICLPPTHPLLKIAPNQYPGLISGCQLIWMCDWTKESLLGEAAYFLNKSTLTKD---CENDLSENVMAIMANIHSFVLQDCRQCKWAGDTNEELTLNEVKVNEKKKELLKVQTRTLPNRPFSKAIMLESIK-LKHKQLETPSTSELFVGPTSYKRFMKTFKCIYTKKAKERTQVVGTLKKALSTLDQTRDDAQKMRQDIRTITLKFENAREKTGHLLSDLTLKATALEKLRAQLGMSTSLSAFLQLNEMSDEEEEDTE-LLKEDERDEYDDEFDRMRAANLKTR--------------LIAAKDEHTEAVKTVLHWRGRVDRQCVERLKAFQNPPMLVGHVLEMVMTLIGKRLPSQRLETKADNYPTKEEQSGRFTSSSSSTKFTGSVKKSKSVDKSSTGAERFDRAQWKSMQQMLNDTAKFVDIMHNVAWEDGLPDDVRAAVESYLARSRDGLLGVTGEGSLLDNAQ------EKERGLIAQRRSPSPDNTRGISIAAAKYASEDAATLVNYTIAIVEYTRLCGPLKAAMERRHELEREIEENDRLQREQGQQEGEKEGEAEVEKAEEEELTEKDLPRLQEEVQDLQAHFDAAVVEKHSLEMELTSMKERLKAATNMIGSLKPQEASWRQYVEEHISNDMLVANSLAAAAFLTYCSAMNADCRSRLGEFFITICEHHNLPLPPKKLFKNMSLMDFLEKPLMVYELRKLNLPTTPLMLENSALLMQGDTTMAWPLLCDPVSHVLSVLRSYLNNQGLVEVSYTHLRSQFDTCLAEGLPLLITDVDVHEFIHDQRFRSIIYLRNKFVSGQNPFKMKV-GEHEVECQPHFRMYLHTTSLPHEVPPELAAHVGLLYFHQTREDVEEQLLDRFMRREKMRLDEEKRTLLMERMTNSKNLEELEQEMVQCLSSEVRLLNDLSATKKLAELKKQHEETEESQCRVDTAEQTLSRARESFRVIAKQGAVCFDTMQYMREINAVYKVSFVQMLELFDQAVSHSDRAAVKAVVDRLMNLFFVSTTRFLSERDKQIYCLLLALEVEDAEGRVGRGEREYLISPSLGSVTMTALGCSAAQD-SKFVQAKKPFDWMNEDQFSNLQILAIHYEWFQDMFDRMPKDGRETQWRNLCESDQPEMQPLPDRM-DDQYTLLQRMLVIRAVRSDRLNQVSVLFINNILDKKLLGEGNGLDLTGALRQAAPKTPLLMLY----------------TTEKEAAERAVLEFAARKQVDVIPVSLSGPTQAIEKVARKSLAKAMATGCWLLLQNGHSQVHL-------------------LNSLE---LMFSEQETIDPNFRCWITAEAKADLPTTILQSCVKIMIDKPRTIRDQLVRTF--SSIDAETLRHSSKVDWLPLLHNICYLHGALKLRSRFGRGGFNKHADFTQI-GLSTLVECINLAKDEFMDNLSVLAPDGSALPRSTSWSGLRFMVAEVFCGNFVEDPLDQQSLTAMVEYWLSSNACKKDFELPRIKYKIPAVFFNQNVRQTQLVQALESTTPFFLESAEACNLHPSSETLMGDDQYIFTRLNKIYDAMPSSQSLTHKL 4741          

HSP 2 Score: 210.69 bits (535), Expect = 9.210e-50
Identity = 235/1067 (22.02%), Postives = 465/1067 (43.58%), Query Frame = 3
Query:   78 MDERHWWLATRVNESLTDKIKSNVSELETAFLEFNNSNCINSFFDEDGPLVLYF----AKCINSSLKSVHVSSEIKDLNDKSLFPSEKLTILLVIKKRXXXXX-XXXFENELFCIELKNYILQNITTIFTHGFIPLLMTKYNSCDNTEK-----IYPLTSQLNSMWQSVQNYTDQLYLNTNMEEPI-------HATIDLNKELQDPLKQFETFVTDVMSEIEVILEEVND-RTSEQDIFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIRRQILSIINNKIQAIVGFNQAPEDLWKRVQDEICEGSIESFLNMSLSQVKIILPKEDLLSNVEAFNSILHNNEIRTNTILGLLKFSNIIHDIFLENVTNLRETLNVSNSTKY-----SLHVP----NKSTENINITIPR-----FDQASEN----GIGIYDDNKIFSNWLVINGEVKKFIEICNHQLKFEKILSMKMVRISTLKFDIIHLL--EKASKTQNAMQYSHKTV-------NSSD--DEPEENNLSDGSEEE-----SSAIKQNWSYSTLASS----RDSLEWLLNLSTENTAD--VSLLEVINKTRSLTLSNM---TSTFNILEITNLDRSSLTDNMHIGKTSEMHE---EIMNNFDKTFSIFLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAG-MHSEFSKLLKYLATQKIYNFNHLLSKNWDSNEFTEAIN-------KDLLAKKSTVQRTLEACSNIL 3062
            MDERHWW+A ++ ES       N + LE    E +    INSF +  G   L+F          S + +H ++ +  L D +L   E +TIL  +++   +   + + E ++FC ELK   + N+ ++ +  ++PL+  + N   +T       ++ L   +NS+ +S  +     ++     E +       H    L+  +   + ++E  VTD M+ IE IL + +D R  + +   + E+E+W+ R             +M  +    L SK+ K +     +  LIT     +K ++            ++R+ S+ S +   + +   K++  ES  R F       +   +I   +   IN   Q       +    + R          + FL + L+++K               N    + E+    +   LK   ++H  + +++ +LR+ L VS+S  +     SL  P     + T  I+I+          QAS +    G+ I D+  +  +       +K+ ++I N   +F+K+L            D++     EKA+ T      +   V       NS D  DE EE  +     +      S     + +Y  +  S    +  +E L      +  D   S+  +I    S  +  M    +T  +L++ + D+         G+  E++    +++ + +K F+ +LN LF+R ++T EAL ++  F  +  R  ++ VI  K  E+F  ++SD+      Y+  K+          V   + W + LLS IE PM  F++ K V+ +++Y  IVK YN+++  L++ +S +  +W  +++   + L   L ++     ++ +N    +L ++ E + + R+  Q+  +A ++++ E R K +   L   +N +++V  +I   +L LF+ HI   +Q FQ G S+L+W ++NID FLH++      L+ ++++V   M ++  + ++ +     ++     S++W   +F E +        K+L      ++  ++ C+NIL
Sbjct:    1 MDERHWWIAGKIQESFRIGGFDNPTLLEDFMCEASTMAIINSFLNPGGQCRLFFYCDQVDANALSTRQLHTTANLASLKDINL---EVITILYFLRQNLDAAVDVGHMERDIFCGELKGNTITNLNSLLSDIYVPLMKVQKNWGSSTGDAQNNLVHNLDKVMNSLTESTASLNASKHIMLKQPENVVGNEFKQHRLAALDHTI---ITEYEDLVTDWMNTIESILHDTSDERFLDPNAGPLSELERWKRRQ------------RMLTSITEQLKSKECKGV-----IGVLIT-----AKSRL------------LKRWKSVDSGITDAMNETKDKVRYLESLRRHFDLLYADATPAVIINTALPGFINTVKQM-----DSVSRFYAR----------QGFLGLLLTKIK--------------RNG---STEVAHEGLFTRLKACLMLHTYYRDSIRSLRDALGVSHSLSHANSISSLAGPVSAGGRRTNRISISSASPSKKAMSQASSDLEGHGVPIADEETVLGHLDSFCSRIKQILDIINTFAQFDKMLKNTSALPRPRNDDLVFYEKDEKANDTAADEAPTKPQVPTIEGMSNSLDVIDEDEERLIEKADRDRRQRDVSDFANIDEAYDAMGISGGLTKKDVEILKEYYPYDQKDEGPSIYSIIQGKISRMIHGMIGSATTSTMLDVESKDK---------GRFEEVYSSFIQMVMDIEKFFAAYLNALFMRKIKTHEALDLMMLFSCISQRPGVRMVISEKFVEIFNWYESDLEEVQCIYERHKDDPLLARNAPPVAGAIGWSRNLLSRIEEPMKIFRENKAVSNLRDYSRIVKIYNRLATALVTFESLWFTHWKQSIEQARSGLYATLFILHPETREIMVNVDSKVLELMQEAKWLKRMNIQIPESASQIVQKESRFKGYHDHLQLCLNEYKSVCAAIPEALLILFKPHIDACLQNFQPGLSTLAWNSMNIDPFLHQIHTGTAKLKFLVDRVNSIMANKVERAIENIRQMIFFDHKLAFSRSWPPEKFIEMMGLSIGDQSKELTQYIHNIEVGIKECANIL 986          

HSP 3 Score: 193.356 bits (490), Expect = 1.546e-44
Identity = 99/307 (32.25%), Postives = 167/307 (54.40%), Query Frame = 3
Query: 14289 STISFQIDLTKVENELFEICKNLASKLPKS-TIESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVI-MNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKP------ENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGVFITINPF 15185
            ++ SF     K E EL+E+C  +A K+P++ + + I ER+KKV     ++  +MKEL +   +  +I   +Q  +    +  +G  ++   + +   L   ++P  W     N      Y+   W++ L  + QH ER+++  ++K+  YWLGAF  P  LLA+ K++      + DRSG +       E T +DKDHIR+PP++G+++ G++LWGC ++K TG+L D   +  C  LPV H+T      DKP      + S+ Y CP++    A + PIL + +S  G+ S++W LRG+  TI P+
Sbjct: 4815 ASASFATLKMKKEVELWEVCHLMAPKVPRAYSKDYITERIKKVGGFTSFNMFIMKELDIMYQLITDIKTSLQAIKAACELTNMGEMLTPTLLGIADDLYHLRIPHHWCRLAGNTAPPPNYALGTWLTDLANRCQHFERILVLGREKMPAYWLGAFTYPRGLLALLKQDCYRHHPQ-DRSGAFDQYVFQTEVTARDKDHIRDPPAEGMFIFGIYLWGCAWEKTTGDLIDTPPRHACAALPVIHLT-CWPQADKPILQDASKASEIYACPVYQSRIAPRRPILELDLSHSGVPSTRWSLRGLSATIRPY 5119          
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Match: A0A210PM49 (Dynein heavy chain 5, axonemal OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07441 PE=4 SV=1)

HSP 1 Score: 1507.27 bits (3901), Expect = 0.000e+0
Identity = 1003/3419 (29.34%), Postives = 1739/3419 (50.86%), Query Frame = 3
Query: 5457 HLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKM-------------KTTVMDSVG--------NQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKI---KSPTSSFIK----QKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHL---------------MEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLATNS----SADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPL--LLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREY---LVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN-HSLNEIDLYLSEEKD-KDQLAQYLANLHKEVLKFTVT---PSIVSGKSVKIGKIIMNDKKKEIYKYDSTSLA--PYSQLFLREKLRN-------------LNDNSIQ-----KKIYNGPCTFHRFLYILRRLLHQKTIEKTQSTQTISRALNSIKQTKHDITTINNLISHQKVKFNEISIKSQQLLKTLINKVTLLRIILAKKGDNSYLNEILIKNANISVSELYKDPLLIDAERDELDDEFERIREESLKNRKNIIKGTLEKTRKEYFALKKDLAYATEQVCYWKSKIDRQVIDRIKSFQNPPSLVIDVIEMIFILIGKQIQNTR----KDSNADDD------------------ETNDEKSNARSRWKRMQQFMADPVKFVDIIHNVSWTDGLNPDVYNGVKSYLATSKDGQLGVTGEGTMLNQAENVNIKAKKNKQMTPELSESENLINRSISVSATKYASEDXXXXXXXXXXXXEYTEKCEPLRQALQK---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGL-VTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSDLHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISP-------SSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLSLRATSPSSAILMKYLNNSYETNILFNQIHSSVKPRIIQSRVIDYS----KEGLQLFYQQLQNQMSNIHEICLDSSLTTSNLTALNSVYIVIH-LSSTEHISSIHKRVMSYIDEMNSFQRSALLKSRDQNVVTYNLFFTLPQNHSGVSSSQMNKMTTVYLDYPSNLRDFLLH---LFKIGFLSANSIPSMSLDLLPVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWF------------ESHSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHL-SSNLLTKINSEKILIEKIDKVSQTINEKSTISFQI--------------DLTKVEN------------------------ELFEICKNLASKLPKS-TIESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVI-MNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHI-TFTLND----LDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGVFITINPF 15185
            H P+ F     +  D  FR+ + +    S+  E ++L +K+ + D V  WL  L   + ++I +L+ + I   + G +++E   K+P+Q+C   +  +W+ E +  ++EIK D+K+L    KK+    S++   L+R +W++ ++P+  L + RL  M    LYLRD L N+  +K+R+  DFE  + I+              ++   D  G         Q+  +  L   +  G EF G+    A TP TE+  LT+  +L + + S + G    GK+  ++ LA    ++     C       +L   + G A +GCW   D  + +    LS+    +  +  A+K + +  ++ + + I ++       T  +  +     LP  +   FR V++  PD   ILK  C    +R    L  RL +V + A   ++EH   +  + +    L +A   K+  +  EKT      +T   ++  E   S    K+   ++  SS +K     +   TP  ++AA K EH LV + I+E++ P +T  + K  K +L D F G  +          PP  L+ I + AK R   I   L               M K  QL+N+ + H G+I+ GP  SGKST +   +              + LS+S     + S   +R ++P      H +  I PM  + E+ MFG+ + +  D+ DG+FT   R+ NRN   +W+  DG +   W+ N  SIL  +  LHL +G +L  S N+  +FE +S+ DASP  ++RSG+VY   +++GW+ +   W+E++   E+  L + F K LDP+ Q+++Q  K     S+   F+  L +LS ML DN EIGGELHI+RL++FC IW+    ++  +++  + LLK  +  LPDDD  IC+FDYYVDESGEWD W+S + +     +  + GEV +D++ T R K  ++  + + LNV L+G  GSGK+ +++      D       R V+S  + + Q + F+EANI HRQG +YG KE K L + I+D+NLP P   DS  ++R NE+LRQLL+  V+   + PFE   + D +II +++ +     S   L  RL+RHF    +  P    L++I+ G+ E ++   +   + ID  + L+ A+ ++ + V SVL+ +   GR H  F+L+ I      +K    +S + E +  ++  W +  +R+ +D +    DL WF++ LQ  I++ W  +     +    NF+TF T+    +        R    + A  I + +  I+  R+    L + +  + E+FG   +N+M +D ++  II +HR ++    G+++LIG+VGSHL+ +C +AL +A +PI K++TS      D ++S +R  GSEGK  +++ TAR+L+  + LD +NSL+ISG+ P LF  DE+ GLL A+  +MKRE  + ++    D ++ F +R++ +LH L+CL P + ++  + ++YPG+LS  A+NW+ D     L+ +A+YF+  H L E    L    D  + +   LAN+H  VL+          ++G+ V + ++ +++KKKE  K  S ++   PYS+L + E+++N             LN++  +      ++Y GP T+ RF+   + L ++K  E+T +   + + ++++ QT+ D   +   I     KF++    +  L+  L +K T L  + AK G ++ L+  L     +   E  +D LL   + D+ D EF+++RE +LK R+   K       K     +++L YA +QV +WKS++DRQ I+R+K F  PP LV  V+EM+  LIGK++ + R    +D +  DD                     D     R++WK M   M D  KFVD++HNV W DGL+ DV   V+SYL+T KDGQLGVTGEGT+L+ A++++ +A+K    TP    S     + I++SA KYASED A LVQY +A+VEYT  C PL+ +L++   +     E E  +   E+  +E E         +  +++   L+ E   L+  ++  +  +  +E EL +++ERL     +VE++K  E+ W+   K+ +    +   C+ ++A+L YCGP N + R +  +F +       L +  R     +E+ +FL+  ++I  +E   LP     ++NA F++ E     W LICD T R I WL  Y      V + YS++ ++ E+CLA G  +++ DCD+ QL++D+  R   +   RF+ EK  FKI +E +HEVEC P FRL+LHT      +P  L +   ++ F  S   +  E L RF+ K K  ++ E   L +EK++    L KLE+QM D+LS+ +R +  ++    + +  K Y+E   +  + E   +S  K+ + +  IA R A  F +   M  V + Y + + ++L+L+D+ I  S+R   K +I+K+T      +   + + ++ +F+LLL+IE+  +   +   + E+LISP       +++ L  +PD      SK   +KKPFDWM+EE   N++ILA     F+++ + M KD +E  W+ L +S+ PE   + +++  +  +  Q+LC+IR +R DR+MQAS  FI N L  ++ G +   D+   LR ++P+  +++ Y         LF+   +  + + +   + D +    +   +L ++ +Q  M                       ++++H   ++ H+             MN+ +  A+L        T+ L+ T   + + +    +       +D P  ++D L+     F+   L  +S P   L    ++HN S L + ++ R+ Y   G+ + +  + I   + + E +  M   F            ++  + SW  +RY  SEIIYGS +T + DR +++S+ D+W++ NA++K+F+  KLKY  P   ++ N + + + +A   I+    +  E CHL  SN+ T +  E+ +  +++KV   +    T+S ++              +++K  N                        EL+E+C  L +K+PKS   + + +R++K+ +   ++  +MKE      +  EI   +Q  +     N LG+ +SD  +S    L   + P+ W     +      ++  +W + L  +  H ER++   +DK+ CYWLGAF  P  LLA+ K++    +   DRSGN++      E T +DK+H+R+PP +G++V+G+H+WGC ++K T EL D   +   + LPV H+  + +N+     D  + ++ Y CP++    +K+EPI+ +   +EG  +++W LRG+  TI  +
Sbjct: 2049 HAPA-FMPSEGIVEDSVFRDAVAVS---SAEGELVLLQDKVFLTDGVEVWLQKLRESVAKTIKDLNINIIHDCNNGVAMDEWPSKYPAQVCRMGMLYYWTRECDQGIAEIKYDRKALQGTLKKYIASGSKLQTVLSRGAWRTIEEPMLPLHKARLECMISQFLYLRDILDNMCTRKLREPTDFEWRRSIRCYFHPVASDTPTPRESVTGDDSGLDDLAIQDRQEPMIWILDNPYIYGNEFYGTNAGAALTPVTERCFLTMSQALNNYQGSCVSGPVGVGKTETVKGLANTLGQFLSMVQCCPEFDPTALARSIQGTAMDGCWCCFDEAQSLHRKALSVLFDHVEAVLVAMKARHSYATLADGQEISVKKSCAMHMT--INRDDPRCNLPVEVRALFRTVSLIKPDFSLILKAKCASMGFRAPTVLGARLKSVSELAKDQLSEHFHHLFGIATWTGVLKRALQ-KRKYVRDEKTQDRIESKTKDETSRSESQASEAPTKLAGLQNVASSNVKISSVSRKTGTPNPMTAAGKLEHALVAQTILEVISPRLTGRDVKLFKAVLDDVFAGLPE----------PPSNLSQI-QSAKSRGADIDVSLKHKVADKGLVAHDPWMTKCKQLFNISQVHNGVIVAGPPGSGKSTCIQTLV--------------DSLSISGRGTSRQSQG-SRATNPA--ESMHKLIKINPMVVDDEALMFGSLN-QNHDWIDGIFTNAVRKANRNLSTTWLCLDGPLNQGWADNFNSILSGDKVLHLKNGDKLFLSDNIILIFETDSLDDASPATIARSGIVYLDKDVLGWKPLADAWIESRTPQEIHVLQRAFQKTLDPIAQFVLQEAKPSLKLSLVGMFKTCLGLLSAMLADNIEIGGELHIERLYLFCLIWTFGGLLNPADRKGFSDLLKTLSTALPDDDRDICVFDYYVDESGEWDPWTSRVQEVIYTDNQDMLGEVFMDSVDTFRTKILMEFASASGLNVLLVGANGSGKTSLIERFMDIQDPQVSVCKRLVFSGASSAKQFQHFIEANIHHRQGFVYGAKESKKLKVFIDDVNLPVP---DSHKVQRCNELLRQLLDDKVLCTLQKPFEWKTVEDLSIISAMSMSDHPSVSTRKLSNRLLRHFAVFNLATPSDEGLKNIVHGILEVNMTDGDCQGLEIDLHNNLVKASCEILKAVQSVLRPAPMYGRRHYLFSLKDITVCFQNLKRLPEESLADETMVPVVSLWRHEMQRIIKDRISRTADLNWFDSLLQETIESTWP-DFKEPLIE---NFVTFPTDARMYQ--------RPVTSVGAKNIKIVLQPIDQLRDVHSCLNTHLTRYNEEFGNIPLNIMLSDFIIAHIIRMHRVLSFHHGGNMLLIGAVGSHLATLCKLALHVADVPIHKVDTSKQSNFFDGLRSAVRLCGSEGKILSLMFTARDLEDPVYLDAINSLLISGEYPHLFSNDELEGLLQAIGPAMKREFPNMSV----DPMKFFVARVKSNLHFLMCLQPGHTLLSIAASQYPGLLSGCAINWMCDWPQVALLGEASYFITRHQLTEEFEDLRPRPDWLENVTVCLANIHSFVLRDCRQLPWAGDMTGE-VTMNQLKIHEKKKEQIKTQSITVPNHPYSKLIMLERIKNRRRMRTEDQSLTSLNNHRCEVVKAKNEVYIGPTTYRRFMECFKYLYNEKAKERTSTVDQLKKVISTMDQTRTDAKVMKKAIKSIMGKFDDAKKNTADLMHKLTHKATNLEKLKAKVGLSTSLDAYL-HLTEMETEEEEEDELLQPEDYDDYDKEFDKMREANLKTRQVAAKEEHVVALKYVEECRQNLEYARQQVLHWKSRVDRQCIERLKGFSTPPVLVGSVMEMVMTLIGKRLPSQRLQESRDYHGKDDLSSRMSSSSSSTKVISKKAKKDGDRFDRAQWKAMTLTMMDTTKFVDMMHNVPWEDGLSGDVLRAVESYLSTGKDGQLGVTGEGTLLDHAQDLSFRAQKR---TPSPDGS-----KGITISAAKYASEDCATLVQYTIAIVEYTRLCGPLKTSLERLNELQREIEENERIQREREEEPQEEEKAPTPEPEEEYTEDDLSRLQGEVSALQQVFDQSVVQKHSLEMELNSMNERLKAATEMVESLKSQEQSWRKHVKENDCNELLLGNCMAAAAFLTYCGPANLDTRKRMGEFFMQVCEHHKLPLPRRRLFRNLELVEFLNRRLDIMNLEIERLPITSLMLENACFLMQEESTTAWPLICDPTSRVIDWLQFYKRSKGLVCVRYSEMRSQFENCLADGSPLLVTDCDVIQLSKDKRFRDAIQRCNRFINEKSRFKIFVE-DHEVECDPKFRLYLHTTLEPHNVPSHLAAYCSIMFFQQSRLCIEEELLDRFLAKEKSRLEDERTALRQEKKENIVLLEKLEKQMKDNLSSDVRLMNDLQATKKLAELKKQYDETVESHSRVESAENSILKNRELHRPIAQRAAVCFDVCQYMREVNRLYQMSYTQFLSLYDTAISHSDRTVPKVVIEKVTSSAYTTTARGLLERDRSIFALLLAIEVEDSLKKIGRGEREFLISPNYSMVVMTTLGLGQSPD------SKIVQAKKPFDWMTEEQFHNLQILAMYFEWFQEMFDRMPKDGRETQWRTLCESDLPENVALPDKM-DDHYEQMQRLCVIRAVRSDRLMQASTNFITNVLGKRYYGDIG-IDLTSMLRQSTPTIPLILLYSVEVEHVTKLFHDFSNRKQAKTLSLTINDDTSAIERTAKRLIHKGMQEGM-----------------------WVLLHNAHNSPHL-------------MNNLE--AILLEETNPDSTFRLWITSKVDTTALPLRLLQNSIKAVIDTPKVMKDSLIRSFSSFESDILKQSSRPEWPL----MLHNLSYLHAALQLRARYGQGGWNNGQDFLNI-GINEIQEALSFMITEFKEPLTCVAPDGSQTPRSTSWTGIRYMFSEIIYGSYITDDYDRNSMSSVVDYWISPNAIKKDFDVAKLKYRHPPGFFNTNPRLNNLIQALDGINNHFLDVPEGCHLHHSNIETLLGDEQYVFTRLNKVFDAMPSTETLSHKLFPKPPTPFHGPAKAEISKYSNNPAVFTQGTFATATYSVLKRTKEIELWEVCHTLLTKMPKSYNRDFLLDRVRKMADFPSFNTFIMKEFDQMILLITEIRTTLQTIKNACETNVLGDMMSDHILSAADDLFYGRTPQTWCRMAGSSAPPMNFAVGNWFNDLGNRCLHFERILSQGRDKMPCYWLGAFFNPRGLLALLKQDYIRHYC-GDRSGNFEQFVFQTEVTTRDKEHLRDPPPEGMFVYGIHMWGCAWEKTTMELQDTPPRSGFSSLPVVHVNCYPINEKPLLQDPVKAAEVYQCPVYASRLSKREPIMEMDFKREGYPATRWALRGLSCTIRNY 5349          

HSP 2 Score: 546.969 bits (1408), Expect = 2.045e-151
Identity = 298/719 (41.45%), Postives = 453/719 (63.00%), Query Frame = 3
Query: 3363 YDSDHAESKTLIKFILLVKYEIPMIKFEPELDAIQSIIEQMGQDIMAFHNDVSDFSGRKLNLYIKLESDL--FYEFSQIISLKYSESRLKLQSTVENLNEFDFLWKMTSDKL--DFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPA 5507
            + ++  ++ TL++F + V + IP I  EP LD  Q+ I+ +   ++  + +VS    + L  +  L +D     E +  +S   +E    +   + + + ++FLWK   D L  +F+E ++      ++K ++ + L+++  +  +PK + +  + + T   +  L      W+ K    LH+EAK+ LD A  YR  V   L+  V  L+QLN  L +L++++D++ KIDSIY PIE++Y  L  FEL + R+E  E+  LR  W  LI++AE  R  LL E+R  F QELDKQ+K F VEVIQFRN FD + P++ G  P E   +L+ F+ +Y +Y+ K+NTL ++SKLFG+  + F EL+   E+L LL+QLY L+QKF +F+  F D LW+ VDL+  + ++  +WDECLALPSKLK+ ++Y +LK  +   +++  +L +L +KEIRNRHW++VM+VTG++FQLEA  FK   L  I L+++K EI+ IC  A +E+ELE+K+   EEEW EQVL F+ + +RG + L+   T  LL+QLED+Q LL NM  SR+I P++DEAA WA KL  ++EVL+ WLEVQ +W  LE VF N I  K+L QE KRF R DKS+ K M+R +ET+NV QCC   E  K   LKNI + LE CF SL GYL  KR  F R ++V D  +L+I++  ND++++  HL S+F++++D+  + A
Sbjct: 1245 WTTERTDATTLLQFEVEVHFMIPNIIVEPTLDIAQTAIQDVANAVLEANRNVSWIGPQGLENFYSLIADDENVVEMTSQLSNIINEIDTVVNKHLFHFSYYNFLWK---DDLHGNFKEFISADPGMFAIKREVERFLYIEKKVLGIPKMLPVGPISLHTDPIKDALHGFAMAWKIKFASVLHEEAKKKLDAAVLYRSNVRNRLELHVQSLDQLNSALHLLEELWDMENKIDSIYLPIETLYAKLREFELRLPRNEVEEVDQLRDKWQELIELAEQVREILLKERRGAFEQELDKQVKTFVVEVIQFRNAFDAQGPAVPGIPPAEAVSRLQDFQQKYLLYDSKRNTLESVSKLFGIACKPFSELDKTGEELDLLSQLYGLFQKFLRFDARFKDTLWAEVDLEAFFREVEGYWDECLALPSKLKDWDAYHDLKTSLQTYLEVFPLLHSLNAKEIRNRHWLEVMRVTGSSFQLEANVFKLLHLLDIGLIKHKLEIEEICRGASRELELEIKMRVTEEEWNEQVLTFEHYKKRGPMYLDKVSTERLLEQLEDAQALLANMLTSRYIGPLRDEAAGWAEKLKTVAEVLEQWLEVQDVWQYLEAVFSNSIAAKELPQEAKRFARTDKSWTKLMKRDFETRNVLQCCYGGEVPKAVLLKNIHEELEICFKSLMGYLDNKRRAFPRFYYVSDPILLAIMSRPNDLESVRPHLKSLFSSIHDVRLEEA 1960          

HSP 3 Score: 279.641 bits (714), Expect = 1.345e-70
Identity = 256/1133 (22.59%), Postives = 523/1133 (46.16%), Query Frame = 3
Query:   78 MDERHWWLATRVNESLTDKIKSNVSELETAFLEFNNSNCINSFFDEDGPLVLYF--AKCINSSLKS--VHVSSEIKDLNDKSLFPSEKLTILLVIKKRXXXXX-XXXFENELFCIELKNYILQNITTIFTHGFIPLLMTK--YNSCDN------TEKIYPLTSQLNSMWQSVQNYTDQLYLNTNMEEPIHATIDLNKELQ----DP--LKQFETFVTDVMSEIEVILEEVND-RTSEQDIFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIRRQILSIINNKIQAIVGFNQAPEDLWKRVQDEICEGSIESFLNMSLSQVKIILPKEDLLSNVEAFNSILHNNE--IRTNTILGLLKFSNIIHDIFLENVTNLRETLNVSNSTKY-----SLHVPNK--------------STENINITIPRFDQA------SENGIGIYDDNKIFSNWLVINGEVKKFIEICNHQLKFEKILSMKMVRISTLKFDIIHLLEKAS---KTQNAMQYSHKTVNSSDDEP-----------------------EENNLSDGSEEESSAI-KQNWSYSTLASSRDSLEWLLNLSTENTADV-------------SLLEVINKTRSLTLSNMT---STFNILEITNLDRSSLTDNMHIGKTSEMHEEIMNNFDKTFSIFLNLLFLR-PMRTGEALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAG-MHSEFSKLLKYLATQKIYNFNHLLSKNWDSNEFTEAINKDLLAKKSTVQRTLEACSNILKEITEIISIVEKLDPNSSLYESEDLIFGQMKEMYNKSLSQSLYRSI 3200
            MDERHWW+A ++ E+       N + LE    E      IN F    GP  L+F   K  N++L S  ++V+  +  L D +L   + + IL  ++ R          E ++FC ELK+  ++ +T + +  ++PL+  +  +  C+N      T  +    + LN    S+Q  + QL L    ++P +  ++  K+ +    DP  + Q+E  V D M+ IE  L + +D R  + +   + E+E+W+ R  LL  +  QLK K  K  IG L++ KS+++KKW+ +++ IT+A+N++KDK+KYLE+ +     +   A+  S +   +P I   ++Q +S SR ++R G +G   + I  Q++      I+         ++LW+R+ +EI   S +S  +M      +    E  L N  +        +  ++ +++ G L+    +   + E + +L++ L  S +  +     S+  P                ++   +++ P+  Q+        +G+ I D+  I S+       +++ +++ N   ++ K++          K D+++  E      K +   Q + K V   +DE                        EEN    GS+ E  AI K+           +++     LS E  A +             S+   + +     +  M+   +T  +L++ + DR    D      T+      +   +   + +L+ +FLR  M+T + L I+++F  ++ R  I+  I  K  E+F  +++D+      Y+  K     +     V   + W ++LL  IE PM  F+D + + Q+ ++  IV+ YN+++  L++ +S +   W + ++   + L+  L V     +++ +N+ E +L +I+E + + R+  Q+  +A+ +++ E R K + S L   +N +  V +SI   ++ LF  H++ V Q  Q G ++L+W ++NID FLH++ +    L+ +  +V   M  +    L  +    ++++   +S++W   EF + + + + ++   + + +E+  + L+ I   ++  +K    +S++ +  +  G   ++ +KS++QS  R +
Sbjct:    1 MDERHWWIAGKIQETFKIGGYDNPTLLEDFMTEEGTLTKINRFLKSSGPCRLFFYSEKPENATLSSRELYVTGTLAALKDVNL---DNVNILYFLRNRVDKDVDGHRMERDVFCGELKHNTIETLTALLSDVYLPLIKAQKEWGECNNECQTNLTHSMDKFLTALNESTASMQT-SKQLML----KQPENIILNDFKQQRAAALDPQLISQYEELVNDWMNTIETTLNDTSDERFLDPNAGPLSELERWRRRQRLLTNITEQLKSKECKAVIGVLITVKSRLLKKWKNIDASITDAMNDTKDKVKYLESLRRHFDQLYHDATPASIINNAIPGITNSVRQMDSISRYYARVGFLGLMFTKITNQLVLACKEYIKNCTMTVYDGDELWERIGEEI--RSRDSLPSMDTQHKYLKNQVEANLKNAPSRGKSKEGKDLGLQDDSLFGRLRACLTLQGYYREMLRSLKDALGQSQNLSHFPSLSSVGGPGSFTGTGAKSKQGTSGASRGTSVS-PKKGQSIMIADTQGHGVSIADEEAIMSHMDSFCNRIRQLMDVINTLAQYNKMVHSTTGIPRLRKEDLVNEDENEKDIYKYRKRQQEALKAVMVYEDEEVEGGLTSVQVTSPERSLRAIAEDEENQDDQGSDPEDMAIEKKEVPPDPTDDVFETVNGKQGLSDEEIAIIRKYFPEEEEEEGPSISYTVAQHHDSMMKAMSENVTTKTMLDVESKDRDKFDDYYANFATT------VQELETFMAAYLHAMFLRKKMKTTQGLDIITRFGPIQSRPGIRAHIAEKFVEIFNWYETDLEEVHNIYETHKENPQMVRNAPPVAGAIHWSRQLLKRIEDPMKIFRDNRAINQLGDFGRIVRIYNRLATALVTFESLWFTQWKNRIEQARSGLRATLFVHHPSTDQIVVNADERVLELIHEAKWLTRLGIQIPESAVSIMQQESRFKNYKSHLELVLNEYREVCESIPEPLIKLFTPHMEFVEQQLQAGLTTLAWNSMNIDAFLHQIHSATQKLKGMQQKVHQIMEQDIYDKLDSIRNFYLFDYEEAISRSWPPLEFRDKMLQSIQSRSEILGQYVESVLSSLQRIANTLA-TKKTYTFTSIH-TMAVAKGVATKIKHKSMAQSEKRPL 1114          
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Match: V4A786 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_229063 PE=4 SV=1)

HSP 1 Score: 1462.59 bits (3785), Expect = 0.000e+0
Identity = 981/3384 (28.99%), Postives = 1724/3384 (50.95%), Query Frame = 3
Query: 5535 IFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAI------------------VMIGQIKDA----------IKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGST-----------LMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSD-SHSKNI--KETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAAL----------NHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHK-ELSINSVTIAFQNSLKVLSQMLVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLATNSSADL----LDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAV-AMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN-HSLNEIDLYLSEEKDKDQLAQYLANLHKEVLKFTVTPSIVS--GKSVKIGKIIMNDKKKEIYKYDSTSLA--PYSQLFLREKLR---NLNDNSIQKKIYNGPCTFHRFLYILRRLLHQKTIEKTQSTQTISRALNSIKQTKHDITTINNLISHQKVKFNEISIKSQQLLKTLINKVTLLRIILAKKGDNSYLNEILIKNANISVSELYKDPLLIDAERDELDDEFERIREESLKNRKNIIKGTLEKTRKEYFALKKDLAYATEQVCYWKSKIDRQVIDRIKSFQNPPSLVIDVIEMIFILIGKQIQNTR----KDSNADDD-------------------ETNDEKSNARSRWKRMQQFMADPVKFVDIIHNVSWTDGLNPDVYNGVKSYLATSKDGQLGVTGEGTMLNQAENVNIKAKKNKQMTPELSESENLINRSISVSATKYASEDXXXXXXXXXXXXEYTEKCEPLRQALQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXE-EFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSK-IEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISY-----SDLHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISP--SSVALKSNPDFIKQN--ESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNI---MERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLSLRATSPSSAILMKYLNNSYETNI---LFNQIHSSVKPRIIQSRVIDYSKEGLQLFYQQLQNQMSNIHEICLDSSLTTSNLTALNSVYIVIHLSSTEHISSIHKRVMSYIDEMNSFQRSALLKSRDQNVVTYNLFFTLPQNHSGVSSSQMNKMTTVYLDYPSNLRDFLLHLFKIGFLSANSIPSMSLDLLPVI-HNCSLLMSIMKSRS-----------SYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFESHSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSNLLTKINSEKILIEKIDKV------SQTINEK--------------------------------STISFQIDLTKVENELFEICKNLASKLPKS-TIESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVI-MNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSG----YSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITF-----TLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGVFITINPF 15185
            + SS  E ++L +++ + D V +WL  L   + +++  ++   I   ++G +++E + K+P+Q+C   +  HW+ E  T +SE+K D+K+L    +K+ +  S++   L+R +WK  D+ +  + + RL  M    L+LRD L NLS++K+R+V DFE  + I+     +D     +  +  L  ++D G EF GS   +A TP TE+  LT+  +L+    SSI G    GK+  ++ LA +   +    HC +  +  SL   + G+A +GCWG  D  + ++   +++ +                  +M GQ              ++    T S++E + I+++     F T    +      LP  +   FR V++  PD+ QILK  C    +R    LA RL  + +     +        T+ S+V  L +A   ++ L  ++ T   +  ++   S            L    PS +    K P  +  ++    TP  ++AA K +H++V   I E++ P +T  +    K ILK+ F G  +   ++N+   ++   DL  A+  +A       +   + + VQL+N+ +   G+I+ G   SGKST +   + AL          +H++ NR NTS  +                         +H +  I P+  +  S MFG +  +  D+ DG+FT   ++ NRN   +W+  DG + P W+ N  S+L  E  LHL +G +L  S NV  +FE +S+ D+SP  ++R+G+VY   +++GW+ I   WLEN+   E   L + F K LDP+I ++  + K +L +  V + F+  L +LS ML DN EIGGE+HI+R+F+FC IW+    +   +++A + LLK  +  LPDDD+ I +FDYYVDESGEWD W S + +     +  + GEV +D++ ++R +  ++    +  NV L+GP GSGK+ +++      D       R V+S  + +SQL+ F+E+NI HRQG +YG +++K L + I+D+NLP P   D   ++R NE+LRQLL+  V+   + PFE   +    ++  +A +         +  RL+RHF    +  P+   L+SI+ G+ + ++   +   + +D  + L+ A+ +L  ++ SVL+ +   GR H  F L+ I      ++    +S++ + +++  W + ++R+ +D +   +DL WF+  L  +I+ ++      GN++   +F+TF        +S+  Q   T+A     K+ +  ++ ++     L S +  + E+FG   +++M +D V+  ++ +HR ++    G+++LIG+VG HLS +C +AL +A I I K++ S   +  D ++S +R  GSE K   +L T+R+L   + LD +NSL+ISG+ P LF  DEM GLL A+  +MKRE  + ++    D ++ F SR++ +LHI+LCLPP   ++  +   YPGIL+     W+ D     LM +A+YF+  H L E    LS       +   LAN+H  VL+           G  + +    +N+KKK+  K  +  +   PYS+L L+E+++     N+N  + ++Y GP T+ RF    R L + K+ E+TQ  + + + L ++ QT+ D   +   I    VKF++    +  LL  L  K T+L  + AK G +  LN  L     +   E+ +D LL   E D+ D EF+++RE +LK R    K       K     K  L ++  QV  WK+KIDR  I+ I+S  NPP LV  V+EM+  LIGK++ + R    ++    +D                   +  + +   RS WK M   M+D VKFVD++ NV W DGL  DV   V+SYLA SKDGQLGV G+ +ML+ ++      K  +  +P+  ++       I+++A KY++ED A LV Y++A+VEY   C PL+ A ++  EL  EIEENE       +E E ++      +   E +   +++E   L+ +++  + ++  +E EL++++ERL     LVE++K  EE+W+   K  +    +   CL ++A+L YCG  N + R +  +F +      GL  ++    K IE+  FL++ ++  +++   LP  +  ++N+ F++ E     W LICD T R I WL         V + Y      +L ++L++CL+ G  +++ DCD+  L  D+      ++  +F   K  FK+++E +HEVEC P FRL+LHT      +P  L + T ++ +  S   +  E L  F++  K  ++ E  +L +EK +  + L +LE+QM D LS+ I  +K +++   +  + K ++E   +  + +    S +K+ + +  IA R A  F     M  +   Y + F++YL+L++  I  SER + K++I+K+T  +   +   + ++++ +++LLL+IE+ ++  +V   + E++ISP   SV + +   F   +  +SK   +KKPFDWM+++   N+++LA+    F+++ + M KD +E  W+ L +S++PE   +   M+  FK      Q+LC+IR +R DR++QAS LFIQN L  KF G + P D+   LR +S S  I++ +   S+E ++   LF    +  + + I   + DYS    +   +Q+Q  M+    I L ++     L       ++I    +E      ++   +I                          T PQ    + +  + +     +D P  +RD L+  F    L  + +   +    P+I HN   L + ++ R+            +  +GF + +  ++ T       IV    +      + SW   RY +SE++YGS +T   D+ ++ +I D+WL+  A++K+FE  +LKY  PS  ++ NV+ + + +A   I+    +  EACHL  N+ T +  ++ +  +++K+      S T+  K                                +T S+     + + EL+EIC  + SK+PK+ T E I ++LKK+     ++  +++EL     +  EI   +Q  +     N LG+++S+  +SV   L   ++P+ W    C+  G S     +    W++ L  +  H E+++   ++K+  YWLGAF  P  LL++ K+E + QF   +RSGN++      E T++DKDH+R+PP +G++++G+++WGC ++K TGEL D   +  C  LPV H+T           D  ++ + Y CP++    A ++P++ + + +EG+ +S+W LRG+  TI P+
Sbjct: 2005 VHSSDGETLILQDQVTLTDGVESWLYKLKESVGKTLHQMNLSIINDCNSGIAMDEWASKYPAQVCRMGMLYHWTKECETGISEVKYDRKALQGTLRKYVSHTSKLSSILSRGAWKGIDEAMLPVHKGRLECMVAQSLFLRDILENLSSRKLREVTDFEWRRSIRCYLHPVDD--KPEPLIWILDNSYDYGNEFYGSDIGVALTPLTERCFLTMSQALKQYHGSSITGPVGVGKTETVKGLANILGNFLGMFHCSTTFNPGSLGKIVQGLAMDGCWGCFDEAQNLNSEAIAVLMECAQKVLLSLRSSILTTSLMEGQDSYGRTGCKYTVLSLRSSILTTSLMEGQDIYIKTTVGLFMTVNPDVTPPRCSLPNELRSSFRTVSLIRPDIGQILKCKCSALGFRAPGILANRLKVLSELVKDQLPHEFHYHFTISSLVGVLKRACQKRRYLRDEKSTEKDKREESRSESVASEATVKLNMPLQSSGPSGMGSLAKLPGQAQTRKAG--TPNPMTAAGKLDHSVVCNTIEEVLGPRMTATDLAQFKVILKEVFNGLPEVPTTRNVLSAKSRGFDLEVALENKAADSGLIATKPWINRCVQLHNLSQVSNGIIVAGAPGSGKSTCIQTLVDALCVQPRGLSRQSHIS-NRSNTSKPIET-----------------------NHKLLRINPLVVDDSSLMFG-YLNQNNDWVDGIFTSACKKANRNMSTTWLCLDGPLIPSWADNFNSVLAGEKVLHLKNGDKLFLSDNVILLFETDSLCDSSPSTIARTGIVYLDKDVVGWKPIAKAWLENRTQQEAHVLQRAFQKCLDPIINFVFHDCKPKLKLCEVGL-FKTCLGLLSAMLADNIEIGGEMHIERMFLFCLIWTFGGLLDQHDRKAFSDLLKTLSSALPDDDHDISVFDYYVDESGEWDPWHSRVPEAVFVDNQDMLGEVFIDSVNSIRTRILMEFAAASGQNVLLVGPHGSGKTSLINEFIDLQDQQTTICKRLVFSGASTASQLQQFIESNIYHRQGFVYGARDNKKLRVFIDDVNLPVP---DDYNVQRSNELLRQLLDEKVLCTLQKPFEWRSIEGLTVLSGMALSDYPGFNNRTISERLLRHFAVFHLPAPQDEALKSIVNGILDSNMTDQDATGLDLDLHNGLVQASCELLTEIQSVLRPTPMPGRYHYLFTLKDITKCFQCLQRLADESKADDLMVISLWKHETQRIMRDRICRTSDLNWFDDKLDKLIEKIFPK--LEGNLH--EHFVTFPI------DSRMYQRPMTSAPSKQIKVNLQPIDKLSDIHTCLNSHLTRYNEEFGNVRLDIMLSDYVIAHVVKMHRILSFHHGGNMLLIGAVGCHLSTLCKLALHVANIGIHKVDNSKQSSFFDGLRSAVRMSGSENKIITLLFTSRDLSEPVYLDAINSLLISGEYPHLFSNDEMEGLLQAIHPAMKREFPTMSV----DPMKYFVSRVKCNLHIILCLPPNYTLLQSASELYPGILNGCQSIWMCDWPHEGLMGEASYFITKHQLTEEFENLSV-----GVTSCLANIHSFVLRDCKQMPWAGELGPDINMTMFRVNEKKKDQLKLSTVKVPNLPYSKLILQERIKLNHRDNENPGKNEVYVGPTTYRRFKESFRWLYNIKSKERTQVVEQLKKVLGTLDQTRVDSKIMKKAIKSTNVKFDDARKNTANLLHQLTMKATVLEKLKAKVGLSKSLNAYL-HLTELEADEIEEDELLKQEEYDDYDAEFDKMREANLKTRHIQAKEEYTLAVKAVEDCKHRLEHSKSQVTEWKNKIDRSCIETIRSMSNPPMLVGQVMEMVMTLIGKRLPSQRIVEVREHTGKEDMSSRISSSSSSTKHLVKKSKQKEGERFDRSVWKGMLLTMSDSVKFVDMVRNVPWEDGLPEDVLRAVESYLAISKDGQLGVYGDASMLDTSD------KHKRTPSPDGRQA------GITIAAAKYSNEDCATLVNYSIAIVEYCRLCSPLKAAKERQQELAREIEENERKQRQQEEEPENDDQPNAVDENLTEDDLPRIQEEENGLQRKFDEAVMEKHSLEMELQSMNERLKAATELVESLKGQEEEWRQYVKDNDSNELLLANCLTAAAFLTYCGATNIDTRKRMGEFSMQVCEHHGLPLHKQLLFKNIELIDFLYTPLDEMELKIMQLPTTQLMLENSCFLMQEETTTAWPLICDPTSRVIEWLKLRFQSKGLVEVKYHALRSQELRSQLDNCLSEGIPLLVTDCDVVALKTDKRFHDTIQNCRQFTSGKTRFKVIVE-DHEVECEPGFRLYLHTTVEPHVVPQKLAAYTSVLYYQQSRYCVEEELLDTFMKHEKSRLENERIQLRQEKFENMKLLDRLEKQMKDLLSSDIVLLKDLQSTKRLADFKKQFDETLESQYRIDISVESIRKAREGFRSIAQRAAVCFDTTQYMREINPLYQISFKQYLSLYEGAISHSERSAIKAVIEKITSSSFFSTARGLLEKDRQIYALLLAIEVEESHGHVGPGEREFIISPNFGSVVMSA---FTAGHSVDSKVLQAKKPFDWMTDDQFHNLQVLASHFDWFQEMFDRMPKDGRETQWRNLCESDNPETVPLPDKMDEFFK----PIQRLCIIRAIRSDRLLQASTLFIQNVLGKKFFGEI-PLDLPSLLRQSSTSIPIILLF---SFEGDLASKLFTDFANRKQAKSIVINLTDYSPATDKYVKKQIQKAMAEGSWILLHNAHNAGGL------LLIIEQLLSEGSQQCDQQFRLWISSQ-----------------------TTPQI---IPNRLLQQSVKTVIDTPKTMRDSLVRSF--ASLDYDVLKQGNRAEWPIILHNLCYLHATIQLRARFGQGGWNCPQDFKQIGFIELQEGLRFTASEFKDPIVSVGADGSNVTRSTSWTGARYILSEVLYGSHITDSYDQQSLCAIVDYWLSPQAIKKDFEVARLKYRVPSAFFNTNVRLNTLIQALDGINHHYLDVPEACHLHPNVETLLGDDQYIFTRLNKIFDAMPSSPTLTHKLFPRPPTPFKGPPLAGISSQSNNPSVVGQGVFATASYATFKMRKDVELWEICHTMLSKVPKAYTKEFINDKLKKIGGFTPFNNFIVRELETMYKLLTEIKGSMQAIKLATETNILGDQVSNHILSVADDLYHFRIPQIW----CDMSGVSAPPLTWGLGQWLTELQNRCYHFEKILTLGREKMPAYWLGAFFNPRGLLSLLKQEYTKQF-SGERSGNFEQFTFQTEVTSRDKDHLRDPPHEGMFIYGIYMWGCAWEKTTGELQDAPPRTSCATLPVVHLTCLPVTEKHGAQDSTKSYETYQCPVYNSRIASRDPVMEMDVRREGVAASRWALRGLSATIRPY 5272          

HSP 2 Score: 856.67 bits (2212), Expect = 0.000e+0
Identity = 593/1940 (30.57%), Postives = 1000/1940 (51.55%), Query Frame = 3
Query:   78 MDERHWWLATRVNESLTDKIKSNVSELETAFLEFNNSNCINSFFDEDGPLVLYFAKCINS-----SLKSVHVSSEIKDLNDKSLFPSEKLTILLVIK-KRXXXXXXXXFENELFCIELKNYILQNITTIFTHGFIPLLMTK--YNSCDNTEKIYPLTSQLNSMWQSVQNYTDQLYLNTNMEEPIHATIDLNK-ELQDP-------LKQFETFVTDVMSEIEVILEEVND-RTSEQDIFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIRRQILSIINNKIQAIVGFNQAPED-LWKRVQDEICEGSIESFLNMSLSQVKIILPK-EDLLSNVEAFNSILHNNEIRTNTILGLLKFSNIIHDIFLENVTNLRETL-NVSN----------------------STKYSLHVPNKSTENINITIPRFDQASENGIGIYDDNKIFSNWLVINGEVKKFIEICNHQLKFEKILSMKMVRISTLKFDII---------HLLEKASKTQNAMQ----YSHKTVN---------SSDDEPEENNLSDGSEEESSAIKQNWSYSTL--------ASSRDSLEWLLNLSTENTAD--VSLLEVINKTRSLTLSNMTSTF--NILEITNLDRSSLTDNMHIGKTSEMHEEIMNNFDKTFSIFLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAV---IGNLESIINQVAGMHSEFSKLLKYLATQKIYNFNHLLSKNWDSNEFTEAINKDLLAKKSTVQRTLEACSNILKEITEIISIVEKLDPNSSLYESE----------------------------DLIFGQMKEMYNKSLSQSLYRSIINNLVYLAICSNCQKEHLELLTSRAEYD---------------PVTGINDNLCSSYGEEVFCINDIKPIYDSDHAESKTLIKFILLVKYEIPMIKFEPELDAIQSIIEQMGQDIMAFHNDVSDF-SGRKLNLYIKLESD-LFYEFSQIISLKYSESRLKLQSTVENLNEFDFLWKMTSDKL--DFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASK---------EIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDL 5492
            MDERHWW+A ++ ES       N + LE    E    + IN F    GP  L+F  C        S + +H +  +  L D  L   + +TIL  ++ K    +  S  E ++FC ELK+  ++ + T+ +  +IPL+  +  +  C N E    L   ++    ++   T  ++ +  +   +   I LN  +LQ         +  +E  VTD M+ IE I+ + +D R  + +   + E+E+W+ R  LL +L  QLK K  K  IG L++ KS+++++W+ ++  IT+A+N++KDK+KYLE+ +     +   A+  S +   +P +   +KQ ES SR + R G +G  L+ +  QI+      I+         ED LWK+V  EI   +    LNM+  Q K++  + E  L    +      +  +   ++ G L+    +   + E + +LR++L NV+N                      +T  S+  P  S     +++  F     +G+ + D++ I S++    G +++ +++ N   ++ +++S+        K D++         +  +K ++ + A +    YS   V           +  E EE    D  EEE   I  N     +          + + L  +     E+  D   S+  +I +     +SNMT +   N+   T LD  S  D          +  I+   +K  + +++ +F+R M+T + L I++KF  ++ R  I+G I  K  E+F  ++SD+    + Y++ K+    +     V   + W ++LL  IE PM  F+DIK VTQ+ EY  IV+ YN+++  L++ +S +   W + +D   + L+  L V     N+V +NS E +L +I+E + + R+  Q+  +AM +++ E R K +   L   +N + +V +SI   +  LF  HI+ V Q  Q G ++L+W ++NID FLH++      + NLE  +N++  M ++   ++  ++   +Y+     S+ W   EF + + + +  +   + + ++     L+ +  ++S  +K++   S  + E                            + +  ++   Y+  + +++  S+  +L  LA  S C  E L  +T  + +                P + +   L       +  ++++    DS      T ++F + VK+ IP I  EPEL+ +Q  I  +   IM  + ++S   S      Y ++ +D    +  Q +S    E    +   + + + ++FLWK   D +  +F E +A      ++K ++ + L ++  +  +P  + +  + + T   +  L      W+ K    LH+EAK+ LD A  YRE V + L+Q V  L+QLN  L +L+ + D++ KID++Y PIE+MY+ L  FEL + R+E  ++  LR+ W  LI++A+  R  LL E+R  F QELDKQ+K F VEVIQFRN FD + P++ G  P E   +L+ F+N+Y+ Y+ K+ TL ++SKLFG+  + F EL+   E+L LL+QLY L+QKF KF+  F D LW+ VDL+   ++   +WDECLALPSKLK+ ++Y +LK K+   +++  +L NLASK         EIRNRHW+QVMQVTG++FQLEA  FK   L  I L++ K EI+ IC  A +E+ELE+K+ Q EEEWTEQVL F+ + +RG + L+  FT  LL+QLED+Q LL  M  SR+I P++DEAA WA KL E++EVL+LWLEVQ +W  LE VF N + +K+L QE KRF R+DK + K M+R ++T+NV QCC   E  K   L+++Q+ LE CF SL  YL  KR  F R +FV D+ +LSIL+  ND++++  HL SIF+ ++D+
Sbjct:    1 MDERHWWIAGKIQESFKIGGYDNPTLLEDFMCEETTLSLINKFLRSGGPCRLFFY-CERPENGLLSTRELHSTGNLAALKDVEL---DSVTILYFLRNKTEKDVDPSRMERDIFCGELKHNTIETLNTLLSDIYIPLIRAQKDWGQC-NEEGQSNLIQNMDKFVTALNETTASMHSSKQLMLKLPENIVLNDFKLQRAAALDSQIIGDYEELVTDWMNTIETIIVDTSDERFMDPNAGPLSELERWRRRQRLLTSLTEQLKSKECKAVIGVLITAKSRLLRRWKIIDVGITDAMNDTKDKVKYLESLRRHFDQLYNDATPHSIMNTAIPGLTNSIKQMESISRYYGRVGFLGIVLAKVTNQIVLACKEHIKECTMNIVEDEDYLWKKVSTEINRDN----LNMTDPQQKLLRSQIESKLKGARSKGKESKDIGVIDKSLYGRLRSCLTLQSFYREALRSLRDSLGNVTNLSHFSSVSSFVGASLMSSRSKQTTATSMSRPTLSPSKKTLSL--FGDNVGHGVPLTDEDAILSHFDSFCGRIRQLLDVMNTMSQYSRMVSVSTGIPRPRKEDLVIEEPEQDEKYRYKKEAQEKKAQELKEEYSKTPVLDLNIDRNQLGAIAEDEETIDDDKKEEEGKKISHNDHGDEIFDVVNTKNGLTEEELAIIRRYYNEDDEDEGPSISSIIEEQ----VSNMTKSMSENVTTKTLLDVES-KDKEKFDHHYNSYINIVQELEKFLAAYMHAIFVRKMKTQQGLEIITKFAPIQSRPGIRGTISDKFVEVFNWYESDLEDVQKIYEKNKDHPLTVRNAPPVAGAIYWSRQLLKRIEDPMKVFRDIKAVTQLTEYGRIVRIYNRLATALVTFESLWFTQWKNRIDLAKSGLRATLFVYHPDTNEVVVNSDERVLELIHEAKWLTRLDIQIPESAMNIMQQEERFKSYKGHLELVLNEYRSVCESIPESLRDLFTPHIENVQQQLQPGLNTLAWNSMNIDAFLHQIHTATSKLQNLEEKVNEL--MDNKVLGVIGTISQFYLYDSQLAFSQTWSPVEFRDKMLEGIEDRSQQLHQYVQTVVEGLQSVANLLSTKKKINGTDSKKKGESGRNKDKKMMLIIDEEEVQREKEKAVLEEALVYKLIAYYHDQVYEAVLSSVCRSLSTLADASGCTVEQLRPITPGSTFSSEGTISPRPGSRRDTPYSRLGSALSDRPDTGMSMLSNMTWSGDSKDPSEVTHLQFEIQVKFNIPNIIVEPELNVVQKAITDVSNAIMQANKNISWLGSHGDEEFYPEISTDDTVIQLQQQLSSVIEELENYVHKHLYHFSYYNFLWK---DDMHGNFHEFIAADPGIVAIKREVERFLSIEKKVLNIPTILPVGSVCLYTDPIKDALHGFAMAWKTKFATVLHEEAKKKLDSAVSYRENVKKRLEQFVQSLDQLNSSLHLLEDLRDMENKIDAVYLPIETMYSKLREFELRLPRNEVEQVDELREKWQELIELADQVREVLLKERRGAFEQELDKQVKTFVVEVIQFRNAFDAQGPAVPGIPPAEAVSRLQDFQNRYTQYDAKRKTLDSVSKLFGIPCKPFPELDKTGEELDLLSQLYGLFQKFIKFDNKFRDTLWADVDLEAASMETETYWDECLALPSKLKDWDAYNDLKTKLQTYLEVFPLLHNLASKKKDEHFQLTEIRNRHWLQVMQVTGSSFQLEANVFKLCHLLDIELIKYKSEIEDICRGASRELELEIKMRQTEEEWTEQVLNFEHYKKRGPMYLDKAFTERLLEQLEDAQALLAGMLTSRYIGPLRDEAASWAEKLKEVAEVLELWLEVQDVWQYLEAVFSNSLAVKELPQEAKRFSRIDKGWTKMMKRAFDTRNVLQCCYGGEVPKGVVLRHMQEELEICFKSLVIYLDNKRKAFPRFYFVSDTILLSILSRPNDLESVRPHLRSIFSQIHDV 1919          
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Match: K1S1H2 (Dynein beta chain, ciliary OS=Crassostrea gigas OX=29159 GN=CGI_10024919 PE=4 SV=1)

HSP 1 Score: 1450.26 bits (3753), Expect = 0.000e+0
Identity = 1002/3398 (29.49%), Postives = 1723/3398 (50.71%), Query Frame = 3
Query: 5535 IFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSH-LAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKK-IRDVDDFELYKIIKM---KTTVMDSVGNQKFQLATLTCTHDL-------------------GYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGS---YEVGQTTGGSTLMEFWPSFVERKIKSPT--SSFIK-------QKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHL------MEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIE----------VIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQ-LTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILD---NHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLATNSSADL----LDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLL--LQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFIT-FSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREY---LVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN-HSLNEIDLYLSEEKDKDQLAQYLANLHKEVLKFTVTPSIVS--GKSVKIGKIIMNDKK-KEIYKYDSTSLA--PYSQLFLRE--KLRNLNDNSIQK-KIYNGPCTFHRFLYILRRLLHQKTIEKTQSTQTISRALNSIKQTKHDITTINNLISHQKVKFNEISIKSQQLLKTLINKVTLLRIILAKKGDNSYLNEILIKNANISVSELYKDPLLIDAERDELDDEFERIREESLKNRKNIIKGTLEKTRKEYFALKKDLAYATEQVCYWKSKIDRQVIDRIKSFQNPPSLVIDVIEMIFILIGKQIQN-----TRKDSNADDDETNDEKSNA------------------RSRWKRMQQFMADPVKFVDIIHNVSWTDGLNPDVYNGVKSYLATSKDGQLGVTGEGTMLNQAENVNIKAKKNKQMTPELSESENLINRSISVSATKYASEDXXXXXXXXXXXXEYTEKCEPLRQALQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEE--FENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSK-IEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSDLHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSERLSN-KSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPS-SVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDS--ESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLN--------LKFKGTVTPSDIRLSL----RATSPSSAILMKYLNNSYETNILFNQIHSSVKPRIIQSRVIDYSKEGLQLFYQQLQNQMSNIHEICLDSSLTTSNLTALNSVYIVIHLSSTEHISSIHKRVMSYIDEMNSFQRSALLKSRDQNVVTYNLFFTLPQNHSGVSSSQMNKMTTVYLDYPSNLRDFLLH---LFKIGFLSANSIPSMSLDLLPVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWF------------ESHSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISF--------------QIDLTKVEN-------------------------ELFEICKNLASKLP------KSTIESIQERLKKVTNNF-IYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNE-LGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHI-TFTLNDLDKPE-NSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGVFITINPF 15185
            + SS  E I L+ K+ + + V  WL  L + + +++  L  + I+  + G  ++E + K+P+Q+C   +  +W+ E +  + E+K D+K+L     KK+    +++   L + +W++ ++P+  L + RL SM    LYLRD L N+  +K +R+  DFE  + I+         ++V  +   + T     DL                   G EF G+   +A TP TE+  LT+  +L + + S + G    GK+  ++ LA +   Y     C +     ++   + G A +GCW   D V+ ++   +S  +  +  +  A++ +    ++ + + I ++       T           LP ++   FR+V++  PD   ILK  C    +R    L  RL  + + A   +        ++ ++V  L +A+  K+  I  EKT      +  +T+   +     PS +    +S T  SS IK        +   TP  L+ A K EH LV + I EI+ P  T +N K  K IL D F G  D  + +    IP         E  L++ S+   L      +E+  QLYN+ + H G+I+ GP  SGKS+ +   + AL+         SN    S ++  Q S      +   +    H +  I PM  +  S MFG +     D+ DG+FT   R+ NRN   +W+  DG + P W+ N   IL+ +  LHL +G ++  S N+  +FE +++ +ASP  VSRSG+VY   +++GW+ I   WLE++   E          V  L + F K LDP+ Q+++   +     S+   F+  L +LS ML +N EIGGELHI+RL++FC IW+    +   ++++ + +LK  +  LPDDD  IC+FDYYVDESGEWD W+S L  E  Y   Q + GEV V ++ T+R +  ++  + + LNV L+G  GSGK+ +++   ++  + D  A    R V+S  + + QL+SFLE+NI HRQG +YG K+ K L + I+D+NLP P + D   ++R NE+LRQLL+  ++   + PFE   +   +II +++ +  A +    L  RL+RHF    +  P+   ++SI+ G+ + ++   +   + ID  + L+ A+ +L + + +VL+ S   GR H  F L+ I      +K    +S + E L+  +  W +   R+ +D L   +DL WF+ T+Q II+  W         N + +F+  F T    +R  +     R    +    I V +  I + R+    L + +  + E+FG   +++M +D ++  +I +HR ++    G+++LIG+VGSHLS +C +AL +A +PI K++TS      D ++S +R  GSEGK  A+L TAR+L+  + LD +NSL+ISG+ P LF  DEM GLL A+  +MKRE  S ++    D ++ F +R++ +LHI++CL P N ++  S ++YPG+LS  A+NW+ D     L+ +A+YF+  + L E    LSE     ++   LAN+H  VL+            + + I ++ +  KK ++I K+    +   PYS++ L+E  KL++ +DN   K + Y GP TF RF+   + L + K+ E+T++   + R L+++ QT+HD   +   I     KF +    +  L+K L  K T L  + ++    + L E  +K       +  ++ LL+  E D+ D EF+++RE  LKNR+ + K    + +K     +++L YA +QV  WK K+DR  I+R++ F NPP+LV  V+EM+ ILIGK++ +     TR+ +  ++  +    S++                  R++WK MQQ M+D  KFVD++HNVSW DGL+ DV   V+SYLA S++GQLGVTGEGT+L+ A+     AKK    TP    +     + I++++ KY+SED A LVQY +A+VEYT  C PL+ AL+K+HELE EIEENE   ++S +E           + +  E     L+     L+ +++  + ++  +E EL++++ERL     +V+++KP E  W+   K+ +    +   C+ +SA+LAYCGP + + R +  +F +      GL   R    + +E+  FL+  +++ +ME+ +L   +  ++NA F++    +  W LICD T R + WL  +  +   V + YS++ ++ E+CLA G  +++ DCD  QLA+D+  R   +   +F+  K  FKI +E +HEVEC P FRLFLHT      +P  L + T ++ F  S   +    L RFI + K  ++ E   LL+E+++    + KLE+ ML+ LS+ IR +  +     + +  K Y+E   + ++ E   ++N ++ +   + A R A  F +   +  V   Y V + ++  L+DS I  SER    +  ++K+T          + + ++F+F+LLL+IE+  +  N+   + E+L+SP+ S  + +   F +  +SK    KKPFDWM ++   N+++LA     F++  E M KD +E  W+ML D+  + PE   + +++        ++L ++R +R DR+MQAS +FI   L           + G      + LS+     A  P S + +  L       +L+     S +    QSR +D+S           + Q   +     D+S  T +     ++   I   S  ++ + H    +  + +NS +   + K    N   + L+     +   +    +       +D P  ++D ++     F+   L  +S P   +    ++HN   L + ++ R+ +   G+   +    I   S L E +  + N F            ++  ++S+N +RY V+EI+YGS VT   D+ ++ ++ DFWL+S A++++FE   LKY  P   ++PNV+ + + +A  +      +  E CH+   ++T +  ++ +  +++KV  ++    T+S               Q  ++K  N                         EL++IC +L  K P      KS  E + E+++K+  ++ I++  +MKE  +   +  E+ N +   R    N  +G+++SD  +S    L   ++P  W            Y+   W+  L  +++H E+++   +  +  YWLGAF  P  LLA+ K+E    +   DRSGN++      + T +D  H+ +PP +G+Y+HG+HLWGC  +K T E  D + +    PLPV H+  + +N  +KP      + CP++    A ++PI+ I I KEGI   +W LRG+  TI P+
Sbjct: 2093 VSSSDGEMIFLHEKVCLNEGVEVWLQRLRDSVAKTLRELGINIIQDCNNGVMMDEWAYKYPAQVCRIGMLYYWTRECDQGIGELKYDRKALQQNTLKKYQASTAKLTTVLTKGAWRTLEEPMLPLHKARLESMIAQSLYLRDILENMCNRKSLRETTDFEWRRCIRCYFHPVANDENVDTESVDIKTEASLSDLSIQDKYEPLIWILDTPYIYGNEFYGTNAGVALTPVTERCFLTMSQALNNYQGSCVSGPVGVGKTETVKGLATVLGHYIGTFQCSTESDTSAMGKIVQGTAMDGCWCCFDEVQSLNKQAMSTLLDQMTAVITALRSRHPYATLSDGQEISIKKTFAVHMTYNKETAPPGCSLPIDVRSLFRMVSLVKPDFSLILKAKCAAMGFRAPAVLGARLKALTELARDELPPECHHHFSVATLVGVLKRATQ-KRKFIRDEKTVDRLEAKDRETSRSDSQASEAPSKIANPQQSVTVASSGIKMTTGAGMSRKTGTPNPLTMAGKLEHALVAQTIKEIIGPRFTDQNMKIFKHILNDIFAGLPDPPTVH---QIPSARSRGFDVELVLKQKSVDKGLVAHDPWIERCKQLYNISKVHHGVIVAGPPGSGKSSCIQTLVDALS--------LSNQAGTSRQS--QGS-----RTTGNIQENQHKLIKINPMVVDDCSLMFG-YLNVNNDWVDGIFTSACRKANRNQSTTWLCLDGPLNPGWADNFNPILNGDKVLHLKNGDKMFLSDNIIVIFETDNLSNASPASVSRSGIVYIDKDVLGWKPIADAWLESRSPQEIHEEMAHQLLVSVLQRAFAKTLDPISQFVLNEARPRLSLSLVGMFKTCLGLLSSMLANNNEIGGELHIERLYLFCLIWTFGGLLDSADRKSFSDILKNLSNALPDDDRDICVFDYYVDESGEWDPWTSKL-PEAVYADNQDMLGEVFVPSVDTIRTRNLMEFASFSGLNVLLVGANGSGKTKLIEEFIDYMERLDPQAAVWKRLVFSGASTAKQLQSFLESNIYHRQGFVYGAKDKKKLKVFIDDVNLPVPDDYD---VQRCNELLRQLLDDKILCKLQKPFEMKTVEGLSIISAMSMSEQASVSSRQLSDRLLRHFAVFNLPTPQDDAMKSIVHGILDVNMTDGDRPGLDIDLHNGLVKASCELLKALQNVLRPSPMHGRRHYLFTLKDITTCFQCVKKLPEESRADETLIPVISLWRHEMHRIIRDRLSRTSDLIWFDTTIQEIIEQTWP--------NLKESFLEYFVTFPMDARLYQ-----RPVTSVGTKHIKVTLQPIENLRDVHSCLNTHLTRYNEEFGNVRLDVMLSDFIISHVIRMHRVLSFHHGGNMLLIGAVGSHLSTLCKLALHVADVPIHKMDTSKRSNFFDGLRSAVRLCGSEGKILALLFTARDLEDPVYLDAINSLLISGEYPHLFTNDEMEGLLQAIGPAMKREFPSLSV----DPMKFFVARVKSNLHIVMCLQPMNSLLKLSASQYPGMLSGCAINWMCDWPQEALLGEASYFITRYQLTEEFENLSE-----KVTSCLANIHSFVLRDCAQLPWAGDLSEEININQVKVEKKKDQQIVKFLPAKVPNLPYSKVLLQERIKLQHRSDNMKAKNETYVGPTTFRRFMETFKYLYNLKSQERTETVDQLKRVLHTLDQTRHDAKIMKKAIKTITSKFEDAKKTTSNLMKQLTTKATALEKLKSRVTQGTDL-EAHMKLYMTESEDEEEEELLLQEEYDDYDKEFDKMREAKLKNRQAVAKDEYVQAQKTVEECRQNLEYARQQVIIWKGKVDRACIERLRGFGNPPTLVGQVMEMVMILIGKRLPSQRLYETRELTGKEEMSSRMSSSSSSTRIGVKKGKKDGSDKFDRAQWKAMQQTMSDTPKFVDMLHNVSWEDGLSDDVLRAVESYLAVSREGQLGVTGEGTLLDHAQETTFAAKKR---TPSPDGT-----KGITIASAKYSSEDCATLVQYTIAIVEYTRLCGPLKGALEKLHELEREIEENERLQKESQEEVREERSPTPEPEPDYVESDLPGLQDTVNSLQKQFDQSVVEKHSLEMELQSMNERLKAATEMVDSLKPQEASWRKHVKENDCNEMLVANCVTASAFLAYCGPASIDVRKRMGEFFMQVCEFHGLPMPRNKLFRNMELITFLYKPMDVIRMETMHLSITKLMLENACFLMQRDSMVAWPLICDPTSRVLDWLRNFYGNTGLVEVKYSEIRSQFENCLAEGCPLLVTDCDTKQLAKDKRFRDAIQSCKQFINGKLKFKITVE-DHEVECDPRFRLFLHTTVEPHIVPRHLAAYTSVIYFQRSRADIEETLLDRFIFQEKSKLEEERVSLLQERKENLELMEKLEKSMLESLSSDIRLMNELPATKKLAELKKQYDETLDSQERVESNEATNTRNRELSREFARRGAVCFHVMQYLREVNPLYQVSYHQFQQLYDSAIAHSERAQRAEETLEKITHMAYTTFARGLLERDRFIFTLLLAIEVEDSLGNIGPGEREFLVSPNYSAVVMTKLGFTQPPDSKIVQMKKPFDWMHDDQFHNLQVLATHFEWFQEKFERMPKDGREMEWRMLCDNVEKEPENMPLPDKMDSKDFAPMKRLLVVRAVRSDRLMQASTVFIHRVLGKNILQGPEQDYTGYYGDMGLDLSVMYKQSAPVPPSTLSLPIL-------LLY-----SFEAEAAQSRFLDFSG----------RRQAPRLMVTITDNSQATRS-KVRKTIRKAIAEGSWVYLHNAH----NAPNVLNSLESFLVEKP---NPEGFRLWVACQADPEVIPVRLLQNSIKAVVDTPKVMKDSMIRSFSWFEPDILKQSSRPEWPV----MLHNLCFLHAAIQLRARFGQGGWNCPQDFFNIGY-SCLQEALAIVQNEFKEPLTSVAPDGSQNSRSVSYNGIRYMVAEIVYGSHVTDFYDQQSLCAMVDFWLSSGALKRDFEVKGLKYRHPQAFFNPNVRLNTLIQALDSAPNHNLDVPEGCHIHQTIVTLLGDDQYVFTRLNKVFDSMPSTLTLSHKMFPRPPTPFDGPAQAGISKTSNNPSVVHQGVFSTASYATHKIRFKDVELWQICNDLLQKTPKIGNSSKSFREFVVEKIRKLPGDYPIFNDFIMKECEILHQLLTEVRNTLTTIRNACENNVMGDQLSDHYLSAADDLYHLRIPRIWCKMTGTTAPPYTYNAAQWLRDLEDRWKHFEKILSMGRKAMPAYWLGAFFNPRGLLALLKQEAIKNYC-GDRSGNFEQFTFQTDTTFRDFGHLLQPPPEGVYIHGIHLWGCSIEKTTNEFQDQASRQGYAPLPVLHLQCYPVN--EKPALQEPSFQCPLYASRIAPRDPIMEIDIKKEGIPPMRWALRGLTATIWPY 5396          

HSP 2 Score: 517.309 bits (1331), Expect = 1.556e-142
Identity = 296/732 (40.44%), Postives = 445/732 (60.79%), Query Frame = 3
Query: 3390 TLIKFILLVKYEIPMIKFEPELDAIQSIIEQMGQDIMAFHNDVSDFS--GRKLNLYIKLESDLFYEFSQIISLKYSESRLKLQSTVE----NLNEFDFLWKMTSDKL--DFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVY-ETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQ-IDKI-FSSSR 5552
            T ++F + V + IP I  +P LD  Q  I  +   I+    ++   S  G + N Y  +  D   E  Q ++ + +    +L+STV     + + ++FLWK   D L  +F+E +       ++K+++ + L+++  +  +PK + + C+ + T   +  L      W+ +    LH+EAK+ LD A  YR  V   L+  V  L+QLN  L +L+++ D++ KID IY PIE+MY  L  FEL + R+E  E+  LR  W  L+ +A+  R  LL E+R  F QELDK +K F VEV++FRN FD + P+   + P +    L+ F+ +Y +Y+ K+NTLV++SKLFG+  + F EL+   E+L LL+QLY L+QKF +F+  F D LW+ VDLD  +V++  +WDECLALPSKLK+ ++Y +LK  +   +++  +L  L SKEIRNRHW+ VM VTG  FQLEA  FK S L  I L+++K +I+ IC  A +E+ELE+K    E+EW EQ+L F+ +  RG + L+   T  LL+QLED+Q LL +M  S++I P++D+ A WA KL +++EVL+LWL+VQ LW  LE VF N +  K+L  E KRF R DKS+ K M+  Y E + V QCC  +E  K   L+N+QQ LE CF SL  YL  KR  F R +FV D  +L++L+  ND++++  HL SIF+A+ D+  + A   P +  D+I F+ SR
Sbjct: 1251 TYLQFDVEVGFNIPNITLQPSLDVAQMAIADVANAILESTRNIDWLSLYGPE-NFYGSISQD---ENVQEMTSQVAAIVQELESTVNKHLFHFSYYNFLWK---DDLHGNFKEFIMGDPGMFNIKKEVERFLYIEKKVLGIPKVLPVGCICLRTDPIKDALHGFAMAWKIQFASVLHEEAKKKLDSAVLYRSNVRNRLELHVQSLDQLNSALQLLEELRDMENKIDGIYLPIETMYEKLREFELRLPRNEVEEVDQLRDKWVELMDLADQVRENLLKERRGAFEQELDKNVKAFVVEVMEFRNAFDSQGPNTPNTPPAKAVASLQEFQQKYKLYDSKRNTLVSVSKLFGIVCKPFPELDKTGEELDLLSQLYGLFQKFIRFDTRFRDTLWADVDLDAAFVEVEGYWDECLALPSKLKDWDAYHDLKTSLQNYLEVFPLLRKLNSKEIRNRHWLDVMNVTGVKFQLEANVFKLSHLLDIGLIKHKADIEEICLSASRELELEIKQRVTEDEWNEQMLTFEHYKNRGPMFLDKVSTERLLEQLEDAQALLASMLTSKYIAPLRDDTALWAKKLKDVTEVLELWLQVQDLWQYLEAVFSNSVTAKELQLEAKRFARTDKSWTKMMKTTYFEMRGVLQCCTGDEVPKVNLLRNMQQELEICFKSLMEYLDNKRRAFPRFYFVSDPVLLAMLSRPNDLESVRPHLKSIFSAIYDVKLEEADTGPDEPTDEIGFAQSR 1975          

HSP 3 Score: 300.056 bits (767), Expect = 7.873e-77
Identity = 266/1119 (23.77%), Postives = 515/1119 (46.02%), Query Frame = 3
Query:   78 MDERHWWLATRVNESLTDKIKSNVSELETAFLEFNNSNCINSFFDEDGPLVLYFAKCINS-----SLKSVHVSSEIKDLNDKSLFPSEKLTILLVIKKRXXXXX-XXXFENELFCIELKNYILQNITTIFTHGFIPLLMTK--YNSCDNTEKIYPLTSQLNSMWQSVQNYTDQLYLNTNM--EEP---------IHATIDLNKELQDPLKQFETFVTDVMSEIEVILEEVND-RTSEQDIFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIRRQILSIINNKIQAIVGFNQAPEDLWKRVQDEICEGSIESFLNMSLSQVKIILPKEDLLSN-VEAF---NSILHNNEIRTNTILGL--------LKFSNIIHDIFLENVTNLRETLNVSNSTKY-----SLHVPNKST-----ENINITIPR----------FDQASENGIGIYDDNKIFSNWLVINGEVKKFIEICNHQLKFEKILSMKMVRISTLKFDIIHLLE-------------KASK----------------TQNAMQYSHKTVNSSDDEPEENNLSDGSEEESSAIKQNWSYSTLASSRDSLEWLLNLSTENTADVSLLE------------VINKTRSLTLSNMTSTF--NILEITNLDRSSLTDNMHIGKTSEMHEEIMNNFDK------TF-SIFLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAG-MHSEFSKLLKYLATQKIYNFNHLLSKNWDSNEFTEAINKDLLAKKSTVQRTLEACSNILKEITEIISIVEKLDPNSSLYE 3125
            MDERHWW+A ++ E+       N + LE    E    N IN F    GP  L+F+ C  +     S + ++V+  +  L D  L   +K+ IL  ++ R         +E ++FC ELK+  ++ + T+ +  + PL+  +  +  C N E    L+  ++    ++   T  ++ +  +  ++P          H    L+ +L   + Q+E  VTD ++ IE +L + +D R  + +   + E+E+W+ R  LL ++  QLK K  K  IG L++ KS+++KKW+ +++ IT+A+N++KDK+KYLE+ +     + + A+  S +   +P I   ++Q +S SR ++R+G +G   + I  Q++      I+         ++LW R+++EI           +   + ++ P++ LL N VEA       L   + +    LGL        LK    +   + E + +LR++L  + +  +     S+  P   T      N + + P               + +G+ I D++ I S+       +++ I++ N   +F K+ +  +      K D++   E             KASK                T  + + S       D+E +++N+S+  E E    K+    +    + +  E + N    N  ++S+L              I+   S  L  MT     N+   T LD  S        K  +  E+   NF +      TF + +L+ +F+   +T  AL I+++F  ++ R  I+  I  K  E+F  ++SD+    + Y+  KN    +     V   + W ++LL  IE PM  F+D K V Q+ ++  IV+ YNK++  L++ +S +   W + +D+    L+  L V      ++ +N+ E +L +I+E + + R+  Q+  AA+ +++ E R K + S L   +N ++ V ++I   +  LF  H   V Q  Q G S+L+W ++NID FLH++ +    L+++  +VA  M  +    L  ++   +++ +   ++ W   EF E + +    +   +Q  ++  ++ L+++   +++ ++ D  S+  E
Sbjct:    1 MDERHWWIAGKIQETFKIGGYDNPTLLEDFMTEETTLNKINRFLKAGGPCRLFFS-CAKADSGELSTRELNVTGTLAALKDADL---DKVNILYFLRNRVDKDVDTVRYERDIFCGELKHNTIETLVTLLSDVYNPLIKAQKEWGEC-NMEGQTNLSHSMDKFLTALNESTASMHHSKQLMLKQPENIVLNDFKQHRAAALDAQL---IGQYEELVTDWINTIETMLNDTSDERFMDPNAGPLSELERWRRRQRLLTSITEQLKSKECKAVIGVLITAKSRLLKKWKNVDAQITDAMNDTKDKVKYLESLRRHFDQLYQDATPASIINNAIPGIVNSVRQMDSISRYYARTGFLGIVFTKITNQLVLACKEYIKNCTITAYDGDELWVRIKEEI----------RNRDSLPVVDPQQRLLRNQVEAKIKQQGALTRGKTKEGKDLGLQDDSLYGRLKACLTLQGYYRETLRSLRDSLGQTTNMSHFPSLSSVGGPGSFTTRSKPSNASRSGPSVSPKKGISSLMTNEAGHGVSIADEDAIMSHMDSFCNRIRQLIDVINTLAQFNKLATSTIGVPKPRKEDLVIDDEDSDEYKYRKFRENKASKLEYEDENGDDRMTITVTVASPERSGLRAIKEDEETQDDNISEIQEIED---KKERPPTQPDHNDEVFESVNNNKGLNENELSVLRRYFPEDEEEEGPSISAIISQHLQQMTQAMSDNVTTKTMLDVES--------KDKDRFEDYYTNFAQIVSDLETFLAAYLHAIFIGKTKTQHALDIITRFTPVQNRSGIRACISEKFVEIFNWYESDLDEVHQIYEAHKNNPQLVRNAPPVAGAIHWSRQLLKRIEDPMKIFRDNKAVNQLGDFGRIVRIYNKLATALVTFESLWFTQWKNRIDHARNGLRATLFVHHPTTEEIVVNADERVLELIHEAKWLTRLGIQIPDAAIAIMQQESRFKSYKSHLELVLNEYKEVCEAIPEPLQKLFTAHKDHVEQQLQPGLSTLAWNSMNIDAFLHQIHSATQKLKTMEARVAEIMEKQVFSTLDDISNFYLFDIDEAFARTWPPEEFREVMLRSTQDRSRQLQEMVKTVADGLQKVANTLALRKEYDLTSAQGE 1090          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 601.282 bits (1549), Expect = 1.575e-171
Identity = 528/2222 (23.76%), Postives = 985/2222 (44.33%), Query Frame = 3
Query: 3426 IPMIKFEPELDAIQSIIEQMGQDIMAFHNDVSDFSGRKLNLYIKLESDLFY-------------EFSQIISLKYSE--SRLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSL-KEKITQVLHLKN---NLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKF----NTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQ----GSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWR---RVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHK-ELSINSVTIAFQNSLKVLSQMLVDNKEIGGEL---HIQRLFVFCFIWSLNSQISDLNKQAITTLLKRET---LVLP--DDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLTGE---VLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQ-ASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERN--FITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKL---ETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            IP I   P LD +Q  + +  + +++ +  V  ++G   ++ +     L +             E  +++S+  +   S  K+++ +E  + +  +W+      D E ++ +    N L  E  +Q+L+ K+    +   P+ I +  L + T   +  L +    W    G +   + +  +++   + +   ++L + + +L+ +   +  L +I +  + ID    PIE  Y  L  +EL + + E  ++  LR  W  L+  +   +N+L++ + N F  EL   ++ F  +   F   +D + P + G  P +   +L  F+N++     K  T     +LFGL V    +L  +++ L LL +LY LY    +    + D LW+ V ++ +  +L +F   C  LP  LKE +++ +LK  ID   +   +L  +A++ +  RHW ++ +VTG  F++E  TFK  ++   PLL+ K+EI+ IC  A KE ++E KL Q+  EW  +   F     RG ++L    T+ ++  +EDS ++L ++ ++R+  P K +  +W   L   +++++ W+ VQ LW+ LE VF+   I K L +E KRF  +DKS++K M R +E  NV Q C+ +E +    L ++   LE C  SL GYL +KR LF R +FV D  +L IL  ++D   I  HL ++F  +  +              +F      +   N + I  +V +   L                 K++              +Q+    + + W+ +   A++  + D+K ++   + F    NT I              T   +  ++R +  ++    ++ +D   +L    IR   DFE  K  + +   ++ +      +       D+G+++Q    G    +  TP T++  +TL  +L      +  G + +GK+   +++ R   +Y V  +C   M    L     G+A +G WG  D    +D S LS+A   I  +    K++  T +  + + + +      F T   P  +    LP N+   FR VA+  PD   I++       +  +  LA + +T+ K     +++       LR+I++ L    A K++                                  +PT +                   E  +V+  + ++ L  +  E+E     +++D F G        + +   P+L  AI K+              K +QL+   R   G++  GP+ +GKST +   + A+                                      Q H    + P +     +MFG       D+ DG+F+ LWR   R  + + I WIV DG +   W +NL S+LDD  TL L +G R+P + N K VFE +++ +ASP  VSR+G+V+  S+++ W  I   WL  + + E   L  +F      + Q+ IQ+   ++ +    +  Q  + +L Q L+  K+ GGEL   H++RL+VF  +WS+ + +   +++ +   L+      L LP    D+   +FDY+V   G+W  W +L ++E  Y    +T E   +LV  +  +R  + +    +    V LIG +G+ K++I+  +  KS+  +       +S  T     +  +E+ ++ R G  YG    K +++ I+D+N+P   E         NE++RQL+      N + P E   + D   + ++       + +  RL R F      +P  + +  I   +   H  S    +  + +  S+L+  T++L++   + ++   T    H  FNLR ++ I  G+ + N D   +  +LL  W +  +RV  D      D+ WF++ L  +++    GE     V  E +  F+ F  ++      ++ +N    A    PK+   +    S R+ L   + L+ E      ++L+   + ++ ++ I R I  P  G+ +L+G  GS    +  +A  IA   I ++    + N   L++ +K++ R  G +GK  + ++T   +K    L+ +N+++ SG+   LF  DEM  +LS +   MKRE       TN +L E F SR+R++LH++LC  P           +P ++S   ++W        L+A + +F++
Sbjct:  652 IPSIVMVPGLDEVQQALNKAVEYVVSVNKGVGQWNGSTSDISVSAHQVLPFQAKNYYKSVSENKEIVKLVSVLSTSINSSKKMKNALERFSRYHHIWRK-----DRESTIQEFSQGNPLLAEFESQILYYKDLELEINAEPEFITVGALALYTADLKLALTAETKGWMLDFGHHCKRKYRTEMEQVFTFVDEASKKLNRPIKDLDDIRIAMAALKEIREHQITIDFQVGPIEESYAMLNKYELSVAKEEMEKVDTLRYTWEKLLARSSEVQNELVSLQPN-FRGELISNVQTFVEDCDHFYQEYDKDGPMVMGLAPQDASDRLIMFQNRFDNLYRKFVTFTGGEELFGLPVTQHPQLLEIRKQLTLLQKLYGLYNNVIETVNGYYDVLWADVHIERINNELLDFQTRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMANRAMMTRHWKRITEVTGHTFEVETDTFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVIAEWDNKTFTFAQFKTRGELLLRGDSTSEIISNMEDSLMVLGSLMSNRYNTPFKAQIQKWVQNLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQSCVGDE-TMGQLLPHLLDQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSV--------------VFHDKTRRV---NHVLISKQVKHHCILFKVM------------FKFVF-----------LLAQVGLLGIQMIWTKDSEEALTNARFDRKIMTKTKQSFLELLNTLID------------MTTKDLGTMERTKYETLITIHVHQKDIFDDLCHLNIRSPSDFEWLK--QCRFYFIEDLDRMMINIT------DVGFKYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIDLSVLSVAAQQIAVVLTGKKERKKTFTFTDGDIVEMNPEFGIFLTMN-PGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASCGFIDNVELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRS----------------------------------NPTDT-------------------ESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGI------QLDKAGYPELEAAIDKQVTEAGLINHPPWRLKIIQLFETQRVRHGMMALGPSGAGKSTCIHTLMKAMTD----------------------------------CGQPHREMRMNPKAIT-APQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHI-WIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLNWSPILEGWLMKRSAQESEVLRHLFSSSFPTLYQFSIQSLDFKMDMLEAFVIMQ-CINML-QGLIQPKDQGGELSREHMERLYVFALMWSIGALLEQDDRKKMEHWLRHHDSIHLDLPYIPPDSQDTMFDYHVTNDGQWVHW-NLRVEEYIYPK-DITPEYSSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYLSKSNPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVT---NEIVRQLMEQKGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGTGHYCSQRGFEEDVRKVVSRLVPLTRRLWQ--MTKVKMLPTPANFHYIFNLRDLSRIWQGMLNVNADVIHTPKVLLCLWKHECKRVIADRFTSPEDVAWFDSMLANLVEEEL-GEEYRDVVKPEVDAYFVDF-LQDAPEATGEEPEN----ADFDMPKVYEPIASFPSLRDRLNMFLGLYNESIRGAGMDLVFFTDAMIHLVKISRIIRTP-RGNALLVGVGGSGKQSLTRLASFIAGYGIFQITLTRSYNTANLMEDLKNLYRTAGQQGKGISFIITDNEIKDESFLEYMNNVLSSGEVSNLFARDEMDEILSDLIPVMKREFPRRPP-TNENLHEYFMSRVRQNLHVVLCFSP-----------FPALISGCTMDWFSRWPKDALVAVSEHFLS 2682          

HSP 2 Score: 98.9821 bits (245), Expect = 1.698e-19
Identity = 146/647 (22.57%), Postives = 302/647 (46.68%), Query Frame = 3
Query: 11397 EFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDE-RAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVIS---YSDLHNRLESCLASGQCMIIADCDIH-QLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLK-MYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFD-SMIESSE------RLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLI---SPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLSLRATSPSSAILMKYLNNSYETNIL 13289
            E +  + E   +++EY   + ++ ++  + +    ++     L+  +   + +W   SK++  + + +    L+++A+L+Y GP N E R+  L       R+  +    FG + + +T+ L     +S+     LP  +  I N   +   +  R  +LI  QT+  I W+ R     N + I+   +    N LE  L+ G+ ++I D       A D ++ +       F+K   T+K+ +  + EV+    FRL++ T          +++ T ++ F  ++  L ++ L R I   K  ++ +   L+ +    KRK+ +LE+ +L  L++   ++   E+   ++   K   EE+   LQ           + + Y  +A R + ++ + + M+ V   Y     ++L LFD S+  SS+      R+ N  II+ +T +   Y+   + +E+KF+F+LLL+++I   +N ++   +E+L      +S+ LK+ P              KP  W+ + + +N+  L+  L  F DIL+ + +  K+  W+  FD E+PE   ++   +  S+D +++L LIR+  PDR +  +  +I +++  ++   V   D+  +   + P + I+      S  T+I+
Sbjct: 2999 ELDAKQAELDVVQAEYEKAVTEKQMLLEDAERCRHKMQTASSLISGLAGEKARWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLSDWQKEMRARCIP---FGIN-LNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAA--RFPLLIDPQTQGKI-WI-RNKEAKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEK------NFIKTGSTYKVKV-GDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKDRMDLVEDVMANKRKMKELEDSLLYRLTSTKGSLVDDESLIVVLSNTKRTSEEVTQKLQIAAETEVKINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSSKSPITSKRIGN--IIEHMTYEVHNYAARGLYEEHKFLFTLLLTLKIDMQSNRIK--HEEFLTLIKGGASLDLKACP-------------PKPSKWIPDMTWLNLVELSK-LWQFSDILDQIGRHEKQ--WRSWFDKEAPE-EEVIPNAYDQSLDCFKRLLLIRSWCPDRTIAQARKYIVDSMGERYAEGVI-LDLERTWEESDPRTPIICLLSMGSDPTDII 3608          

HSP 3 Score: 77.7962 bits (190), Expect = 4.257e-13
Identity = 89/404 (22.03%), Postives = 166/404 (41.09%), Query Frame = 3
Query: 13986 GSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPF-LFESAEACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPK--STIESIQERLKKV-----TNNFIYSK--TLMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTID-WISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGV 15164
            G +VT + D+  + +    W +      EF+F K  YH P        + + + +    I     +++ E   L  N    I  +  L + +     +I  K + S   +    E  +  +  ++  KLP   S  E + +RL+ +      N F+  +   + + L +  S   ++   I  T  ++M+E    + DA    +  +   ++P +W       K     ST+  W + LL + Q  +  I   +    C+W+  F  P+  L   ++E++    R ++      +    E T   KD I +PP +G+YV+GL+L G G+D+    L D   K +   +PV  +    N +   ++S  Y CPI+       + I+     +       W+LRGV
Sbjct: 3801 GGRVTDDYDKRLLNTFAKVWFSETMFNHEFQFYK-DYHIP--------RCTSVDQYLQYIQGLPAYDTPEVFGLHPN--ADITYQSKLAKDVLDTILSIQPKDSSSGGGETR--EAAVGRLADDMLEKLPPDYSPFE-VMKRLETMGRLEPMNIFLRQEIDRMQRVLALVRSTLTDLKLAIDGT--IVMSE---NLRDA----LDCMYDARIPARW------KKASWASSTLGFWFTELLERNQQFQAWIFEGRP--NCFWMTGFFNPQGFLTAMRQEIT----RANKGWALDRMVLCNEVTRWMKDDITQPPQEGVYVYGLYLEGAGWDRRNCRLVDSKPKVLFEMMPVVRMYAENNGV---KDSRLYSCPIYKKPARTDQNIIAAVDLRTSQRPEYWILRGV 4166          

HSP 4 Score: 77.7962 bits (190), Expect = 4.439e-13
Identity = 62/228 (27.19%), Postives = 105/228 (46.05%), Query Frame = 3
Query: 2172 ICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGN 2855
            I  K  + F N+  DI      Y + K +      +  V   + W ++L   IE PM  FQ    V    E + I++ YN+V+K L+ ++  Y   W+S +      L+  LLV      ++ +N    +L  I ET  + R+  ++ P A  L + +  +K  ++ L   +       Q  F +ML     H+  V +    G +SL+W+++NID FL +V A +GN
Sbjct:  392 IEEKYQKAFQNYSRDIEMVSRIYTKQKMEPPIGRNLPPVAGKILWSRQLYLRIEEPMKLFQQHPNVLATPEAKRIIRNYNRVAKTLVEYEVIYHRGWMSQL--VRIGLQASLLVRCPDTRELYVNFDPQILTQIRETDCISRMGLEIPPFAAVLRQKQNVLKTHYNNLQVTLCGI----QPAFEQML---TPHVAKVDEAILPGLTSLNWSSLNIDKFLSRVTAALGN 610          

HSP 5 Score: 67.781 bits (164), Expect = 5.069e-10
Identity = 46/172 (26.74%), Postives = 81/172 (47.09%), Query Frame = 3
Query:  690 EVILEEVNDRTSEQDIFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIRRQILSIINNKIQAIVGFNQAPEDLWKRVQDEICE 1205
            +V+ E    R    D+    E++ W+ R      L+ QLK    K+ +G L+  KSK+IK WR+L+  IT++ N +KD +KYL  + +E      Y S P  ++  +  +   ++   S SR ++ S  + S    +  Q+++     I      N     +W + QD + E
Sbjct:  103 QVLAESDQLRKEGDDLGPRAELDHWKKRMSRFNYLLDQLKSPDVKSVLGVLLMAKSKLIKTWRELDIRITDSANEAKDNVKYL--YTLERFFDPLYNSNPVSMVEAIAGLINAIRMIHSISRYYNTSEKITSLFVKVTNQMITACKAYIT-----NNGSATIWDQPQDVVAE 267          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 417.927 bits (1073), Expect = 5.891e-116
Identity = 451/2071 (21.78%), Postives = 874/2071 (42.20%), Query Frame = 3
Query: 3867 WQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRH-WIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCC-ISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKS-DKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAI-------KQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNR---NDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHKELSINS--VTIAFQNSLKVLSQM------LVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKR-ETLVLPDDDNSIC-----------IFDYYVD-ESGEWDLWSSLLMDEGEYLSLQLTG--EVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVA---LIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQ---ISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNHS 9950
            W +  G+ L+D A+  L       + + E LK+    LE L  +L  +  I D+ + ++  ++ I+  Y  L ++ + +   E     N+R  WS L   +  Q ++ L   +  F +   +Q+ ++  EV  F   F+   P   G D ++  R L     + +  E  +  LV   KLF L + ++ EL +++ ++  L Q+Y +   +   +  ++  LW  +++  +      F      LP  ++       L+G++    +   +L +L ++ +R+R+ ++   ++           +   D + I   +  KE+     D  + M+  ++              F+    RG ++  V   + + Q L+D+ + L +M  SR I P  +   QW   L  ISEV+++W+ VQ+ W+ LE++FI   I   L +E K+F+ +DK + K M        + +CC + N  S    L+N+  GLE C  SL  YL  KRN F R +F+ D  +LSIL  S++   +  H+  ++  +  L  D           + S+  E + L   +  +  V +W+  +  E+  +   ++ +AI Y     S  +    +   +  +   + W+ E+     ++ S +K+++   AKK + QI         N  +    P+    RR+L ++ +  ++ RD + +     I D  +FE    ++      D   +  F +   +     GYE+ G    +  TP T++  LTL  +L      +  G + +GK+   ++LA+      V  +C   M   ++     G+A  G WG  D    +D S LS+    I  I++A+       + +   +S+  + GI + +   +   + LP ES + L        FR V +  PDL QI +       + +++ LA ++  + K A   +++       LR++ + L  A   K+        GS ++                                             +E  +++ A+ ++ LP    E+      ++ D F G        ++     D +  I++E K    S+  + ++K VQ+Y  +      ++ GPT  GKS  ++    A   L                                LL +   MY++ P +     E++G       D+ DG+ + ++R +NR        +I+FDG +   W +N+ S++DD   L L +G R+    +   +FE+  ++ ASP  VSR G+V+     + +      W+ ++   E   L K+F+K +  +I+ +++   +        TI  Q  L ++ Q+      L++ +++  E  ++  F+     SL + + +  ++    L+K+   LV   D+ ++            +FD++ D  + +W  WSSL+    +Y+    T   ++LV T+ T R  + L+   +    V L+G  G+ K+    N     +     +    +S  T S  L+  LEA++E R    YG    K L + ++DLN+P+   +D    ++P  +L+ LL+   + +        +L D   I ++       + +D R +  F    I  PE   L  I   + + H    E C    +   +L   T +LY+ +   L    T  + H  FNLR ++ +  G+   N +   +E   ++ W     RVF D LI +TD       ++++IQ  +  E+ S      R+ I F              + RT    S P++   + D ++ +      +  + E   K  +NL+  D+ L  +  +HR I +   GH +L+G  GS    +  +A   A   + ++  S   +     + +K++  ++G E K++  L T  ++     L+ +N+++ SG  P LFP DE   +L+ ++   + M    S  ++       + F ++   +LHI+L + P  D++      +PG+++   ++W        L A A  F+  S
Sbjct:  969 WVSSLGRLLNDSAREDLYALRSELQQLSENLKKSPDTLEDLKFVLSTISNIRDMSVDVELRFRDIQERYRTLTMYNIQVPEEELQLAANIRNMWSDLFSESR-QVDRSLGRAKKTFTEITKEQIVQYKQEVAIFAESFNMHGPGAVG-DNLDKGR-LRYCSEELAKIEAGRQDLVGAEKLFDLPITTYPELLNVQREMRALRQIYEV---YKAAKTEWSQTLWVNLNIQLLQEGTEGFIKSLRKLPKDVRAMPVAFFLEGRMKEFKESLPLLLDLKNEALRDRYLFLHCYRL-----------YLLKDWSLIGSPQGVKEV----VDTWEVMKFSVQR------------YFKGTQERGYILGSV---DEIQQNLDDNAVNLQSMAGSRFIGPFLNVIQQWEKNLSLISEVIEVWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDHIDKMFKKIMSDTVRDPGIKRCCLVPNRLSD---LQNLSDGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSEPACVQEHMIKMYDNIASLRFDSGTNGETVAGALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRTNRLITKEAIFYYCQKKSRVDWMLDYQGMVVLAGNQVWWTWEVEDVFQKMSSGEKQAMKQYAKKMHQQID--------NLVRRITQPLKKNDRRKLNTVLIIDVHARDIVDSFVRDSITDAGEFEWESQLRF---YWDKKPDDLF-VRQCSAEFSYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALILQLKRFQFEGQEISLDSRMGIFITMNPGYAGRTELP-ESVKAL--------FRPVVVIVPDLQQICEIMLFSEGFLLAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKR--------GSPDL---------------------------------------------NEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLD---CPRVRYPNFNDAVETILEENKY---SLLPNQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQAQTRLG-------------------------------LLTK---MYALNPKAMSV-IELYGILDPVTRDWTDGILSNIFRDINRPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWQKWVNSRPPKEQADLRKLFEKYVPSIIEMVVEGITDGKQGEKLKTIVPQTDLNMVVQLSMMLDALLEPEDLSSE-ELECFFIEALYCSLGAALLETGRKKFDDLVKKLSCLVSVQDEKTLAGPGEIPGYLPTLFDFHFDGTTKKWMPWSSLV---AKYIHNPDTKFIDILVPTVDTTRVNWLLEQMVKVKRPVVLVGESGTSKTATTQNFLNNLNPDFTMVLTINFSSRTTSMDLQRSLEASVEKRTKETYGPPMGKSLLVFMDDLNMPR---VDEYGTQQPIALLKLLLDRGGMYDRGKELNCKQLKDLGFIAAMGKAGGGRNEVDSRFISLFSVFNIPFPEEEALHLIYSSILKGHTRPFEEC--IRNMCDKLTFCTLELYKTIIKDL--PPTPSKFHYIFNLRDLSRVYNGLTLTNAERFLTEAQFVRVWRNECLRVFYDRLINETDKALVQGHIKSLIQEHFGSELDSAM----RDPILFG-------------DYRTALSESEPRVYEDIQDYDACKALFQEILEEYNEN--KTRMNLVLFDDALDHLTRVHR-IIRMDRGHALLVGVGGSGKQSLTKLAAFTAGCDVFEIVLSRGYSESNFREDLKTLYVKLGIENKRTVFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLNQIRDEAVKMGSGHSKESVW------QYFINKSASNLHIVLGMSPVGDVLRTRCRNFPGLVNNTGIDWFLPWPPQALHAVAQSFLGES 2847          

HSP 2 Score: 132.109 bits (331), Expect = 1.874e-29
Identity = 146/634 (23.03%), Postives = 295/634 (46.53%), Query Frame = 3
Query: 11397 EFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERA-IFIQCLISSAYLAYCGPLNFEQRSKFL-DFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSD--LHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRN-VKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESS-------ERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNES-KTSNSKKPFDWMSEESLMNVKILAACLPC-FKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLS--LRATSPSSAIL 13250
            E E ++KE   L  +Y+  +G++ +++ E + +  RL     L+  +    ++W    ++ + +R  +   CLIS+A+L+Y G  N++ R++ + +         G+  ++       I   L  E+EIS+  S +LP  E  + N       S    + +  D  ++A++W+ +     N  + S++D     +LE  +  G   +  D D +    D ++  V       +K  +  ++++  + EV+  PNF+L+L+T  +  +    +     ++++  ++  L ++ LS  +   +  ++ + ++L++E  + KR L  LE+ +L +L+    N + ++E  +T+ +      E+   L+  E   +   K  D Y   A R A +F + + M  V   Y      +L +FD  +  S       +RLSN  I++ LT     Y    + + +K +FS  ++I+I +        + E+              F+K N S + S  KKP DW+ ++   ++  L    P  F  ++E++ K+ KE  WK  FD +SPE +    + +++S+  +QKL L+R  R DR+ +A   ++  T+  K+   V P  I        ++P+S I+
Sbjct: 3150 ELEAIQKELGALGEKYSAAMGEKQLLQEEAQLMERRLIAADKLISGLGSENQRWTEDLEELKKKRVRLLGDCLISAAFLSYEGAFNWDFRNEMVYEVWQKDVLERGIPLSQ----PFRIESLLTDEVEISRWGSESLPPDELSVQNGILTTRAS---RFPMCIDPQQQALNWIKKKEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYI---DPVIDNVLEKN---VKGAEGRQVIVLGDKEVDYDPNFKLYLNTKLANPKYSPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLIQETSQNKRLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKSKAGEVFEKLKLAETTSADIDKLRDGYRPAAKRGAILFFVLAEMALVNSMYQYSLASFLEVFDYSLRKSLPNSILPKRLSN--IMNTLTLNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQEELEF--------------FLKGNLSLEKSKRKKPCDWLPDQGWEDIVRLNELFPNEFGALIEDIEKNPKE--WKNWFDLDSPEQAPFPMK-YRDSLTVFQKLLLLRCFRVDRVYRAVSDYVTATMGEKY---VQPPVISFEAIFEQSTPNSPIV 3748          

HSP 3 Score: 65.4698 bits (158), Expect = 1.989e-9
Identity = 50/234 (21.37%), Postives = 106/234 (45.30%), Query Frame = 3
Query: 2271 PGMSLVYSTVA----WIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNP--LLVVDLVGN---KVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAGMHSEFSKLLKYLATQKIYNF 2945
            P +S +Y  VA    W + L   I+ P+IRFQ++ E+   ++ +S+ ++Y +V + +  ++   +  W    +  + +L N   LL VD  G+   ++ +N    L  II+ET  + R+   +   A  +   E R      +L   V    ++  S+      L    ++ + +  + G   L+W ++ I  F+ +    +   ES+++Q+     +    L+ + T  ++ F
Sbjct:  468 PPVSKIYPPVAGAVYWERLLFHRIKDPIIRFQELPEMLDNEQGKSVTEKYLEVGRRMRDYEVKKVEGWRKETERMLPELMNRTLLLTVDSSGDRGIRLVVNFAPELKEIISETIYLDRLGYAVPELARNVALQEHRFLRCVDELKNLVKRCHSLMDSLNDAEFLLLTPQVQELRRVLRAGWRRLNWNSLGIAEFIGRSEQAVTKFESLVSQIKKNARDVDAKLQDIETANLFKF 701          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 327.791 bits (839), Expect = 7.107e-89
Identity = 300/1280 (23.44%), Postives = 548/1280 (42.81%), Query Frame = 3
Query: 6165 LTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWR---RVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHK-ELSINSVTIAFQ--NSLKVLSQMLVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRET---LVLP--DDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLTGE---VLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERN--FITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKL---ETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            +TL  +L      +  G + +GK+   +++ R   +Y V  +C   M    L     G+A +G WG  D    +D S LS+A   I  +    K++  T +  + + + +      F T   P  +    LP N+   FR VA+  PD   I++       +  +  LA + +T+ K     +++       LR+I++ L    A K++                                  +PT +                   E  +V+  + ++ L  +  E+E     +++D F G        + +   P+L  AI K+              K +QL+   R   G++  GP+ +GKST +   + A+                                      Q H    + P +     +MFG       D+ DG+F+ LWR   R  + + I WIV DG +   W +NL S+LDD  TL L +G R+P + N K VFE +++ +ASP  VSR+G+V+  S+++ W  I   WL  + + E   L  +F      + Q+ IQ+   ++ +    +  Q  N L+ L Q  +  +      H++RL+VF  +WS+ + +   +++ +   L+      L LP    D+   +FDY+V   G+W  W +L ++E  Y    +T E   +LV  +  +R  + +    +    V LIG +G+ K++I+  +  KS+  +       +S  T     +  +E+ ++ R G  YG    K +++ I+D+N+P   E         NE++RQL+      N + P E   + D   + ++       + +  RL R F      +P  + +  I      C     E     +   S+L+  T++L++   + ++   T    H  FNLR ++ I  G+ + N D   +  +LL  W +  +RV  D      D+ WF++ L  +++    GE     V  E +  F+ F  ++      ++ +N    A    PK+   +    S R+ L   + L+ E      ++L+   + ++ ++ I R I  P  G+ +L+G  GS    +  +A  IA   I ++    + N   L++ +K++ R  G +GK  + ++T   +K    L+ +N+++ SG+   LF  DEM  +LS +   MKRE       TN +L E F SR+R++LH++LC  P           +P ++S   ++W        L+A + +F++
Sbjct:   21 ITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIDLSVLSVAAQQIAVVLTGKKERKKTFTFTDGDIVEMNPEFGIFLTMN-PGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASCGFIDNVELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRS----------------------------------NPTDT-------------------ESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGI------QLDKAGYPELEAAIDKQVTEAGLINHPPWRLKIIQLFETQRVRHGMMALGPSGAGKSTCIHTLMKAMTDCG----------------------------------QPHREMRMNPKAIT-APQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHI-WIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLNWSPILEGWLMKRSAQESEVLRHLFSSSFPTLYQFSIQSLDFKMDMLEAFVIMQCINMLQGLIQPKLSRE------HMERLYVFALMWSIGALLEQDDRKKMEHWLRHHDSIHLDLPYIPPDSQDTMFDYHVTNDGQWVHW-NLRVEEYIYPK-DITPEYSSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYLSKSNPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVT---NEIVRQLMEQKGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGTGHYCSQRGFEEDVRKV--VSRLVPLTRRLWQ--MTKVKMLPTPANFHYIFNLRDLSRIWQGMLNVNADVIHTPKVLLCLWKHECKRVIADRFTSPEDVAWFDSMLANLVEEEL-GEEYRDVVKPEVDAYFVDF-LQDAPEATGEEPEN----ADFDMPKVYEPIASFPSLRDRLNMFLGLYNESIRGAGMDLVFFTDAMIHLVKISRIIRTP-RGNALLVGVGGSGKQSLTRLASFIAGYGIFQITLTRSYNTANLMEDLKNLYRTAGQQGKGISFIITDNEIKDESFLEYMNNVLSSGEVSNLFARDEMDEILSDLIPVMKREFPRRPP-TNENLHEYFMSRVRQNLHVVLCFSP-----------FPALISGCTMDWFSRWPKDALVAVSEHFLS 1170          

HSP 2 Score: 98.9821 bits (245), Expect = 1.482e-19
Identity = 144/647 (22.26%), Postives = 301/647 (46.52%), Query Frame = 3
Query: 11397 EFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDE-RAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVIS---YSDLHNRLESCLASGQCMIIADCDIH-QLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLK-MYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIE-------SSERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLI---SPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLSLRATSPSSAILMKYLNNSYETNIL 13289
            E +  + E   +++EY   + ++ ++  + +    ++     L+  +   + +W   SK++  + + +    L+++A+L+Y GP N E R+  L       R+  +    FG + + +T+ L     +S+     LP  +  I N   +   +  R  +LI  QT+  I W+ R     N + I+   +    N LE  L+ G+ ++I D       A D ++ +       F+K   T+K+ +  + EV+    FRL++ T          +++ T ++ F  ++  L ++ L R I   K  ++ +   L+ +    KRK+ +LE+ +L  L++   ++   E+   ++   K   EE+   LQ           + + Y  +A R + ++ + + M+ V   Y     ++L LFD  +        +S+R+ N  II+ +T +   Y+   + +E+KF+F+LLL+++I   +N ++   +E+L      +S+ LK+ P              KP  W+ + + +N+  L+  L  F DIL+ + +  K+  W+  FD E+PE   ++   +  S+D +++L LIR+  PDR +  +  +I +++  ++   V   D+  +   + P + I+      S  T+I+
Sbjct: 1489 ELDAKQAELDVVQAEYEKAVTEKQMLLEDAERCRHKMQTASSLISGLAGEKARWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLSDWQKEMRARCIP---FGIN-LNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAA--RFPLLIDPQTQGKI-WI-RNKEAKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEK------NFIKTGSTYKVKV-GDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKDRMDLVEDVMANKRKMKELEDSLLYRLTSTKGSLVDDESLIVVLSNTKRTSEEVTQKLQIAAETEVKINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSSKSPITSKRIGN--IIEHMTYEVHNYAARGLYEEHKFLFTLLLTLKIDMQSNRIK--HEEFLTLIKGGASLDLKACP-------------PKPSKWIPDMTWLNLVELSK-LWQFSDILDQIGRHEKQ--WRSWFDKEAPE-EEVIPNAYDQSLDCFKRLLLIRSWCPDRTIAQARKYIVDSMGERYAEGVI-LDLERTWEESDPRTPIICLLSMGSDPTDII 2098          

HSP 3 Score: 77.0258 bits (188), Expect = 7.782e-13
Identity = 50/194 (25.77%), Postives = 86/194 (44.33%), Query Frame = 3
Query: 14586 QVPEKWLNKLCNPKGYSGYSTID-WISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGV 15164
            ++P +W       K     ST+  W + LL + Q  +  I   +    C+W+  F  P+  L   ++E++    R ++      +    E T   KD I +PP +G+YV+GL+L G G+D+    L D   K +   +PV  +    N +   ++S  Y CPI+       + I+     +       W+LRGV
Sbjct: 2474 RIPARW------KKASWASSTLGFWFTELLERNQQFQAWIFEGRP--NCFWMTGFFNPQGFLTAMRQEIT----RANKGWALDRMVLCNEVTRWMKDDITQPPQEGVYVYGLYLEGAGWDRRNCRLVDSKPKVLFEMMPVVRMYAENNGV---KDSRLYSCPIYKKPARTDQNIIAAVDLRTSQRPEYWILRGV 2652          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: ENSAMXT00000016401.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000026.1:1184712:1219988:1 gene:ENSAMXG00000015872.2 transcript:ENSAMXT00000016401.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 314.309 bits (804), Expect = 1.015e-84
Identity = 294/1294 (22.72%), Postives = 534/1294 (41.27%), Query Frame = 3
Query: 6141 TPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRV--NRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRE--TLVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYL--SLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQ-ASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITF--STEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGS---HLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNHSLNEIDLYLSEE 9983
            T TT    +TL  +L      +  G + +GK+   +++ R   +Y V  +C   M    L     G+A +G WG  D    ++   LS+A   I  +    K K       + + + +      F T   P  +    LP N+  +FR VA+  PD   I++       +R ++ L+ + YT+ K     +++       LR+I++ L    A                                                     V  S  ++ E  +V+  + ++ +  +  E+E     ++ D F G        + +   PDL  AI+K+A+          + K VQLY   R   G++  GP+ +GK+T +   L A+                     +  +P      +P+ +  S               +MFG       D+ DG+F+ LWR+    +    +WIV DG +   W +NL S+LDD  TL L +G R+P +   K VFE +++ +ASP  VSR+G+V+  S+++ W+ I   WL+                        +  +  EL +N     F      L  + +  K IG      RLFVF  +WS+ + +   ++  +   L+     L LP+      IF++ V+E+GEWD WS + + E  Y   S+     +LV  +   R  + L    +    V LIG +G+GK++++  +  K D          +S  T  S  +  +E+ I+ R G  YG    K +T+ I+D+N+P   E         NE++RQL+      + + P E + + D  ++ ++       + +  RL R F      +P  S +  I   +   +  S      ++   A  L+   +++++ V + +  S    + H  FNLR ++ I  G+ +   +      +L+  + +   RV  D  I   D   F+  L+ I       ++  G V  E  F+ F     E +    +D + +        PKI   +   ++  E L   +  + E     +++L+   + ++ ++ I R I  P  G+ +L+G  GS    L+++ S         I    T N   L++ +K++ R  G +GK    +    ++K    L+ + +++ SG+   LF  DE++ +   +  +MK++        + +L   F SR+R +LH++LC  P  + +     K+PG++S   V+W +      L+A A +F    L+   L  SEE
Sbjct:    6 TYTTIWCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKKPQFIFTDGDVVDMDKEFGIFLTMN-PGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRDNQVLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA-----------------------------------------------------VKRSNPSESEKTVVMRVLRDMNISKLVDEDEPLFMSLINDLFPGIV------LDKAGYPDLEAAIVKQAEEAGLIAHQPWVLKLVQLYETQRVRHGMMTLGPSGTGKTTCIHTLLKAMT--------------------DCGTPHKELRMNPKAITAS---------------QMFGTLDVATNDWTDGVFSTLWRKTLKAKKGEYTWIVLDGPVDAVWIENLNSVLDDNKTLTLANGDRIPMAPTCKVVFEPHNIDNASPATVSRNGMVFMSSSVLNWKPILQAWLKK-----------------------LPASQAELILN----FFNTFYSRLKYIYLTEKVIG------RLFVFAVMWSVGALLELEDRSRMEMFLRNHPAALDLPNTQQDQTIFEFVVNEAGEWDPWS-VKVPEYHYPKDSVPDYSSILVPNVDNTRTDFLLQTIMKQGKAVLLIGEQGTGKTVMIKGYTTKYDPETHLSKSLNFSSATLPSMFQQTIESYIDKRMGSTYGPPAGKKMTVFIDDINMPVINEWGDQIT---NEIVRQLMEQGGFYSLERPGEFVSVVDLQLVAAMIHPGGGRNDIPQRLKRQFCVFNCTLPSNSSIDKIFHTLASGYFCSERGFTESVSSLAKALVPTIRRVWQTVKAKMLPSP--AKFHYIFNLRDLSRIWQGMLTVGAEVCRDPEVLVSLFRHECTRVIADRFIDQNDRNVFDGILEKISTEEHGSDLVKG-VAWEEYFVDFLRDAPEITGDEPEDTEVV-------IPKIYEPIPSFSALSERLTLFLQQYNESVRGSAMDLVFFKDAMIHLVKISRIIRTP-QGNALLVGVGGSGKQSLTRLASFIAGYQSFQIVLTRTYNATNLMEDLKTLYRIAGLQGKGVTFIFADNDIKDESFLEYMTNVVASGEVSNLFTRDEISEITQDLIPTMKQQHPRLPPTID-NLYSYFLSRVRSNLHVVLCFSPVGEKLGSRAVKFPGLISGCTVDWFQRWPKDALVAVAQHF----LSGYSLQCSEE 1151          

HSP 2 Score: 91.2781 bits (225), Expect = 2.936e-17
Identity = 99/447 (22.15%), Postives = 191/447 (42.73%), Query Frame = 3
Query: 13776 PVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFESHS---NISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTI-ESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTR-----KVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPS---DGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHI--TFTLNDLDKPENSDQYYCPIF 15074
            P++   + L + ++ R  +  LG+     I    N ++    VQ + N  E       ++WN LRY + E+ YG +VT + D+  + + T  W + N   ++F F    Y   ++   PN K      + ++  P L ++ E   L  N    I+ +  +  +I      I  K + S   D T+ E+ +  +   +  KLP   +   ++  L+K+      +  L +EL    ++ G + + +   +      +IM+E   ++ DA    + S+   +VP+ W         +   +   W + LL + Q       N +     +WL  F  P+  L   ++E +   +   +      V  L + T   ++ +  PP+    G+Y++GL L G G+DK   ++ +   K + TPLPV H+    +  D  +P+    Y CP++
Sbjct: 2195 PLLFAVAFLHTTVQERRKFGPLGWN----IPYEFNQADFTSSVQFVQNHLEDVDVKLGVNWNCLRYMLGEVQYGGRVTDDMDKRLLNTFTRIWFSENMFGEKFCF----YRGYTI---PNAKTLPEYHSHIDALP-LVDTPEVLGLHPN--ADISCQTNMASEILSTIINIQPKDS-SGGGDETR-ESTVLRLANEMLEKLPPDYVAHEVRTHLQKMGLVQPMTIFLRQELDRMQNIIGCVRSTLTDLKLAIDGTIIMSE---DLRDA----LDSVYDARVPKLWQR-----SSWDSATLGFWFTELLERNQQFHSWTFNGRPHQ--FWLTGFFNPQGFLTAMRQETTR--MNLAKGWTLDTVVLLNDVTRMMREDVTGPPTGDVGGVYIYGLFLDGAGWDKRNCKILESLPKVLFTPLPVVHVYAVSSATDPKRPQGVSLYPCPVY 2609          

HSP 3 Score: 91.2781 bits (225), Expect = 3.807e-17
Identity = 133/621 (21.42%), Postives = 290/621 (46.70%), Query Frame = 3
Query: 11394 EEFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDE-RAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSK-IEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSDLHNR--LESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKK-----SIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIE-------SSERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDF---IKQNESKTSNS--KKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTV 13193
            E+ +  +KE  + +  Y+G + ++  +  + +A   ++   + L++ +   + +W   S +++ + + +    L+++ +L+Y GP N E R+  L           +  N    S+   +   L     + +     LP  +  I N   + + S    + L+ D   +  +W+     +++  V S +  + R  +E CL+ G+ ++I D    +L  D ++  +    F  ++   T+K+ +  + EV+    F L++ T  +       +++ T +V F  ++  L ++ L R I   K  ++ E  K+L E    KRK+ +LE+ +L  L++      S+    ++I+ L++ +     +  K+ L ++  +     + + Y  +A R + ++ +   M+ V   Y     ++L +FDS IE       +S+RL N  I+D LT +  +Y++  + +++KF+F+LLL+++I     N+                 S+P+F   IK   S   NS   KP  W+ + + +N+  L++  P F  +   + ++ +   WK  FD  +PE + + +  +++ + A+ KL LIR+  PDR +  +  +I  ++  ++   V
Sbjct: 1460 EQLDAKQKELDEAQELYDGAVSEKQSLLEDAEACRRKMSNAMALIDGLGGEKIRWTESSTEFQRQIKHLPGDVLLATGFLSYAGPFNQEYRNLLL-----QQWKKEMSGNHIPYSQSFNLITMLVDNATLGEWNLQGLPNDDLSIQNGIIVTSAS---RYPLLIDPQGQGKTWIKNREANHDLQVTSLNHKYFRAHIEDCLSLGKPLLIEDVG-EEL--DPVLDNILEKNF--IRSGSTYKVKV-GDKEVDVMKEFTLYITTKMANPAYSPEVSAKTAIVDFTVTVKGLEDQLLGRVILTEKQELESERVKMLAEVTSNKRKMQELEDNLLYRLTS---TQGSLVEDESLIEVLRVTKSTAEEVSLKKLLVAAETEIKINEAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDSSIEKSPKSQITSKRLIN--IMDFLTYEVFRYTVRGLYEDHKFLFTLLLTLKIDLQAKNI-----------------SHPEFQALIKGGASLDLNSVEPKPRRWILDMTWLNLVHLSSLHP-FSRLPSQVSQNDR--GWKSWFDEAAPEEAPLPDG-YESLLGAFHKLLLIRSWCPDRTIAQARHYITESIGQRYAEGV 2040          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: DYNC1H1 (dynein cytoplasmic 1 heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:2961])

HSP 1 Score: 256.529 bits (654), Expect = 3.768e-67
Identity = 245/1092 (22.44%), Postives = 476/1092 (43.59%), Query Frame = 3
Query: 4599 LPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDL-SQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFD-------SLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKD--EVVNWLNLLTXXXXXXXXXXXXDAIKYI-----STGDSLEELSK---KFPSQICYSALHLHWSNEINTAVSEI--KSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSAT----VSIVEKEGIHLQVGTNF---FFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQG--YSDSHSKNIKETIPPDLLNAIIKEAKLRRC---SISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRV---NRNDL--ISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMI 7763
             P++L++  SY  ++  +   +K++ ++  L S+ +++RHW Q+M+    N+ L   T     +  + L +N+  +  +   A+ EM LE  L QI E W    L   ++  +  ++   R  + L  ++++    +  M  S + +  +++A  W  KL  I  + D+W++VQ+ W+ LE +F     +K L   E +RF+ +   ++  M++V  TK+     + N       ++ +Q+ LE   D       +L  YL ++R+ F R +FV D  +L I+  S ++  +  H   +F  V  +  +    E L I    S   EE++    ++I +  ++  WL L+  E+  +++ L ++++  +     +TG  L        ++ +Q+   +  + WS  +  A++ I  K D   L  +  K    ++ +  T+        + P   ++R++L  +   +++ RD    L   KI +   FE    ++       +   Q+  +       + G+E+ G    +  TP T++  LT+  +LE +   S  G + +GK+  ++ L     R+ +  +C      +++     G+   G WG  D    ++   LS     +  I+ A+++ S       + V  E ++ QV  +     F +  P  +    LP N+ + FR +A+T PD   I +       +R + TLA ++    K     ++        LR++ + L  A   K+  I K K    E G+    + + E  P                                E  ++++++ E ++P +  E+   +  +L D F G  Y       ++E      L  +  E  L       + S  +EK +QLY + + + GL++ GP+ SGK+ +  + L AL  L                   +    +A   DP+ +++ H               ++G       ++ DGLFT + R++    R +L    WI+FDG + PEW +NL S+LDD   L LP+G RL    NV+ +FE+  +K A+   VSR G+V+F  +++
Sbjct:  477 FPARLRQYASYEYVQRLLKGYLKVNMLVIELKSEALKDRHWKQLMKRLHVNWVLSELTL--GQIWDVDLQKNEMVVKDVLLVAQGEMALEEFLKQIREVWNSYELDLVNYQNKCRLI---RGWDDLFNKVKEHINSVSAMKLSPYYKVFEEDALSWEDKLNRIMALFDVWIDVQRRWVYLEGIFTGSADIKHLLPVETQRFQSISTEFLALMKKV--TKSPLVMDVLN-------IQGVQRSLERLADLLGKIQKALGEYLERERSSFPRFYFVGDEDLLEIIGNSKNVAKLQKHFKKMFAGVASILLNEDNTEVLGIS---SREGEEVLYKTPVSITEHPKINEWLTLVEKEMRVTLAKLLAESVTEVGAFNKATGIDLGAYINWIDRYQAQLVVLSAQIDWSENVEMALTTIAGKDDMAPLQDVLTKVEATLNVLADTV------LMEQP--PIRRKKLEHLITELVHQRDVTRTLIKNKIDNPKSFEWLSQMRFYFDPKQTDVLQQLSIQMANAKFNYGFEYLGVQEKLVQTPLTDRCYLTMTQALEARLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEFNRLEERMLSAVSQQVQYIQVALREHSNPNRDRSTPVTTELLNKQVKVSAEMAIFITMNPGYAGRSNLPDNLKKLFRSLAMTKPDRQLIAQVMLYSQGFRTAETLAKKIVPFFKLCDEQLSSQSHYDFGLRALKSVLISAGNVKRERIQKIKREKCERGEDVDENEIAENLP--------------------------------EQEILIQSVCETMVPKLVAEDIPLLFSLLSDVFPGVQYMRGEMTALREE-----LKKVCAEMYLTYGDGDDVGSMWVEKVLQLYQITQINHGLMMVGPSGSGKTMAWRVLLKALERL-------------------EGVEGVAHIIDPKAISKDH---------------LYGTLDPNTREWTDGLFTHVLRKIIDNVRGELQKRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSLPPNVRIMFEVQDLKYATLATVSRCGMVWFSEDVL 1472          

HSP 2 Score: 130.568 bits (327), Expect = 5.070e-29
Identity = 147/659 (22.31%), Postives = 288/659 (43.70%), Query Frame = 3
Query: 7977 ELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKR-ETLVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQ---GLMYGGKE-HKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLL-NSNVIQNSKYPFEQMKLSDFNIIVSLATNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPL-------LLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSI-----ALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKD 9899
            E +IQ+  ++  +WS +       +  +   ++R  T+ LP   N + I DY V  SGEW  W   +             +V+V T+ T+R +  L         + L GP GSGK++ L +  R   L  M +    +S  T    L    +   E+R+   G++    +  K L L  +++NLP   ++D    +R    +RQ++ +    + S   + +++   F    +  T+     L  R +RH   + ++ P  + L  I        +  I   +     A  L +A  + Y   T   +R + + + H  ++ R +     GI       E+  PL       L++ W++ + R+FQD L+ D + +W +      I NV             ++F     E+  +R       I  +  LS   I V   ++   R+Y+ +++ +  E+  +  + L+  + VL  ++ I R   +P  GH++LIG  G+  + +         L + +I + +  T  D    + ++++LR+ G + +K A ++   N+  S  L+ +N+L+ +G+ P LF  DE A L++  Q     +K    + T+ +L + F S++ R+LH++  + P ++ + +     P + +   +NW  D
Sbjct: 1590 EKYIQKYLIYAVLWSFSGDGKLKMRAELGEYIRRITTVALPSAPN-VPIIDYEVCISGEWQSWQGKVPQIEVETHKVAAPDVVVPTLDTVRHEALLYTWLAEHKPLVLCGPPGSGKTMTLFSALRA--LPDMEVVGLNFSSATTPELLLKTFDHYCEYRRTPNGVVLAPVQLGKWLVLFCDEINLP---DMDKYGTQRVISFIRQMVEHGGFYRTSDQTWVKLERIQFVGACNPPTDPGRKPLSHRFLRHVPVVYVDYPGPASLTQIYGTFNRAMLRLIPTLRTY---AEPLTAAMVEFY---TMSQERFTQDTQPHYIYSPREMTRWVRGI------FEALRPLETLPVEGLIRIWAHEALRLFQDRLVEDEERRWTDEN----IDNV-----------ALKHFPNIDREKALNR------PILYSNWLSKDYIPVEQEEL---RDYVKARLKVFYEE--ELDVPLVLFNEVLDHVLRIDRIFRQP-QGHLLLIGVSGAGKTTLSRFVAWMNGLSVYQIKVHRKYTGEDFD--EDLRTVLRRSGCKNEKIAFIMDESNVLDSGFLERMNTLLANGEVPGLFEGDEYATLMT--QCKEGAQKEGLMLDTHEELYKWFTSQVIRNLHVVFTMNPSSEGLKDRAATSPALFNRCVLNWFGD 2199          

HSP 3 Score: 68.9366 bits (167), Expect = 1.935e-10
Identity = 127/640 (19.84%), Postives = 264/640 (41.25%), Query Frame = 3
Query: 11403 ENLKKECRDLES-------EYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERA-IFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSD--LHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLE-NNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKS-IENCNTIIKYL----KMYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLL--LSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASN---IMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKG-TVTPSDI-RLSLRATSPSSAILM 13253
            E +++  RDLE+       EY  LI +   ++ +L A+  +++ +  L++++    E+W+  S+ ++++ + I   CL+S+A++AY G  + + R           + + +       + I  T++L +  E  + ++ +LP  +   +NA  +        + LI D + +A  ++            S+ D      LES L  G  +++ D + +    D I+  V   + R    +   ++L+   + +++  P+F +FL T   T E P  L S    V+F  +   L ++ L+  ++  +P +D    +   +  K++ +      Q+   L   +  VK  I + +TII  L    K   E+   +++ + +    +     Y  ++   ++I+     +  +   Y      +L+++ +++  +  L  KS+ D   +      LL++     F FS+L  +S E           + + ++       K      +Q E+    S+ P                     FKD+++ +  D +   W    +S SPE S      E        A  +L LI+  RPDR++  S +F+   L   F   T  P D+  +      P + +LM
Sbjct: 2534 EEVEQMIRDLEASIARYKEEYAVLISEAQAIKADLAAVEAKVNRSTALLKSLSAERERWEKTSETFKNQMSTIAGDCLLSAAFIAYAGYFDQQMRQNLFTTWSHHLQQANIQFR----TDIARTEYLSNADERLRWQANSLPADDLCTENAIML---KRFNRYPLIIDPSGQATEFIMNEYKDRKITRTSFLDDAFRKNLESALRFGNPLLVQDVESY----DPILNPVLNREVR----RTGGRVLITLGDQDIDLSPSFVIFLSTRDPTVEFPPDLCSRVTFVNFTVTRSSLQSQCLNEVLKAERPDVD----EKRSDLLKLQGEFQLRLRQLEKSLLQALNEVKGRILDDDTIITTLENLKKEAAEVTRKVEETDIVMQEVENVSQQYLSLSTACSSIYFTLEALNQMHFLYQYSLHFFLDIYHTVLYENANL--KSVSDHTQRLAITRGLLNICFPLHF-FSVLRGVSSEPPYDPEFQHFLRGKEIVLTGMTLPKVKGLTTEQCEAMVRLSRLP--------------------TFKDLVDKVQADEQFFMW---LESNSPELSVPYIWAEEKTTPIGQAVHQLLLIQAFRPDRLLAMSTIFVSRVLGDSFMSITEQPLDLANIVDSEVKPGTPVLM 3128          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006497.1 (pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 gene:ENSPMAG00000005847.1 transcript:ENSPMAT00000006497.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 620.928 bits (1600), Expect = 2.040e-178
Identity = 521/2139 (24.36%), Postives = 954/2139 (44.60%), Query Frame = 3
Query: 3615 SRLKLQST--VENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREP--LQIDKIFSSSREEIVLNNKI----AIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGD-SLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYL--RDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGY--EFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWR---RVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQ--NHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGE-LHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRET--LVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYL--SLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQ-ASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITF--STEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGS---HLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFV 9941
            S L+++ST  ++N + F  LW    +++  +E +    T +    ++     L+  +Q LP    +  ++  T+  +  L+     W+   G  L+ +A    DE   + E + + L + + +LE +   +  L ++   +++++S   P+E  +  L  ++L    S  + +  L   W  L+  +   +N L+  +  +   +L   + +F  ++  F+  +D + P  AG  P E   +L+  + Q+     K  T     +LFGL V  + EL+ ++ +L LL +LY LY    +    + + LWS +D++ +  +L +F ++C  LP  LKE +++ +LK KID   +   +L  +A+K + +RHW ++  VTG  F +E+  F   ++   PLL  K +I+ IC  A KE +++ KL  +  EW+ Q   F     RG ++L+   T   +  +EDS ++L ++ ++R+  P K    QW  KL   +E+++ W+ VQ LW+ LE VF+   I K L QE KRF+ +DKS+ K M+R +E   +  CC+ +E   +  L ++ + LE C  SL GYL +KR +F R +FV D  +L IL  ++D   I  HL  +F  VN +     F E    QI  I S   E + L   +      +  V  WL  L   +  ++  +   A   I  G   L E    FP+Q+   A  + W+ +   A++  K+D+K +    +KF   ++ +     R+  K          R R++  TL  +++  +D   +L    I+   DFE  K  + +   ++       Q+  +    D  Y  E+ G    +  TP T++  +TL  +L      +  G + +GK+   +++ +   +Y V  +C   M    L     G+A +G WG  D    ++   LS+A   I  +    K K       + + + +      F T   P  +    LP N+  +FR VA+  PD   I++       +R ++ L+ + YT+ K     +++       LR+I++ L    A                                            +K+   E P         E  +V+  + ++ L  +  E+E     ++ D F G +      + +   P+L  AI+ + K          + K +QLY   R   G++  GP+ +GK+  + + + A+    E                    P      +P+ +                  +MFG       D+ DG+F+ LWR   +  + + I WI+ DG +   W +NL S+LDD  TL L +G R+P + N K VFE +++ +ASP  VSR+G+V+  S+++ WR I   WL+   + +   L    D +   +I ++    N K   +  + I  + ++++L  +L +  E   E  H+QRL VF  +WS+ + +   ++  +   L+     L LP   N   IF+Y V +SG W+ W++ +  E  Y   ++     +LV  +  +R  + +    +    V LIG +G+ K++++  +  K D          +S  T  +  +  +E+ ++ R G  YG    + +T+ I+D+N+P   E         NE++RQL+ +N   N + P E   + D   + ++       + +  RL R F      +P  + +  I R   E H          ++Q A  L+  T++L++   + ++   T  + H  FNLR ++ I  G+   N +   S  +LL  + +   RV  D      D  WFN T+  I+ +   G  ++ ++  E  F+ F     E +     D       A L APK+   +       E L + +  + E     +++L+   + ++ +I I R I  P  G+ +L+G  GS    L+++ S     +   I    T N   L++ +K + R+ G +GK    + T   +K    L+ +N+++ SG+   LF  DE+  +   +   +K+E       TN +L + F SR+R +LH++LC  P  +       K+P ++S   ++W +      L A A +F+
Sbjct: 1098 SFLRVESTEVLKNFSCFSSLWSQEPEEM-VKEFMTTDPTMSEFNAQMVYYAQLEQQVQDLPAHFAVGPVLAMTEPLKLALVQECRTWKRAFGAALNRKASASTDEVLAFSEAMAKHLARPICDLEDVRAAMAALAELRAAEIQMESAIGPVEEAFAMLAKYDLTFRDSSADRVDGLAYCWKNLMTQSVQVQNTLVILQPTM-KADLLTGVAEFHKDLSSFQLDYDTQGPGEAGIAPQEASDRLQMCQMQFDDLWRKFTTYSGGEELFGLPVTDYPELQRIRRELALLQKLYGLYNTVIESVDGYYEILWSDLDIEKINNELLDFQNKCRKLPKALKEWQAFEDLKKKIDNFNETCPLLEMMANKAMMSRHWERITNVTGHTFDIESDHFALKNIMEAPLLTFKDDIEDICISATKERDIDAKLKAVVSEWSSQCFTFAPFKSRGELLLKGSDTAEKVALMEDSLMVLASLMSNRYNVPFKPTIQQWVQKLSNTTEIIENWMMVQNLWIYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQKIMQRAHEIPGIVVCCVGDETLAQ-LLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDPHTIQAHLLGLFDNVNQV----GFHEKNYEQILSIESQEGESVTLVEPVMAQRGWQGNVETWLGSLLTGVRSTVHAVIRQAAAIIEDGAFKLHEFQTSFPAQVGLLA-QMIWTRDSEVALNNAKNDRKIMPATNQKFLDLLNELIDMTTRDLTK----------RERVKYETLITIHVHQKDIFDDLVRMNIKSTADFEWLK--QSRFYFVEETDKCLIQITDV----DFHYCNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKRTQFVFTDGDIVEMDREFGIFLTMN-PGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRDNQILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGA--------------------------------------------VKRSNPEEP---------EKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGIT------LDKAGYPELEEAILAQTKAAGLVHHPPWVLKIIQLYETQRVRHGMMALGPSGAGKTCCIHMLMKAMTDCGE--------------------PHREMRMNPKAIT---------------APQMFGTLDVATNDWTDGIFSTLWRKTLKAKKGEHI-WILLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWRPIVQAWLQGLPTEQAQVLWSTMDSVFQDLINFVFTAVNPKMDILECMYI--KQAIELLKGLLPEADERRLEHSHLQRLLVFSLMWSVGALLELEDRARMEAFLRAHPSHLDLPGSANDDSIFEYVVGDSGGWEHWNTRV-PEFAYPRDTVPEYSAILVPNVDNVRTDFLMQCIMKQEKAVLLIGEQGTAKTVMIKGYMNKYDAELHLTKSLNFSSATTPNMFQRTVESYVDKRMGTTYGPPAGRKMTIFIDDINMPIINEWGDQIT---NEIVRQLMENNGFYNLEKPGEFTTIVDVQFVAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNASIDKIFRTFAEGHFCPERGFPEEVNQLAVALVPTTRRLWQ--ATKVKMLPTPAKFHYIFNLRDLSRIWQGMLIMNSEVCRSSDMLLALFGHECVRVIADRFTAQQDKDWFNGTMSKIMLDD-HGTAAAASMEAEVYFVDFMRDAPEPTGEEPDD-------ADLEAPKVYEPIPSFPQLAERLQAFLVQYNESVRGANMDLVFFADAMVHLIKISRIIRTP-RGNALLVGVGGSGKQSLTRLASFIAGYSSFQITLSRTYNMSNLMEDLKQLYRKTGQQGKGVTFIFTDNEIKDEAFLEYMNNVLASGEVSNLFARDEIDEITQELIPVLKKEHPRRPP-TNENLYDYFLSRVRANLHVVLCFSPVGEKFRARALKFPALISGCTMDWFQSWPRDALTAVAGHFL 3098          

HSP 2 Score: 83.1889 bits (204), Expect = 1.727e-15
Identity = 62/275 (22.55%), Postives = 128/275 (46.55%), Query Frame = 3
Query: 2055 KTFSIFLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQV 2879
            ++   F++  F   ++T + L ++ KF+ +      +  +  K   +   +  D+     +Y++ K        +  V   + W ++L   I+IPM    + ++V Q  E +  V+ YNK++  L+  +  Y   W  AVD     L + LLV      +  +N    +  ++ E +++ ++  Q+  A + L + E++IK+  ++L EA+  +     SI P +  L    + LV      G + +SWT++NID ++ ++ A +  L+    QV
Sbjct:  534 QSLQTFVDSWFGDALKTEKMLELLGKFERIA---GGRLQLMEKYQLVLHRYARDMDMVRRTYQKQKQNPPIPRNIPPVSGKIMWARQLFRKIDIPMKFLNNKRDVLQTSEGKITVRNYNKMAAVLLEFELLYHRAWSRAVDLVRNSLLSSLLVRYPKKKEFFVNFDLAIFELLMEAKHLHKLGFQVPEAVINLCQKEQQIKHHHTRLLEALQEYTQAVSSIPPILQPLMTPCVALVEDAILPGLTIISWTSLNIDTYIEEIQAAVVQLKQTTKQV 805          

HSP 3 Score: 56.6102 bits (135), Expect = 2.383e-7
Identity = 37/148 (25.00%), Postives = 74/148 (50.00%), Query Frame = 3
Query:  678 MSEIEVILEEVNDRTSEQD-IFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIRRQILS 1118
            M +IE +L E      E D +    E+  W+ R     +L+ +LK +  +   G L + +S+ +K W++L+S ITE  + +KD +KYL + +   G + +Y+  P  +   +  +   ++   + SR ++ S  M S    +  Q+++
Sbjct:  247 MKQIEQVLVESEQIRKEADNVGPSAELVYWKKRTSRFNSLLEELKSERVQKVTGLLQAARSRSLKHWKELDSRITEEASEAKDNVKYLYSLEKFFGPLAKYS--PVSIKSGIEGLMSNIRMVHTISRYYNSSEHMTSLFVKVTNQMIA 392          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001372.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001372.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 470.315 bits (1209), Expect = 3.381e-134
Identity = 418/1734 (24.11%), Postives = 749/1734 (43.19%), Query Frame = 3
Query: 4833 ICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPL--QIDKIFSSSREEIVLNNKIAIKDEVVNWLN-LLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNRNDLIS--WIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQ--NHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGEL---HIQRLFVFCFIWSLNSQISDLNKQAITTLLK-RETLVL------PDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLT--GEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQ-ASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQ------IINIHRQITKPFNGHIV---LIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            IC  A KE ++E KL Q+  EW  +   F +   RG ++L    T  ++  +EDS ++L ++ ++R+  P K +  +W + L   +++++ W+ VQ LW+ LE VF+   I K L +E KRF  +DKS++K M R +E  NV QCC+ +E   +  L ++ + LE C  SL GYL +KR LF R +FV D  +L IL  ++D   I  HL ++F  +  +     F E +  +I  + S   E + L+  +     V  WLN LL    +     + S A+    +  SL E    +P+Q+    + L W+ +   A++  + ++K++    + F        + LNR    +T D ++A++R +  ++    ++ RD   +L    I+   DFE  K  + +    + V      +  ++  +    EF G    +  TP T++  +TL  +L      +  G + +GK+   +++ R   +Y V  +C   M    L     G+A +G WG  D    +D   LS+A   I  +    K++ +  +  + + + +      F T   P  +    LP N+   FR VA+  PD   I++       +  +  LA + YT+ K     +++    +  +  ++ +L    A               +G+    ST   F      R       S +K    + P+ LS             +I+ + P I  +              GY             P L  AI ++ +     I +    K +QLY       G++  GP+ +GK+T +   + A+                     E  SP      +P+ +                  +MFG       D+ DG+F+ LWR+  R       WIV DG +   W +NL S+LDD  TL L +G R+P + N K VFE +++ +ASP  VSR+G+V+  S+++ W  I   WL+ +   E   L  ++ K    + +Y     + K  ++ +  I    SL +L Q L+ +K+ GGE+   H+ RL+VF  +WS+ + +   +++ +   L+  E++ L      P  ++S  +FDY V   G+W  WSS + +E  Y          +LV  +  +R  + +    +   +V L+G +G+ K+++L  +  K D          +S  T     +  +E+ ++ + G  YG    K LT+ I+D+N+P   E         NE++RQL+      N + P E   + D   + ++       + +  RL R        +P  + +  I   +   H  +       +   A+QL+ AT++L++   + ++   T  + H  FNLR ++ I  G+ +   D  SS  LLL+ + +   RV  D      D  WF   L A+                ER F      +       + ++    A    PKI   +   +  R+ L   +  + E      ++L+   + +L       ++ +       F+GH +    +  V  H +Q     L  +        TSN   L++ +K + R  G +GK    L T   +K    L+ +N+++ SG+   LF  DEM  +LS +   MK++       T  +L E F +R+R +LH++LC  P  +       ++P ++S   ++W        L+A + +F++
Sbjct:    3 ICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDNTTEIIATMEDSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQ-LLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVE----FHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAF-------LVLLNRLISMTTQD-LSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLK--QCRFYFKEDVDKLIVWITDVSFIYQ--NEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMN-PGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILEVMYSLKTCKA---------------MGKAHTSSTAQLFCIRSYRR------VSMMKVIDEDEPLFLS-------------LIDDLFPGIALDK------------AGY-------------PQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMT--------------------ECGSPHREMRMNPKAITA---------------PQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIV--QSLNML-QGLIPSKDHGGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDS--MFDYMVGADGQWVHWSSRV-EEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVT---NEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGVIGTGHYSAARGFTEGVRALAAQLVPATRRLWQ--LTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPELLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGERAFFVDFLRDAPEATGDEPED----ADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKFIPVLGVTNLTLMTFDGHSLQDWAVPGVVRHDAQHIQFDLTFST----SYSTSN---LLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPP-TQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLS 1601          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001140.1 (pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 gene:ENSPMAG00000001005.1 transcript:ENSPMAT00000001140.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 360.918 bits (925), Expect = 1.439e-99
Identity = 409/1846 (22.16%), Postives = 763/1846 (41.33%), Query Frame = 3
Query: 4689 LASKEIRNRHWIQVMQVTGANFQLEAGTFKC-SDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAI---KDEVVNWLNLLTXXXXXXXXXXXXDAIK-YISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVG-TNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIP-PD---LLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRR--VNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIA-----LTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVL-SQM----------LVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKR-----------------ETLVLPDDDNSI------CIFDY-YVDES-GEWDLWSSLLMDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDN----HWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLATNSSA-DLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQA---SQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEI-------SSGNVNCERN------FITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKF---GKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVAL---IDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAV-QISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNHSLNEIDLYLSEE 9983
            L +  +R RHW  + +V G  F L      C      + L     + + I   A KE  LE  L ++  EW E       +   G  +L     + +   L+D  +    M  S  I+P + +  +W  KL+ + E+LD WL+VQ  WL LE +F +P IM  + +E +RF  +DK++   +++     +V      ++  ++  L+   + LE     L  YL +KR  F R +F+ +  +L IL+ + D   +  HL   F  ++ +     F E L I  + SS  E + L   I+    + +V  WL  L   +  S+ N+  +A++ Y ST  +  E  + +P Q         W++E++ A   I+  ++ L     + N QI  + + L R         ++   R  L ++ +  ++ RD LV L    I    DF+    ++          +   Q   +      GYE+ G+ P +  TP T++   TL  +L      +  G + +GK+   ++LA+   +  V  +C   +   +L  F  G+ S G W   D    +D   LS+    I  I+  I   S T+     EG  L++  T   F +  P  +    LP N+   FR VA+  PD   I +     F +  +R L++++    +  S  ++        +R++ + L  A                                     K+K P+                   ++E  L++ +I+++ LP     +    + I  D F G            +P PD   LL AI +  +     ++    EK +Q+Y ++    G ++ G    GK+ +  +  AAL  + E      N + ++                  +LN         P +     +++G +     ++ DG+    +R    + +    W+VFDG +   W +N+ ++LDD   L L  G  +  +     +FE   ++ ASP  VSR G++Y   +++GWR +   WL N R   + A     +  +F++++   +Q++ ++ KELS  S T    + + ++  QM           +D++++     I+ +F+F  +WS+ +  S   +     LL+                  E +  P +  S+       +++Y ++ E  G W+LW+  L             +++V T+ T+R    +++       V  +GP G+GKS+ + N    H  K+    + I    +S  T ++Q ++ +   ++ R+  +YG  + K + L ++D+N+P   E  +   + P E+LRQ L+ +   + K     +KL +  I+ ++       + +  R +RHF  + I   +   + +I   +   H  +        D +    QL+ +T ++Y+  T  L  + T  + H  FNLR  + +  G+     ++      + + W +   RVF D L+ D D  W  A ++  I      +        S+G+   E +      F  FS  +D ++   ++ ++                      E L   +  H E+F    K  +NL+     +  +  I R + +P   H +L+G  GS    +  +A  +A   + ++E S   A     + +K ILR+     +    L T   +K    L+ +N+L+ SG+ P LF PDE   +   + QI  +R+K   T  +   L+  F  R R  LH++L + P  D     L K+P +++   ++W +      L A A  ++       D+ +SEE
Sbjct:  723 LCNPGLRGRHWDALSEVVG--FPLLTQEQVCLEKFLEMNLESFLSKFNDISDTASKEYSLEKALEKMVREWDEMQFTLIVYRDSGTSILSA--VDDIQMLLDDHIVKTQTMRGSPFIKPFESDMKEWERKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFTTVDKTWRDLIKQTLTDTHVLAVVSIDKMLER--LQKSTELLELILKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGISRVE----FTEALDITHMKSSEGEVVQLIETISTSKARGQVEKWLLELEAVMIRSVHNVIGEAMEAYPSTPRA--EWVRAWPGQTVLCVSQAFWTSEVHEA---IRGGQQVLERYLAQCNGQIDEV-VGLVRGQ-------LSQQSRVTLGALVVLDVHARDVLVALLKGGIAHDSDFQWLSQLRYYWE------DGHLQTRMINAGLPYGYEYLGNTPRLVITPLTDRCYRTLFGALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINTGSDTLMF---EGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIMLYSFGFVSARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAG----------------------------------NLKLKYPS-------------------ENEDILMLRSIVDVNLPKFLAHDLPLFEGITSDLFPGVK----------LPKPDYVVLLEAIKENCEKMNLQMTDFFAEKILQIYEMMIVRHGFMIVGEPFGGKTCAYRVLAAALGDICEKALMAENKVQIT------------------VLN---------PKAITM-GQLYGQFDAISHEWSDGVLAVSYRAFATSTSPDRKWLVFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQLASTTNLIFEPMDLEVASPATVSRCGMIYMEPHILGWRPLLTSWL-NARPPPLSAPHKALICALFERLVPCCLQFVRKSTKELSPTSDTNLVCSLMNLMDCQMDDFHDETKIKAMDDRDVSA--WIEGIFLFSLVWSVGASCSTHGQVLFDQLLRELMSGPLSADTSKRFHLSENVEPPAEPFSVPFPAAGSVYEYRFIQEGKGRWELWTEALSLAPPIPRDMNFNDIIVPTLDTIRFTALMEMLVTHQKPVLFVGPTGTGKSVYITNFLLKHLDKNTYKPLTIN---FSAQTTAAQTQNIIMGKLDRRRKGVYGPAQGKRMVLFVDDVNMPAREEYGA---QPPVELLRQWLDHSNWYDLK-DCSMIKLENVQILGAMGPPGGGRNAVTARFLRHFNTVTINEFDDKSMFTIFSRIMGWHFTA--RFAFPTDFSVLTEQLVQSTMEVYKAATQNLLPTPT--KSHYLFNLRDFSRVIQGVCLSLPETCPVAASIQRLWVHEVLRVFYDRLVDDADRTWLVAFIRKTIHTYMKEDFTQLFQHDSNGDGQVEDDDLRSLMFCDFSDSKDDAKRYVEVSDV----------------------ERLRLVVEGHLEEFNNLSKKPMNLVLFRFAIEHVCRISRILKQP-RSHALLVGVGGSGRQSLTRLAAHMADCELFQVEISKGYATNEWREDLKRILRRSTDGEQNGVFLFTDTQIKQESFLEDINNLLNSGEIPNLFAPDEKQEICEKMRQIDRQRDKDKQTDGSPLALLNMFVDRCRDQLHVVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPGDALQAVATRYLE------DVEVSEE 2402          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001370.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001370.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 271.937 bits (694), Expect = 9.711e-73
Identity = 240/1007 (23.83%), Postives = 434/1007 (43.10%), Query Frame = 3
Query: 7014 ITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNRNDLIS--WIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQ--NHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGEL---HIQRLFVFCFIWSLNSQISDLNKQAITTLLK-RETLVL------PDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLT--GEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQ-ASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNG--HIVLIGSVGSHLSQMCSIALQIAKIPI----------QKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            +  E+E     ++ D F G +      + +   P L  AI ++ +     I +    K +QLY       G++  GP+ +GK+T +   + A+                     E  SP      +P+ +                  +MFG       D+ DG+F+ LWR+  R       WIV DG +   W +NL S+LDD  TL L +G R+P + N K VFE +++ +ASP  VSR+G+V+  S+++ W  I   WL+ +   E   L  ++ K    + +Y     + K  ++ +  I    SL +L Q L+ +K+ GGE+   H+ RL+VF  +WS+ + +   +++ +   L+  E++ L      P  ++S  +FDY V   G+W  WSS + +E  Y          +LV  +  +R  + +    +   +V L+G +G+ K+++L  +  K D          +S  T     +  +E+ ++ + G  YG    K LT+ I+D+N+P   E         NE++RQL+      N + P E   + D   + ++       + +  RL R        +P  + +  I   +   H  +       +   A+QL+ AT++L++   + ++   T  + H  FNLR ++ I  G+ +   D  SS  LLL+ + +   RV  D      D  WF   L A+                ER F      +       + ++    A    PKI   +   +  R+ L   +  + E      ++L+   + +L ++        P  G  ++ L+   G  L  + S +L+    P           +   TSN   L++ +K + R  G +GK    L T   +K    L+ +N+++ SG+   LF  DEM  +LS +   MK++       T  +L E F +R+R +LH++LC  P  +       ++P ++S   ++W        L+A + +F++
Sbjct:  662 VIDEDEPLFLSLIDDLFPGIA------LDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMT--------------------ECGSPHREMRMNPKAITA---------------PQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIV--QSLNML-QGLIPSKDHGGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDS--MFDYMVGADGQWVHWSSRV-EEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVT---NEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGVIGTGHYSAARGFTEGVRALAAQLVPATRRLWQ--LTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPELLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGERAFFVDFLRDAPEATGDEPED----ADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKF-----IPVLGVTNLTLMTFDGHSLQDILSASLRTDSDPAVLTPVVTPASRSYSTSN---LLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPP-TQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLS 1603          

HSP 2 Score: 228.794 bits (582), Expect = 1.417e-59
Identity = 167/624 (26.76%), Postives = 295/624 (47.28%), Query Frame = 3
Query: 4833 ICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPL--QIDKIFSSSREEIVLNNKIAIKDEVVNWLN-LLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIK 6695
            IC  A KE ++E KL Q+  EW  +   F +   RG ++L    T  ++  +EDS ++L ++ ++R+  P K +  +W + L   +++++ W+ VQ LW+ LE VF+   I K L +E KRF  +DKS++K M R +E  NV QCC+ +E   +  L ++ + LE C  SL GYL +KR LF R +FV D  +L IL  ++D   I  HL ++F  +  +     F E +  +I  + S   E + L+  +     V  WLN LL    +     + S A+    +  SL E    +P+Q+    + L W+ +   A++  + ++K++    + F        + LNR    +T D ++A++R +  ++    ++ RD   +L    I+   DFE  K  + +    + V      +  ++  +    EF G    +  TP T++  +TL  +L      +  G + +GK+   +++ R   +Y V  +C   M    L     G+A +G WG  D    +D   LS+A   I  +    K++ +  +  + + + +      F T   P  +    LP N+   FR VA+  PD   I++       +  +  LA + YT+ K
Sbjct:    3 ICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDNTTEIIATMEDSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQ-LLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVE----FHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAF-------LVLLNRLISMTTQD-LSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLK--QCRFYFKEDVDKLIVWITDVSFIYQ--NEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMN-PGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYK 608          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001365.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001365.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 270.396 bits (690), Expect = 3.135e-72
Identity = 238/1000 (23.80%), Postives = 432/1000 (43.20%), Query Frame = 3
Query: 7023 ENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNRNDLIS--WIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQ--NHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGEL---HIQRLFVFCFIWSLNSQISDLNKQAITTLLK-RETLVL------PDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLT--GEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQ-ASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKI-PI-------QKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            E+E     ++ D F G +      + +   P L  AI ++ +     I +    K +QLY       G++  GP+ +GK+T +   + A+                     E  SP      +P+ +                  +MFG       D+ DG+F+ LWR+  R       WIV DG +   W +NL S+LDD  TL L +G R+P + N K VFE +++ +ASP  VSR+G+V+  S+++ W  I   WL+ +   E   L  ++ K    + +Y     + K  ++ +  I    SL +L Q L+ +K+ GGE+   H+ RL+VF  +WS+ + +   +++ +   L+  E++ L      P  ++S  +FDY V   G+W  WSS + +E  Y          +LV  +  +R  + +    +   +V L+G +G+ K+++L  +  K D          +S  T     +  +E+ ++ + G  YG    K LT+ I+D+N+P   E         NE++RQL+      N + P E   + D   + ++       + +  RL R        +P  + +  I   +   H  +       +   A+QL+ AT++L++   + ++   T  + H  FNLR ++ I  G+ +   D  SS  LLL+ + +   RV  D      D  WF   L A+                ER F      +       + ++    A    PKI   +   +  R+ L   +  + E      ++L+   + +L ++    ++         + G V  H +Q     L  + + P+       +   TSN   L++ +K + R  G +GK    L T   +K    L+ +N+++ SG+   LF  DEM  +LS +   MK++       T  +L E F +R+R +LH++LC  P  +       ++P ++S   ++W        L+A + +F++
Sbjct:  669 EDEPLFLSLIDDLFPGIA------LDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMT------------------GAECGSPHREMRMNPKAITA---------------PQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIV--QSLNML-QGLIPSKDHGGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDS--MFDYMVGADGQWVHWSSRV-EEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVT---NEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGVIGTGHYSAARGFTEGVRALAAQLVPATRRLWQ--LTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPELLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGERAFFVDFLRDAPEATGDEPED----ADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKKEAKLLVTAYCDWAVPGVV-RHDAQHIQFDLTFSTLFPVFTQITLSRSYSTSN---LLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPP-TQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLS 1609          

HSP 2 Score: 227.639 bits (579), Expect = 2.589e-59
Identity = 167/624 (26.76%), Postives = 295/624 (47.28%), Query Frame = 3
Query: 4833 ICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPL--QIDKIFSSSREEIVLNNKIAIKDEVVNWLN-LLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIK 6695
            IC  A KE ++E KL Q+  EW  +   F +   RG ++L    T  ++  +EDS ++L ++ ++R+  P K +  +W + L   +++++ W+ VQ LW+ LE VF+   I K L +E KRF  +DKS++K M R +E  NV QCC+ +E   +  L ++ + LE C  SL GYL +KR LF R +FV D  +L IL  ++D   I  HL ++F  +  +     F E +  +I  + S   E + L+  +     V  WLN LL    +     + S A+    +  SL E    +P+Q+    + L W+ +   A++  + ++K++    + F        + LNR    +T D ++A++R +  ++    ++ RD   +L    I+   DFE  K  + +    + V      +  ++  +    EF G    +  TP T++  +TL  +L      +  G + +GK+   +++ R   +Y V  +C   M    L     G+A +G WG  D    +D   LS+A   I  +    K++ +  +  + + + +      F T   P  +    LP N+   FR VA+  PD   I++       +  +  LA + YT+ K
Sbjct:    3 ICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDNTTEIIATMEDSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQ-LLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVE----FHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAF-------LVLLNRLISMTTQD-LSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLK--QCRFYFKEDVDKLIVWITDVSFIYQ--NEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMN-PGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYK 608          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 232.261 bits (591), Expect = 1.178e-60
Identity = 402/1876 (21.43%), Postives = 757/1876 (40.35%), Query Frame = 3
Query: 4533 WSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGA-NFQ---LEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFI-NPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVV--NWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKM--KTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQ--GYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVN-------RNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSI--------CIFDYYVDESGEWDLWSSLLM-----------DEGEYLSLQ----LTGEVLVDTITTLR-AKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKS---DLTAMNIARFVYSYFTKSSQLKSFLEANIEH------RQGLMYGGKEH-KHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLATNSSAD----LLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQ-LISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGI-KSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFG-----KDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSI-----ALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTIL--TNFDLIEQFRSRIRRDLHIL--LCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            W  VD+  +   L  F      LP  +K+ E Y  L  +++ L  ++ IL  L    ++ RHW  + +  G    Q   L+   F   D+  + L  N+  + +I   A+KE  +E  LN+I++ W E       HS  GL +  VR  + L Q  ++    L++M  S + +  + +     +KL ++SE+   W+EVQ  WL+L  +   N  I   L  E  +F+ L   Y     R ++     +      +     LK     L+    SL  +L ++R  F R +F+ +  +L I+        +   +  +F ++  +     F E   I  + S   E + LN KI +KD +    WLN+L  EI+ S+     D +  +  G  +E +  K+  Q    +  + W+  +   +          S   K+ + +I  +   LN    KS+D+      ++++ ++ +  L+  + +  L     ++       K+ K   K   +D + +     +     +   +E+ G    + +TP       TL  SL  +      G + +GK+  ++   +   R  V  +C  +   + L   + GI   G WG  D    +D   LS     I QI++ ++   + ++++E+E   L   T  F T   P  +    LP N+ + FR  ++  P    I +       +  S++LA ++   ++  SS  +        LR++   L   S      +I E    +  G+ T   +L                            V L +    +  +  + + +I     TP N K I + LKD  Q  G+                             S+S   ++K +Q Y + +  Q LIL G    GK+                          +W+    A      H++         +Y I       ES ++G+      ++ DGLFT + RRVN       +N  I W+VFD  + PE+ + + S+LDD   L LP+G RLP   N + +FE +++   +P  ++R G+++F +++      K   L NK    +     +F+  LD +   I  +    S+ ++     + + +L     +  E   +L +  +  +   W  N     L K  IT L+KR  L     D++          I  Y+  +S E   +S++++            E   +SL+    +  ++++ TI T++  K F D+   +   + L GP GSGK++I++N  R S   D+  +N        F+K +  +  L A   H       +GL    K   K+L L  +++NLPK   +D    +     LRQL+        K P E   ++   I +  A N   D     +  R  RH   + +  P G  L  I    +E +  +I          ++    A+  LY +  +   R ST  + H  F+ R +  +  G+  + N     +   L++ W+Y + R+F D L+    +K  N+  Q + + V                       D    ++DL NI +T+ L +  +++   ++N         +N  +E+F      +  + ++  ++++  I+ I R + K   GH++LIG+  +  + +         L+I +  I +    +D  +I  +K  +     +  ++ +++   N+  +  L+ +N+L+ + D P LF  +E   LL+    +++ +  S  +L  T  +L + F   I ++LH++  +C P  N     ++   P + +   +NW+ D +   +   AN  V+
Sbjct: 1253 WCRVDVLLLQSDLANFLRRADELPRAVKQFEMYKSLFSQVNMLTSVNKILVELKDGALKPRHWNMIFRDIGKRQIQKNLLDKLEFSLKDVMVLNLTLNEILLTKIIERAQKEFVIEKSLNRIKKFWKEAQYEVIEHSS-GLKL--VREWDVLEQACKEDLEELVSMKASNYYKIFEQDCLDLESKLTKLSEIQVNWVEVQFYWLDLYGILGENLDIQNFLPLETSKFKSLTSEYKMITTRAFQLDTTIEVIHIPNFDTT--LKLTIDSLKMIKSSLSTFLERQRRQFPRFYFLGNDDLLKIIGSGKHHDQVSKFMKKMFGSIESI----IFLEDF-ITGVRSVEGEVLNLNEKIELKDSIQAQEWLNILDTEIKLSVFTQFRDCLGQLKDGTDIEVVVSKYIFQAILLSAQVMWTELVEKCLQ-----TNQFSKYWKEVDMKIKGLLDKLN----KSSDNV-----KKKIEALLVEYLHFNNVIGQLKNCSTKEEARLLWAKVQKFYQKNDTLDDLNSVFISQSGYLLQYK--FEYIGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNCDDSFDYQVLSRLLVGITQIGAWGCFDEFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLEEE-TPLSPHTAVFIT-LNPGYNGRSELPENLKKSFREFSMKSPQSGTIAEMILQIMGFEDSKSLASKIVHFLELLSSKCSSMNHYHFGLRTLKGVLRNCSP-----LISE----FGEGEKTVVESLKR--------------------------VILPSLGDTDELVFKDELSKIFDSAGTPLNSKAIVQCLKDAGQRSGF-----------------------------SMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTA-------------------------TWKTVIDAMAIFDGHANV--------VYVIDTKVLTKES-LYGSMLKATLEWRDGLFTSILRRVNDDITGTFKNSRI-WVVFDSDLDPEYVEAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLWFSTDVCSISS-KIDHLLNKSYEALDNKLSMFE--LDKLKDLISDSFDMASLTNIFTCSNDLVHILGVRTFNKLETAVQLAVHLISSYR-QWFQNLDDKSL-KDVITLLIKRSLLYALAGDSTGESQRAFIQTINTYFGHDSQELSDYSTIVIANDKLSFSSFCSEIPSVSLEAHEVMRPDIVIPTIDTIKHEKIFYDLLN-SKRGIILCGPPGSGKTMIMNNALRNSSLYDVVGIN--------FSKDTTTEHILSALHRHTNYVTTSKGLTLLPKSDIKNLVLFCDEINLPK---LDKYGSQNVVLFLRQLMEKQGFW--KTP-ENKWVTIERIHIVGACNPPTDPGRIPMSERFTRHAAILYLGYPSGKSLSQI----YEIYYKAIFKLVPEFRSYTEPFARASVHLYNECKA---RYSTGLQSHYLFSPRELTRLVRGVYTAINTGPRQTLRSLIRLWAYEAWRIFADRLV---GVKEKNSFEQLLYETV-----------------------DKYLPNQDLGNISSTSLLFSGLLSLDFKEVNK-----TDLVNFIEERFKTFCDEELEVPMVIHESMVDHILRIDRAL-KQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHSNLSDFDMI--LKKAISDCSLKESRTCLIIDESNILETAFLERMNTLLANADIPDLFQGEEYDKLLN----NLRNKTRSLGLLLDTEQELYDWFVGEIAKNLHVVFTICDPTNNKS--SAMISSPALFNRCIINWMGDWDTKTMSQVANNMVD 2934          

HSP 2 Score: 79.7221 bits (195), Expect = 1.404e-14
Identity = 107/458 (23.36%), Postives = 209/458 (45.63%), Query Frame = 3
Query: 11397 EFENLKKEC---------RDLES-------EYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQY-EDERAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRN----WILICDQTRRAISWLDRYLIHYNPVVISY--SDLHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEE---INANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMI--ESSERLSNKSIIDKL 12686
            EFE+LK +          +DLE+       +Y+ LI D   ++TE+  +   LD ++ LV+++   +E+W   +KQ+ +  + +   C+ISS Y  Y G LN  +R+   D  V   R  G    ++  +     +F+   + + +   + L C  D+  N YF+ N S++ N       + D +   I+ +  Y  +   V++S+       RLE+ +  G  +II D +      D I+ ++   +F     + T +I    +HEV+   +F+LF+H+C  + +IP  L S   LV F T+   +        + +    +  + + L++   + K KL  LE+++L++L+N   N+  +EN   ++    + +E   I   L + E  F      ++ Y  I      IF M  +       Y +   ++L+ F  +   +S E  + ++ +D++
Sbjct: 3237 EFESLKTKANLLAAEEMTQDLEASIEVSKRKYSLLIRDVEAIKTEMSNVQANLDRSISLVKSLTFEKERWLNTTKQFSKTSQELIGNCIISSIYETYFGHLNERERA---DMLVILKRLLGKFAVKYDVN----YRFIDYLVTLDEKMKW-LECGLDK--NDYFLENMSIVMNSQDAVPFLLDPSSHMITVISNYYGN-KTVLLSFLEEGFVKRLENAIRFGSVVIIQDGEFF----DPIISRLISREFNHAGNRVTVEI---GDHEVDVSGDFKLFIHSCDPSGDIPIFLRSRVRLVHFVTNKESIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNM--LENDELMVTLNNLKKEAMNIEKKLSESEEFFPQFDNLVEEYSIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCFKRVFIKKSRETRAARTRVDEI 3674          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO32004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWB3])

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 550/2181 (25.22%), Postives = 986/2181 (45.21%), Query Frame = 3
Query: 3591 IISLKYSESRLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNS-LKEKITQVLHLKNNLQRLPKEIEID--CLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVN--DLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYIS-TGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKF-NTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIK--MKTTVMDSVGNQKFQLATLTCTHDLGY--EFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWR---RVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQN-HKELSINSVTIAFQNSLKVLSQMLVDNKEIGGEL---HIQRLFVFCFIWSLNS--QISDLNKQAITTLLKRETLVLPD--DDNSICIFDYYVDESGEWDLWSSLLMDEGEYL--SLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIE--NCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATL-QAIIQNVWSGEISSGNVNCERNFITF--STEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKL---ETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNHSLNEIDLYLSEEKDKDQLAQYLANLHKEV 10034
            I++   S ++ ++   ++  +++ F+W+   DK    +     D   S  K +I +   L+  ++ +P    +    + + ++  +  L   +  W+   G +++++ +  +DE +Q+     + L + + +LE +   +  L+ +   +++ID    P+E  Y  L  FE+ + R E   +  LR  +  L+  A   ++ L+  +   F  +L   ++ +   V+ F + ++   P + G  P E   +L  F++++     K  T     +LFGL+V  + +L  +K++L LL +LY LY         + D LW+ VD++ +  +L +F + C  LP  LKE +++ ELK KID   +   +L  +A+K ++ RHW ++  +TG  F +E   F   ++   PLL++K++I+ IC  A KE ++E KL+Q+  +W  Q   F S   RG ++L+   T  ++  LEDS ++L ++ ++R+  P K +   W  KL   S++++ W+ VQ LW+ LE VF+   I K L +E KRF  +DKS++K M R +ET NV  CC+ +E   +  L ++ + LE C  SL GYL +KR +F R +FV D  +L IL  ++D   I  HL ++F  V   D H     R    I  I SS  E + L   +  K  V  WL  L N+   S+  +  DA   I+    +L      FP+Q+    + + W+ +   A+   + DKK ++   +KF N   S I +T            +T ++R +  ++    ++ RD   +L    IR V DFE  K  +   K  + D +        ++T   D  Y  EF G    +  TP T++  +TL  +L      +  G + +GK+   +++ +   +Y V  +C   M    L     G+A +G WG  D    ++   LS+A   I  +  A K +       + + + L      F T   P  +    LP N+  +FR VA+  PD   I++       +  +  LA + YT+ K     +++       LR+I++ L    A K+                                   SP  S                   E   V+  + ++ L  +  E+E     ++ D F G +      + +   P+L  AI K  +          + K +QLY   R   G++  GP+ +GK+  +++ + A+                                      Q H    + P +     +MFG       D+ DG+F+ LWR   +  + + I WIV DG +   W +NL S+LDD  TL L +G R+P S   K VFE +++ +ASP  VSR+G+VY  S+++ W+ I   WL ++   E     ++FD + D +  Y+ Q+ H ++ +    +  Q  L +L Q L+ +KE  G L   H+ RLFVF  +W + +  ++ D  K     L+    L LP   + +   IF++ VD  GEW+ W++ + +E  Y   S      +LV  +  +R  + +D   + S  V LIG +G+ K++++  +    +          +S  T     +  +E+ ++ R G  YG    + +T  I+D+N+P   E         NE++RQL+      N + P E   + D   + ++       + +  RL R F      +P  + +  I  GV  C     E  N +++ D   QL+  T+ L+++    ++   T  + H  FNLR ++ I  G+ +   D   S  L L  W +   RV  D    + D +WF   + ++++  V  G+ ++G +  E  F+ F     E +    +D       A L APKI   +  +    E L   + ++ +      ++L+   + ++ ++ + R I  P  G+ +L+G  GS    +  +A  IA   + ++    + N   L+D +K + R  GS+G+    + T   +K    L+ LN+++ SG+   LF  DE+  +   +   MK+E       T  +L   F SR R++LH++LC  P  +       K+PG++S   ++W        L+A A+YF    L++ ++  S E  K ++ Q +  +H  V
Sbjct:  407 ILTSSISSTKAEVMGCLDQFSQYHFVWE--GDKESVVKVFVASDPLLSDFKTEILKYQTLEQEIENIPASFRVGHGAIELYSEPLKIALTVEIRGWKLLFGHSINNKYRVCMDEISQFLGDYSKRLGRPIQDLEDVRGAMAALEDVRQNEIRIDMTLGPVEEAYAMLNKFEVAVAREEVERVDTLRYSFEKLLAQARDIQSHLVKIQPK-FKADLLGSVEIYQHNVVDFTSNYEEIGPMVGGITPQEASERLSVFQSRFDDLWRKFVTYSGGEQLFGLEVTEYPDLVRIKKELGLLQKLYGLYNAVIDGVNGYYDILWTEVDIEKINNELLDFQNRCRKLPKALKEWDAFNELKKKIDDFNECCPLLELMANKAMKERHWERLANLTGHKFDVENENFLLRNIMEAPLLKHKEDIEDICISAVKEKDIEAKLSQVVADWKSQEFSFASFKNRGELLLKGGETTEIVSLLEDSLMVLGSLLSNRYNAPFKKDIQSWVQKLSNTSDIIENWMVVQNLWVYLEAVFVGGDIAKQLPKEAKRFGNIDKSWVKIMTRAHETSNVVTCCVGDETMGQ-LLPHLLEQLELCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNVKTVDFHEKDYDR----ILSIVSSEGETVPLETAVMAKGNVEIWLGDLLNQAMSSLHGVIRDAFHAINDPAFALMSFMNTFPAQVGLLGIQMIWTRDAEEALKHARHDKKIMASTNQKFLNLLNSLIDVTTQE---------LTKMERTKFETLVTIHVHQRDIFDDLVKMHIRSVTDFEWLKQSRFYFKEDIDDCI-------VSITDV-DFSYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGKALGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTAKKDRKTQFIFSDGDVVDLNPEFGIFLTMN-PGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFIENVILAQKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRA----------------------------------SPQDS-------------------ESTTVMRVLRDMNLSKLVDEDEPLFLSLINDLFPGIT------LDKAGYPELEAAIQKNTEDAGLIFHPPWVLKLIQLYETQRVRHGMMALGPSGAGKTACINVLMKAMGE----------------------------------CGQPHRELRMNPKAIT-APQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGENI-WIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPQCKVVFEPHNIDNASPATVSRNGMVYMSSSVMDWKPILKAWLNSREPQEHDVFEQLFDCVFDELHTYMKQSLHPKMDVLECNVIAQ-CLDIL-QGLIPSKEEHGILSASHLSRLFVFALMWGVGALLELEDRAKME-EFLVDHGKLDLPKLAEGSHETIFEFVVDSKGEWEHWNNRV-EEWVYPTDSKPDYASILVPNVDNVRTNFLVDTIAKQSKAVLLIGEQGTAKTVMIKGYMSTYNPELHMTKSSNFSSATTPLLFQRTIESYVDKRVGTTYGPPAGRKMTAFIDDINMPIINEWGDQIT---NEIVRQLMEMKGFYNLEKPGEFTHIVDIQFLAAMIHPGGGRNDIPERLKRQFSIFNCTLPSNTSIDKIF-GVIGCGWFCPERFNSEVS-DIIKQLVVCTRILWQQTK--IKMLPTPAKFHYIFNLRDLSRIWEGMLNVTGDEIDSRKLALALWKHEVTRVIADRFTNEVDREWFEKQITKSLVDTV--GDDAAGELMAEPFFVDFLRDAPEVTGEEPED-------ADLDAPKIYELVPSLEFLNEKLGMYMMMYNDTVRGGHLDLVFFKDAMIHLVKVSRIIRTPC-GNALLVGVGGSGKQSLTRLASFIAGYKMFQITLTRSYNATNLMDDLKYLYRVAGSDGQGITFIFTDNEIKDEAFLEFLNNVLSSGEVSNLFARDELDEITQNLISVMKKELPRVPP-TQDNLYNYFISRARKNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFTRWPKDALIAVADYF----LSKFEIVCSAEI-KQKVVQTMGVVHDMV 2439          

HSP 2 Score: 118.627 bits (296), Expect = 6.123e-26
Identity = 145/696 (20.83%), Postives = 313/696 (44.97%), Query Frame = 3
Query: 11412 KKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERAIFI-QCLISSAYLAYCGPLNFEQRSKFLDFCVASAR-SSGLVTNRFGCSK-IEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVV-ISYSDLHNRLESCLASGQCMIIADCDIH-QLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENC---------------NTIIKYLKMYEEINANLQQKEFLFSSNKKSI----DNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSE-------RLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLI-SPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLSLRAT---SPSSAILMKYLNNSYETNILFNQIHSSVKPRIIQSRVIDYSKEGLQLFYQQLQNQ 13394
            + E   +++ Y+  +G++  +  + ++   ++     L+  +   +E+W   SK+++ +    +   L+++ +L+Y GP N   R+      + SAR    L  N+   ++ + +T  L     I +     LP  +  I N   I+N++  R  +LI  QT+     L+R   +   V  +++    N LE  L+ G+ M+I D       A D ++ +       F+K   T+K+ +  + E +    F +++ T          +++ T ++ F  ++  L  + L R I   K  ++ E                    ++++D+++  R +K +E+                 +++  LK+ +E    + +K  + +  +  I    + +  +A R + ++ +   M+ V   Y     ++L +FD  +  SE       R+ N  II+ LT +  +YS   + + +KF+F+LLL+++I      V+  + + LI   +++ LK+ P              KPF W+++ + +N+  L+  LP F  IL+ + ++  ++ W+  FD ++PE   I +  ++ S+D ++KL L+R+  PDR +  +  +I + +  ++   V      L+L AT   S +   L+ +L+   +       I S  K + I+ R +    +G ++  ++L  Q
Sbjct: 2738 QAELDKVQAMYDAAVGEKQTLLDDAESCKNKMVAASALINGLGGEKERWTQQSKEFQAQIGRLVGDVLLATGFLSYSGPFNQTFRT------LLSARWQQELEANKIPFTENLNLTSMLADPATIGEWNLQGLPTDDLSIQNG-IIVNKA-TRYPLLIDPQTQGKAWLLNREKANDLQVTSLNHKYFRNHLEDSLSLGRPMLIEDVGEELDPALDNVLEK------NFIKSGSTYKVKV-GDKECDVMSGFTMYITTKLGNPAYTPEISARTAIIDFTVTMKGLEEQLLGRVINTEKEELEAERV------------------KLMEDVTSNKRKMKELEDNLLYRLTSTKGSLVEDESLVAVLKITKETAEEVSEKLAIAAETETKINLAREEFRPVATRGSILYFLIVEMSMVNIMYQTSLRQFLGVFDMSMARSEKSPIPAKRIQN--IIEFLTYEVFKYSCRGLYENHKFLFTLLLALKIEIQDGKVKNQEFQTLIKGGAALDLKACP-------------AKPFKWITDMTWLNLVELSK-LPQFSGILDQVRRN--DSGWRGWFDKDAPEEHPIPDG-YQTSLDTFRKLLLVRSWCPDRTLPQARKYIADAMGERYAEGVI-----LNLEATWEESDTKTPLICFLSMGSDPT---GSIESLAKRKGIECRAVSMG-QGQEVHARRLIQQ 3372          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO42024 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2L5])

HSP 1 Score: 625.55 bits (1612), Expect = 2.264e-179
Identity = 528/2160 (24.44%), Postives = 960/2160 (44.44%), Query Frame = 3
Query: 3648 LNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWL-NLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGY--EFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAI---IKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWR---RVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGE--------LHIQRLFVFCFIWSLNSQISDLNKQAITTLLKR-ETLVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYL--SLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSL-ATNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQI-TIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITF---STEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKL---ETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNHSLNEIDLYLSEEKDKDQLAQYLANLHKEVLKF 10043
            +++F  LW    +     E +  K   +    +I    HL+  ++ LP    I  ++  T+  +  +++    W+   G+ L ++A   ++E   + + + + L + +T+L+ +   +  L +I + ++KID    PIE  +  +  + L    S+   +  L   W  +   A      LL  +   F  +L   + KF V V  F   +  + P + G  P E   +L  F+ ++     K  T     +LFGL+V  + +++ ++ +L LL +LY+LY         + D LW  +D++ +  +L +F +    LP  LKE +++ ELK  ID   +   +L  +A+K ++ RHW ++ Q+ G    +E+ TF+   L + PLL NK+EI+ IC  A KE ++E KL  +  EW+ Q   F     RG ++L+   T+ ++  +EDS ++L ++ ++R+  P K E  +W AKL   +E+++ WL VQ LW+ LE VF+   I K L QE KRF ++DKS++K M+R +E  NV QCC+ ++   +  L ++ + LE C  SL GYL +KR LF R +FV D  +L IL  ++D   I  HL  +F  V  +  D   +E  +I  I S   E+I+L   +  +  V  WL  LL   +    + +   ++        L E    +P+Q+    L + W+ +   A+S  +SDKK ++   + F   ++ +     R         +T ++R +  +     ++ RD   +L  K I+   DFE  K  +           +  Q        D  Y  EF G    +  TP T++  +TL  +L      +  G + +GK+   +++ +   +Y V  +C   M    L     G+A +G WG  D    ++   LS+A   I  +    K++       + + + +      F T   P  +    LP N+   FR VA+  PD   I++       +  +  L+ + +T+ K     + +       LR+I++ L    A K+                                   +P  S                   E  +V+  + ++ L  +  E+E     ++ D F G        + +   PD+  AI   ++EAKL         + K +QLY   R   G++  GP+ +GK+  ++I + A+                                   +    H  + + P +     +MFG       D+ DG+F+ LWR   R  + D I WIV DG +   W +NL S+LDD  TL L +G R+P S   K VFE +++ +ASP  VSR+G+VY  S+ + W+ I   WL+ + S E   L  +F+++ D V     QN   +S+       + +  V +  L+ N  I GE         H+++LF+F  +WS+ + +   +++ +  +++    L  P       IF+Y V++ G+W  WS  + +  +Y   S+     +LV  +  +R  + ++   +    V LIG +G+ K+++   +  + D          +S  T  +  +  +E+ ++ R G  YG    K +T  I+D+N+P   E         NE++RQL+      +   P E   + D   I ++       + +  RL R F      +P  + +  +   +   +        +  ++  S L+++T+KL++K    ++   T  + H  FNLR ++ I  G+     +   +  +LL  W +   RV  D      D  WF  +L A+++  +  E+S+  ++ E  F+ F   + E     + +D       A   APK+   +    S  E L S + ++ E      ++L+   + +  ++ I R I  P  G+ +L+G  GS    +  +A  IA   I ++    + N   L+D +K + +  G EGK    + T   +K    L+ +N+++ SG+   LF  DE+  + + + IS+ + +      TN +L + F +R++ +LH++LC  P  +       K+PG++S   ++W        L+A A+YF    L+  D+    E  K+ +   +   H  V +F
Sbjct: 1101 MDQFKELWNEDPNT-KVHEFMESKPLLSDFDAQIKYYQHLETQIEDLPSFYRIGSVIYLTERLKEAVVTETKAWKQSFGKALAEKASADMEEIFTFIDNLNKRLARPITDLDDVRGSMAALGEIRESEIKIDMTIGPIEESFAMMNRYGLHFSSSDAERVDGLTYAWKKVNTQAGVVAAHLLKIQPE-FKADLLDGVTKFKVLVQNFVEDYTEKGPMVPGIPPREASDRLAIFQARFDELWRKYETYSGGEELFGLEVTEYPDVQRIRRELGLLQKLYNLYNSVIDNVNGYYDILWQEIDIEKINQELLDFQNRIRKLPKGLKEWQAFLELKKTIDDFSECCPLLEMMANKAMKERHWGRISQMVGVTLDVESETFQLRQLMSAPLLPNKEEIEDICIAAVKEKDIESKLKGVIGEWSAQSFSFAGFKNRGELLLKGSDTSDIVSLMEDSLMVLGSLLSNRYNAPFKAEIQKWVAKLTGSTEIIENWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFSQIDKSWVKIMQRAHENANVVQCCVGDDTLGQ-LLPHLLEQLEICQKSLSGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLGVFDNVKTVTFDE--KEYDKILAINSRENEQIMLEKPVVAQGNVELWLFALLKEAMNSLHAVIRMASVGIKDPSFKLIEFLDAYPAQVGLLGLQMIWTRDAEDALSSARSDKKIMAQRNQYFLDMLNELIEVTTRE--------LTKVERIKFETFITIHVHQRDIFDDLVRKNIKTPSDFEWLKQSRFYWR------EETDQCLVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMAMGGAPAGPAGTGKTETTKDMGKALGKYVVVFNCSDQMDYRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKKQFIFTDGDVVDMDPEFGIFLTMN-PGYAGRQELPENLKIMFRTVAMMVPDRQIIIRVKLAACGFIRNIVLSAKFFTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAVKRA----------------------------------NPEDS-------------------EDRIVMRVLRDMNLSKLVDEDEPLFLSLIDDLFPGL------QLDKAGYPDIEQAIAQCVEEAKLIN---HPPWVLKLIQLYETQRVRHGMMALGPSGAGKTKCINILMKAMT----------------------------------ICGAPHKEFRMNPKAIT-APQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGDHI-WIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPTCKVVFEPHNIDNASPATVSRNGMVYMSSSALDWKPILQSWLKTRSSTESEILFNLFEQLFDDV-----QNFLTVSVVPRMELLECNYIVQASNLL-NGLIPGEDAPKQADASHLEKLFIFSIMWSIGALLELSDRKKVKFMMETFPDLKWPPVSGQDTIFEYVVNDQGDWQHWSERV-EAYDYPTDSVPEYSGILVPNVDNVRTDFLINCIAKQEKAVLLIGEQGTAKTVMTKGYCERYDPELHVFKAMNFSSATTPNMFQRTIESYVDKRMGTTYGPPAGKKMTSFIDDINMPIINEWGDQIT---NEIVRQLMEMKGFYSLDKPGEFTSIVDIQFISAMIQPGGGRNDIPSRLKRQFTVFNCTLPSNASIDKVFSTIGCGYFHKARGFPVEVVNMISPLVASTRKLWQKTK--VKMLPTPAKFHYIFNLRDLSRIWQGMLVVTSEILKTPKVLLNLWKHECHRVIADRFTNQPDRDWFEKSLMAVVEEDFGAEVSA-MIDPEPYFVDFLRDAPEPTGKSHPED-------AEFEAPKVYEPVETFESLNERLDSFVEMYNETVRGGRMDLVFFKDAMTHLVKISRIIRTP-RGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSYNVSNLMDDLKVLYKTAGHEGKGITFIFTDNEIKDEAFLEYMNNVLASGEVSNLFARDEIDEMTNDL-ISVMKAEYPRRPPTNENLYDYFITRVKNNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFSRWPKDALIAVASYF----LSSFDVKCKPEV-KEAMVNTMGIFHDTVAEF 3115          

HSP 2 Score: 81.2629 bits (199), Expect = 1.398e-14
Identity = 94/393 (23.92%), Postives = 181/393 (46.06%), Query Frame = 3
Query:   78 MDERHWWLATRVNESLTDKIKSNVSELETAFLEFNNSNCINSFFDEDG--PLVLYFAKCINSSLKSVHVSSEIKDLNDKSLFPS----EKLTILLVIKKRXXXXXXXXFEN---ELFCIEL---KNYILQNITTIFTHGFIPLLMTKYNSCDNTEKIYPLTSQLNSMWQSVQ-------NYTDQLYLNTNMEEPIHATIDLNKEL------QDPLKQFETFVTDVMSEIEVILEEVND-RTSEQDIFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIRRQILSIINNKI-QAIVGFNQAPEDL 1175
            MD RH ++ T+++++L   +  N+  +E   L  +    I+ FF  DG   L+ Y+ +C   +L+ V +S++  + + K LF S    EKLT   ++  R S+       N   E+  ++    K  IL+    +     IP L  + N  + + +I  +   L S+ + V        N + ++ L  +   P+  ++    +        D + + E  +     +IE +L E    R    DI    E+E W+ R      L+ Q+K    K ++G L + KS+ +K+W++L+S IT+A N +KD +KYL T     G + + +  P+ ++  VP +   ++   S S+ ++ S  M S    +  Q+++     I + +V   + P ++
Sbjct:   19 MDTRHAYIFTKISDTLG--MDPNL--VEDFILGDSRFPQIDEFFATDGIKKLMFYYQEC---NLRRVDLSTQASN-SHKKLFISTGNTEKLTGTCLVFMRMSNSKNITTANIAQEVSFMQFDASKGNILEGFEKLLGGIMIPALQKQENWGEMSTQISQVQEFLESLERFVSILNGARGNLSGRVQLGDHDLGPLLDSLKTPTDYVMAANNPDVVDKLEGLIAHWARDIEQVLAESEQMRKEADDIGPTAELEHWKKRMAKFNVLLDQIKSPHCKAAVGVLHAAKSRSLKQWKELDSRITDAANEAKDNVKYLYTLDKFFGPLIKCS--PTEMIEYVPSLMNAIRMIHSISQYYNTSERMTSLFVKVTNQMITTCKAYINRGVVKIWEHPREV 401          

HSP 3 Score: 80.1073 bits (196), Expect = 2.801e-14
Identity = 80/397 (20.15%), Postives = 175/397 (44.08%), Query Frame = 3
Query: 2022 EMHEEIMNNFDKTFSIFLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGVICH---KICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAGMHS-EFSKLLKYLATQKIYNFNHLLSKNWDSNEFTEAINKDLLAKKSTVQRTLEACSNILKEITEIISIVEKLDPNSSLYESEDLIFGQMKEMYNKSLSQSLYRSI 3200
            E  +E +        +F++  F + + T  +L +++KF+      +I GV  +   K   + + +  D+    + Y++ K     +  +  V   + W ++L   I  PM+ F+   ++ + +E + IVK YNK++  L+  +  Y   W  AV+   + L   LLV      ++ +N    ++ +I E + M R+  ++  +A  L   E +IK   ++L + +  +  V   I    + L +  +  V +T + G + L+WT++NI  ++  +   I  LE +  ++  +       +L+ + +  + +            EF E   K  L+    + R +    N +K ++   S +    PN+     +   +G++ E   + L ++L R++
Sbjct:  512 EEFKESIEQLKNQLQMFVDSWFDKSLSTMRSLELLNKFE------NIAGVQLYLHDKYQRVLLQYGRDLETCRKIYQKQKTDPPILRNLPPVAGKITWARQLFRRIHEPMLIFKTKSDLLKGEEAKRIVKNYNKMASVLVEFELLYHRGWFRAVEAAKSGLYASLLVRHPETKELFVNFDPQIVELIQEAKCMARLNLEIPNSAQVLRLKEEQIKSSSNRLVDVLKDYNHVVSGIPEVFVPLMKPFLNRVDETVKPGLTMLNWTSMNIMQYIDNIQVSIRGLERLTKEIKDIQECRIEAVLEEIGSTPLCDLPE--EDAITVEEFVETTEKTCLSAAEVLSRYVTQICNAIKHVSRRSSRI----PNN----QQSSAYGELVETSVEVLLETLKRNL 892          

HSP 4 Score: 63.5438 bits (153), Expect = 3.282e-9
Identity = 122/539 (22.63%), Postives = 246/539 (45.64%), Query Frame = 3
Query: 11412 KKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDE-RAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVIS---YSDLHNRLESCLASGQCMIIADCDIH-QLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHT-CSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSI----DNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFD-SMIES------SERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDIL 12977
            +KE   ++++Y+  + D+  +  + +A   ++     L++ +   + +W   SK+++ + + +    L+++ +L+Y GP N E R+          R + +  +      I +T  L     I +     LP  E  I N   +   S    + L+ D   +  +W+ R     N + I+   +    N +E  L+ G+ +II D       A D I+ +       F+K  KT+K+ +  + EV+    FRL++ T   + S  P++ ++ T ++ F  ++  L ++ L R I   K  ++ E  KL+ E    KR++  LE+ +L  L++      S+    ++I+ L   +  +  + +K  + +  +  I    + Y  +A R + ++ +   M+ V   Y    +++L +FD SM  S      ++R+ N  IID LT +  +Y+     +E+KF+F+LLL+++I      ++  + + LI     AL  N           +   KP  W+ + + +N+  L+  LP F  IL
Sbjct: 3411 QKELDAVQAKYDQAMRDKQTLVDDAEACRRKMANATALIDGLGGEKIRWTEQSKKFDQQIQRLVGDVLLATGFLSYSGPFNQEFRNLLQSTWKKDMRKAKIPFS----EDINLTNMLTDAATIGEWNLQGLPNDELSIQNGIIVTKAS---RYPLLIDPQGQGKAWI-RTKEQPNELQITSLNHKYFRNHMEDALSLGRPLIIEDVGEELDPALDNILEK------NFIKSGKTYKVKV-GDKEVDVMDGFRLYITTKLGNPSYTPEI-SARTSIIDFTVTMKGLEDQLLGRVILTEKQELEAERTKLMEEVTANKRRMKDLEDNLLYRLTS---TQGSLVEDESLIEVLSSTKATSEEVSEKLIVAAETELKINTAREEYRPVANRGSILYFLIVEMSYVNVMYQTSLKQFLGVFDISMARSQKSPIPAKRIQN--IIDYLTFEVFRYTTRGFYEEHKFLFTLLLTLKIDLQEKKIKHEEFQVLIK-GGAALDLN-----------AVEPKPKKWILDLTWLNLVELSK-LPQFTSIL 3915          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO35603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKZ5])

HSP 1 Score: 601.668 bits (1550), Expect = 5.293e-172
Identity = 525/2132 (24.62%), Postives = 958/2132 (44.93%), Query Frame = 3
Query: 3735 LKEKITQVLHLKNNLQRL---PKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREP--LQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDS---LEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWR---RVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSI-EVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSL---KVLSQMLVDNKEIGGEL---HIQRLFVFCFIWSLNSQISDLNKQAITTLLKRET--LVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLTG--EVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQ---SIIRGVFECHIDS-IENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITF--STEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSH---LSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNHSLNEIDLYLSEEKDKDQLAQYLANLHKEV 10034
            L E   Q+LH K   Q +   P+   +  + + T+  ++ L +    W     +  + + +  ++E   + E + + L + + +L+ +   +  L +I   ++KID    PIE  Y  L  +++PI R E   +  LR  W  L  +A   ++ L+  + N F   L  +++ F ++V  F   ++   P +    P E   +L  F+N++     K  T     +LFGL V  + EL  +K +L LL +LY LY         + D LW  V+++ +  +L +F + C  LP  LK+ +++ +LK  ID   +   +L  +A+K ++ RHW ++  +TG  F +E+ TF   ++   PLL++K++I+ +C  A KE ++E K+  +  +W+ + L F +   RG ++L    T+ ++  +EDS ++L ++ ++R+  P K     W  KL   +++++ W+ VQ LW+ LE VF+   I K L +E KRF+ +DK ++K M R +E  NV QCC+ +E   +  L ++ + LE C  SL GYL +KR +F R +FV D  +L IL  ++D   I  HL ++F  +  +     F E    +I  + SS  E + +   +  +  V  WL  L     +S+ N+   A  Y++  DS   L E    FP+Q+    + + W+ +   A++  K DKK +      F   ++ +         + T   +T + R +  ++    ++ RD   +L    IR   DFE  K I+        V +      T    +    EF G    +  TP T++  +TL  +L      +  G + +GK+   +++ +   +Y V  +C   M    L     G+A +G WG  D    +D   LS+A   I  I    K++       + + + +      F T   P  +    LP N+  +FR VA+  PD   I++       +  + TL+ + YT+ K     +++       LR+I++ L    A K+                                   +P  S                   E+  V+  + ++ L  +  E+E     ++ D F G        + +   P+L  AI  EA+            K +QL+   R   G+++ GP+ +GK+  + + + A+                     +  +P      +P+ +                  +MFG       D+ DG+F+ LWR   R  + + I WIV DG +   W +NL S+LDD  TL L +G R+P S   K VFE +++ +ASP  VSR+G+VY  S+ + WR +   W+ NKR I E   L   F+K  + ++ ++    +E  ++ + I   N +     L   L+  K+ GG+    H++ L+VF  +WS+ + + +L+ +A      RE   L LP    +  IF++ V+++GEW  W++ + +E  Y    +     +LV  +  +   Y ++  ++ S    LIG +G+ K++++  +  K D        F +S  +     +  +E+ ++ R G  YG    K +T+ ++D+N+P   E         NE++RQL+ +    N + P +   ++D   + ++       + +  RL R F+     +P  + +    S+I G + C     I + Q   D A +L+  T+KL++ +T V +   T  + H  FNLR ++ I  GI +   +  +SE  L+  W +  +RV  D      D  WF  T++ +I +   GE     ++    F+ F     E +    +D       A    PKI   +   +   E L   ++L+ +      ++L+   + ++ ++ + R I  P  G+ +L+G  GS    L+++ S         I    + N   L++ +K + R  G  G+    + T   +K    L+ LN+++ SG+   LF  DE+  +   +   MK+E       T  +L E F +R + +LH++LC  P  +       K+PG++S   ++W        L+A A++F    L+  D+  + E  K Q+   +  +H  V
Sbjct: 1160 LSEFEAQILHYKEMEQTIVQEPESYSVGSIALMTEKLKSSLCAETKAWCISFSRYCNQKYRMEMEEIFTFVEDMTKRLSRPIKDLDDIRLAMNALKEIRSQEIKIDMNIGPIEESYQMLARYDMPIAREESERVDTLRYSWEKLQSLATESQDHLIGIQSN-FKGGLIDEVQTFILDVGSFAGDYNSTGPMVPNVPPREASDRLIIFQNRFDTLWRKYITYSGGEELFGLPVTEYPELMQIKRELNLLQKLYGLYNDVIDTVNGYYDILWQDVNIEKINQELLDFQNRCRKLPRALKDWQAFLDLKKTIDDFNESCPLLELMANKAMKQRHWDRIANLTGHTFDIESDTFSLRNIMEAPLLKHKEDIEDVCIAAVKEKDIEAKMKMVIADWSTKDLTFANFKNRGELLLRGDNTSEIVSLMEDSLMVLGSLMSNRYNAPFKKNIQLWVQKLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFQNIDKQWVKIMTRAHENCNVVQCCVGDETLGQ-LLPHLLEQLELCQKSLTGYLEKKRLVFPRFFFVSDPVLLEILGQASDSHTIQAHLLNVFDNIKSVK----FHEKDYDRIMAVISSEGETVEMVKPVMAQGNVEIWLGTLLTMSRQSLHNVIRQA--YVAINDSSFNLLEFLNTFPAQVGLLGIQMIWTRDATEALTNAKYDKKVMQQTNAAFQELLNVL--------IEQTTKELTRVVRTKFETLITIHVHQRDIFDDLCRMHIRTPSDFEWLKQIRFYFNDDTDVCSVNITDVTFIYQN----EFLGCTERLVITPLTDRCYITLAQALFMSMGGAPAGPAGTGKTETTKDMGKALGKYVVVFNCSDQMDYRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIYIILTGKKERKKQFIFSDGDVVDMNPEFGIFLTMN-PGYAGRQELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFIDNITLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRN----------------------------------NPGDS-------------------ENTTVMRVLRDMNLSKLIDEDEPLFLSLINDLFPGIV------LDKAGYPELEQAIATEAEEIGLINHPPWRLKLIQLFETQRVRHGMMVLGPSGAGKTKCIHVLMKAMT--------------------DCGTPHKEMRMNPKAITA---------------PQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEKI-WIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPQCKIVFEPHNIDNASPATVSRNGMVYMSSSGLDWRPVVQAWI-NKRPIPEGEILNGFFEKSYEELLTFL----RESLVSKMDILDHNYIIQTLTLLDGLIPKKDDGGQFSSQHLEHLYVFSLMWSIGALL-ELDDRAKMETFMRENFDLDLPQVSENENIFEFMVNDAGEWAHWNTRV-EEYVYPKDHVPDFLSILVPNVDNVCMDYLIETVSKQSKAALLIGEQGTAKTVMIKGYMSKYDPEKHLSKSFNFSSASTPLLFQRTIESFVDKRMGSTYGPPAGKKMTVFVDDINMPIINEWGDQVT---NEIVRQLMETKGFYNLEKPGDFTNIADIQFLSAMIHPGGGRNDIPQRLKRQFLIFNCTLPSNASIDKIFSVIGGGYFCKERGFINDVQ---DFALKLVPCTRKLWQ-LTKV-KMLPTPAKFHYIFNLRDLSRIWQGILNTIAEVINSERALVSLWKHECQRVVSDRFTNQQDKDWFEKTMKRVIVDEL-GEDYQPMIDATAYFVDFLRDAPEATGDEPED-------ADFETPKIYEPIPSFDGLEERLAMYMDLYNDSIRGAGMDLVFFRDAMIHLMRVSRIIRTP-RGNALLVGVGGSGKQSLTRLSSFIAGYKTFQITLTRSYNSSNLMEDLKYLYRTAGQNGQGITFIFTDNEIKDEGFLEYLNNVLSSGEVSNLFARDEIDEICGELIPVMKKEFPRRPP-TGENLYEYFLTRAKHNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFSRWPKDALIAVADHF----LSSFDIVCTAEI-KTQVVHSMGVIHDGV 3145          

HSP 2 Score: 178.333 bits (451), Expect = 6.863e-44
Identity = 259/1265 (20.47%), Postives = 522/1265 (41.26%), Query Frame = 3
Query: 11523 LVENIKPMEEKWQTMSKQYEDERAIFI-QCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSDLHNR--LESCLASGQCMIIADCDIH-QLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENC---------------NTIIKYLKMYEEINANLQQKEFLFSSNKKSIDN----YHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIE-------SSERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLI---SPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLSLRAT---SPSSAILMKYLNNSYETNILFNQIHSSVKPRIIQSRVIDYSKEGLQLFYQQLQNQMSNIHEICLDSSLTTSNLTALNSVYIVIHLSSTEHISSIHKRVMSYIDEMNSFQRSALLKS-RDQNVVTYNLFFTLPQNHSGVSSSQMNKMTTVYLDYPSNLRDFLLHLFKIGFLSANSIPSMSLDLLPVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFES---HSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPF-LFESAE--ACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTIE-SIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTC-------YWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGV 15164
            L+  +   +E+W   SK++ ++    +   L+ + +L+Y GP N E R   +       +S  +       S + +T  +     + +     LP  E  + N   +   +    + L+ D   +  +W+          + S +  + R  LE  L+ G+ ++I D       A D ++ +       F+K   T K+ +  + EV+    F L++ T          +++ T ++ F  +I  L ++ L   I   K  ++                      ++L+D+S+  R +K +E+                 ++I+ L + +     + QK  + +  +  I+     +  +A R + ++ +   M+ V   Y    +++L LF   +E       +S+R++N  IID LT +  +YS   + + +KF+F+LLL+ +I     N  +  +E++      +S+ LK+ P              K   W+++ + +N+  L+  L  F DIL  + ++ K+  WK  FD ++PE + I +  + NS+D ++KL LIR+  PDR +  +  +I  ++  ++  TV      L L  T   S +   L+ +L+   +       I +  K      R I    +G ++  ++L N         L   L   +L     + ++  +  +EHI    +  M+  +E   F    L  S +  N     L   L + ++G+S  Q                           L  +++P       P++++ + L S ++ R  Y  LG+     I    N ++    VQ + N  +       +SWN +RY + E+ YG +VT + D+  + +    W +       F F K  Y  P        K + +++   +I    L +S E    H ++++  + N  K  ++ I     +I  K + S   +    E+ + ++  ++  KLP+  I+  ++ RL+K           M  L   +    + ++ +Q+    ++  +   ++D  +++  +++ ++     L+ + + +  + +  + W SS  + +   E +  N + +  C       +W+  F  P+  L   ++EV+    R  +      V    + T   KD I  PP++G+YVHGL L G G+D+   +L +   K + TP+PV HI + +N     +N   Y CPI+          +     K       W+LRGV
Sbjct: 3481 LISGLGGEKERWTEQSKEFAEQIGRLVGDVLVCTGFLSYSGPFNQEFRELLMSNWQKEMKSRKIPFT----SNLNVTGMMVDGATVGEWNLQGLPNDELSVQNGIIVTKAT---RFPLLVDPQGQGKAWIKNREKDNEMQITSLNHKYFRTHLEDALSLGRPLLIEDVGEELDPALDNVLEK------NFIKSGSTLKVKV-GDKEVDVMKGFVLYVTTKLPNPAYTPEISARTSIIDFTVTIKGLEDQLLGLVILTEKAELE------------------SERTKLLEDVSSNKRKMKELEDNLLYRLTSTQGSLVDDESLIEVLSVTKTTAEEVSQKLLVAADTEIKINGAREEFRPVATRGSILYFLIVEMSYVNCMYQTSLKQFLGLFSQSMERSHPSPITSKRINN--IIDYLTHEVWRYSCRGLFENHKFLFTLLLAFKID--LQNKRIKHNEFMTLIKGGASLDLKACP-------------PKTCRWITDMTWLNLVELSK-LSQFSDILNQISRNEKQ--WKNWFDKDAPEEAEIPDG-YANSLDTFRKLLLIRSWCPDRTISQARKYISESMGAQYGETVI-----LELEKTWEESDNRTPLINFLSMGSDPT---GMIEALAKKHKYDCRAISMG-QGQEVHARKLLNSFMQTGGWAL---LQNCHLGLEFMLELIDTVVESEHIHEDFRLWMT-TEEHVQFPIGLLQMSIKFTNEPPQGLRAGLKRTYNGISQDQ---------------------------LDVSNLPQWR----PMLYSVAFLHSTVQERRKYGPLGW----NIPYEFNQADFTASVQFVQNHLDDMDIKKGVSWNTVRYMLGEVQYGGRVTDDFDKRLLNTFAKVWFSEGMFHPSFNFYK-GYVIP--------KGTSVQQFLEHIDGLKLVDSPEVFGLHPNADITYQSNLAKDCLDTI----LSIQPKDSSSGGGETR--ESIVHKMADDMLEKLPEDYIQHEVKARLQK-----------MGPLSPMNIFLRQEIDRMQR----VITAVRITLTDLKLAIDGTIIMSETLRDSLDCMYDARIPTHWKKVSWESS-TIGFWFTELIERNAQFRTWCFDGRPNVFWMTGFFNPQGFLTAMRQEVT----RAHKGWALDSVVLHNDVTRFFKDDITTPPAEGVYVHGLFLDGAGWDRRGCKLVEPPAKVLFTPVPVIHI-YAINSTGGRDNR-LYQCPIYKKPRRTDLTYIACVDLKTNQNPDHWILRGV 4607          

HSP 3 Score: 101.293 bits (251), Expect = 1.332e-20
Identity = 70/270 (25.93%), Postives = 125/270 (46.30%), Query Frame = 3
Query: 2070 FLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQV 2879
            F+++ F +   T  AL ++ KF+ L    S++  I  K   + + F  DI    + Y+  K        +  +   +AW +++   I+ PMI FQ    + Q  +   I+K YNK+SK L+  +  Y   W+  V+   + L+  LLV      K+ +N    ++ +I ET  M+R+   +  +A  LL+ +  +K     L   +N  E V   I      L   H+  V      G + L+WT++N+D ++  V   +G LE +I++ 
Sbjct:  523 FMDICFEKIPSTQRALRLIRKFESLGL-DSLRDTIQEKYERILIYFGRDIETIQKIYQRHKTDPPVARDLPPIAGKIAWARQMYRRIQEPMIMFQKYPSILQTSDARKIIKNYNKLSKVLLEFELLYHQAWVKQVEVIKSGLQASLLVRHPDNKKLFVNFDPQIMTLIRETECMVRLGLDIPFSAHALLQKQSSLKKNSDTLQLLLNERERVLGKIPQTFRPLMAPHLAKVEAAIDPGLTMLNWTSLNLDTYVDSVYESLGELELLIDRA 791          

HSP 4 Score: 80.8777 bits (198), Expect = 1.677e-14
Identity = 51/188 (27.13%), Postives = 94/188 (50.00%), Query Frame = 3
Query:  645 LKQFETFVTDVMSEIEVILEEVND-RTSEQDIFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIRRQILSIINNKIQAIVGFNQAPEDLWKRVQDEICE 1205
            L+Q E  V+  + +IE +L E    R    D+    E++ W+ R     +L+ Q+KG   K  +G L + KSK++K WR+L+  IT+  N +KD +K+L T +  C  +  Y S P  ++  +P +   ++   S+SR ++ S  M +    +  Q+++   N I          +++W+    E+ E
Sbjct:  219 LEQIEAVVSAWIKQIEQVLAESEQMRKEADDVGPKAELDHWKKRMAKFNSLLDQIKGSDCKAVVGVLHAAKSKLLKTWRELDIRITDYANEAKDNVKFLYTLEKFCDPL--YNSDPVGMMDGIPGLINAIRMINSYSRYYNTSERMTALFVKVTNQMITACKNYIT-----EHGYKNVWEYTHSELIE 399          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO44669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV18])

HSP 1 Score: 530.791 bits (1366), Expect = 8.888e-151
Identity = 306/993 (30.82%), Postives = 530/993 (53.37%), Query Frame = 3
Query: 6915 KQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPP--------DLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNR----NDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYI-IQNHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNII--VSL----ATNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDII 9836
            K K   TP +LS AAK EH  +++++++ + P + P+       IL+D F G         K   PP        D  NA+++  + R        + K  QL N+ + H G+I+ GP  +GKS+ +   +  L   +  +   +             SP             +H +  +YP+     + MFG  +T   DF DG+FT  WR+ N+    + + +WI  D  +   W++ L S+LD+   L L +  R+  S++VK +FE + + +ASP  VSRS +VY   +++GWR +   WL N+   EV  L + F+K +D + Q++  +    L I  V + F   L ++  ++  N +IGGELHI+RL++F  IWS  S + D +++  + +L   T  LPD D  I +FDYYVDESGEWD W S + D   + +  L GEV V+T+ T+R + F+D+ + +  N+ L GPRG GK+ ++++   K +     + R+V+S  +K+  L+ F+E NI HRQG ++G K+ K L + I+DL++P+P   D   ++  NE+LRQ+L+  V  N+K PF++  L   ++   VSL    +T+     +  RL RHF    +  P G  L +++  V E ++   +   +  D   Q+++A+ +L   V +VL+ S T GRCH  FNLR +  +  G+K+ + +  + +  ++  W +   RV +D +   +D+KWF   L+ I++  +    ++        FITF  +  S           T A  +APK   ++ ++      L + +  + ++F  + + LM + +V+  +I +HR ++    G+ +L+G++G+HL  +  +A+ + + PI  ++ S     +D ++S +RQ G +GK + ++LTA +LK  + LD LNSL+ISG+ P LF  DE+  LL A+  ++KR+ SS       D ++ F +R++ +LHI+LCLPP + ++
Sbjct: 2254 KDKKPSTPSALSPAAKLEHAYMLQSLLDCIGPRLNPDELNIFFTILRDVFYGLP-------KTPQPPYHVTKEQQDFENALLQYTRERGLVAHQPWIIKINQLRNLSKQHHGIIVAGPPGTGKSSCISALIETLTECSATKHKNT------------GSP-----------MHTHKLQKVYPLGVSDPALMFGRINTSG-DFEDGIFTAYWRKANKEHSVHQMTTWICLDAPLHHGWAEMLSSVLDNGGYLSLLNSERMYLSEDVKLLFETDDLANASPATVSRSAIVYMDESVLGWRPLAEAWLANRSPQEVHCLQRAFNKTVDAISQFVQFEARPHLKICEVGL-FSTCLAMVKALIEGNTDIGGELHIERLYLFSLIWSFGSLLDDHDRKKFSEILLSLTTALPDYDQEISVFDYYVDESGEWDPWQSKVPDVSYFDAADLLGEVFVETVDTVRTRMFMDLASTSGRNILLTGPRGCGKTSLINDFLDKQEDKNQIVKRYVFSGTSKAVSLQQFIENNIYHRQGFVFGAKKGKALNMFIDDLSIPQP---DDHGVQEVNELLRQVLDQQVFFNTKKPFDRRVLEGVSVTSAVSLHNEQSTSGQPQRIPERLKRHFAMFYLPAPIGESLFTVVNSVLEANMAQNQGMGLPQDFHDQIVTASCQLLTSVQNVLRPSPTPGRCHYQFNLRDLTRVFQGLKNCSEEMRADDEYVVSLWQHEVMRVMKDRVCRASDVKWFEKNLKNIVKENFPTLPANSPPPV---FITFPLDPGSYSG-----RTTTQARTAAPK---SIENVKEVAPCLQNYLRRYNDEF-NEGLGLMVSTHVMYHVIRLHRILSFKNRGNALLVGAIGTHLHSLAHLAMYMLEYPIHPVDCSYPNTFLDGLRSAVRQAGCDGKTTTVVLTAEDLKQDMYLDALNSLLISGEYPPLFSEDELDSLLQALMPAIKRKFSSFLA----DPMKFFITRVKANLHIVLCLPPTHRLL 3195          

HSP 2 Score: 460.685 bits (1184), Expect = 1.537e-129
Identity = 281/720 (39.03%), Postives = 418/720 (58.06%), Query Frame = 3
Query: 3393 LIKF-ILLVKYEIPMIKFEPELDAIQSIIEQMG-------QDIMAFHNDVSDFSGRKLNLYIKLESDLFYEFSQIISLKYSESRLKLQSTVEN----LNEFDFLWKMTSDKLDFEESLAKKDTYNS-LKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKE-----SYGELKGKIDYL-IKIHSILTNLASK-EIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDL 5492
            L+KF ++ V++ IP I  EP L  IQ  + ++        + IM +  DV++     ++   K+++ L    S I SL         QSTV++       +DFLWK   D      S  + D   +  KE+I ++  ++ ++  +P+ + I    ++T   +  L  L   W+ ++   LH+EAK  LD+   +R  +   L Q V  L++L+    +L ++ D++  ID +Y P+E++YT L  ++L + R E  E+ +LR  W  L+++AE  R +LL +KR +F QELDK++K F V VIQFRN FD + P + G  P E   +L +F+ QY+ YE  + TL A+ +LFG+    F EL+   E+L LL  LY L+Q+F  F++ F + LWS VDL     +L  +  E    P + K  +       G+   K +Y  I +  IL+ L  + EIRNRHW+QVM VTG++FQLEA  FK   L  I LLE++K+I  IC  A +E+ELE+K+  IEEEWTEQVL F++   RGLV L    T  LL  LED+Q  L  M  SRHI P++DEAA WA KL EI EVL+ WL VQ LW +LE VF +    K+L QEY RF R+DKSY+K M+R YETKNV QCC+  +  K   LK++ + LE CF SL G+L  KR +F R  FV D+ +L +L+  ++++++  ++  IF++V D+
Sbjct:  831 LLKFEVVDVRFNIPDIVIEPSLSMIQDGVNKVALGVVNVSRGIMWWAADVNESFHGMVSRDNKVQAQLQDLSSSITSL---------QSTVDHQLLKFRRYDFLWK--DDMHALYHSFVESDPGTARFKEEIEKLQAIEEDVLGIPERLGIGSACLNTSPIKDSLHGLSVAWKMRYSTQLHEEAKIELDKIVTHRNAIYSRLSQPVVTLDELHSAFELLQELGDMENTIDDVYLPVENIYTKLREYKLNLPRKEVEEVDSLRDEWVKLMELAEKVREELLVKKRGMFEQELDKEVKAFVVNVIQFRNSFDSQGPGVPGVRPAEAVARLHAFQQQYTQYESHRKTLDAVQQLFGIVPTPFPELDKTGEELQLLGHLYGLFQQFISFDQRFRETLWSEVDLAVENQELMNYSIESSEFPKRWKTAKVTPLYKSGDHMDKSNYRPISVLPILSKLLERHEIRNRHWLQVMSVTGSSFQLEAHIFKLVHLLDIGLLEHQKKIRDICRSASRELELELKMRSIEEEWTEQVLTFENFKNRGLVCLSHGNTEHLLDLLEDAQATLAVMLTSRHIGPLRDEAAAWALKLKEICEVLEQWLTVQDLWKHLEEVFSHGATAKELPQEYNRFARVDKSYMKMMKRAYETKNVLQCCVGGDVPKSQMLKHLFEELEICFKSLMGFLDSKRKVFPRFCFVTDAVLLGMLSKPHNLESVKPYIRCIFSSVRDV 1539          

HSP 3 Score: 185.652 bits (470), Expect = 3.772e-46
Identity = 125/452 (27.65%), Postives = 216/452 (47.79%), Query Frame = 3
Query: 5517 PLQIDKIFSSSREEIV-LNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKM--KTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLIN---EHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTL 6854
            P  I    SS   E V L  ++ +   V  WL  L   I+ES+       I  I +  S+EE + K+P+Q+C   L   W+ E    +++I+ D+K++ +  K+F + +SR+P  L R SWK +D P+ A  R R+ ++    +YLRD+L +L  +K+RDV DFE  + I+         +V  + F +  L      G EF G    +A TP TE+  L+L  ++      ++ G + +GK+  ++ LA L  RY +   C S M    +   + G+A  GCWG+LD    ++   LS+ +  I  +  A++      ++ E + I +    + F T C    ++E  LP  +   FR V++  PD+  IL+  C    ++  R LA RL  V +  S  +    +H   + +L  ++    K  A +  +  K  T   + G+ +   ++
Sbjct: 1609 PQNIATAVSSELGETVQLRTQVPLNSSVDQWLAALLKSIKESLHADIVQCISDIDSNQSVEEWAGKYPAQVCRLGLLYLWTKECEAGITDIRIDRKAIPNAVKRFWSGLSRLPNLLARCSWKHSDGPMPAYHRVRIEALLSSGMYLRDTLDDLGRRKLRDVVDFEWKRNIRFYEDNGAEGTVAVEPFLIHMLDAQLPYGCEFYGDESGLALTPITERCFLSLTQAIWGFSGGALQGPTGTGKTETVKGLAYLLGRYLLTLSCSSRMGALGVAKIIIGLAEEGCWGLLDEFHQVNNDVLSVLLSEIQSVLLAVRAGQNMCTLDEGKEISVHQNFSVFLTFCTTRHNYE--LPPEVHALFRSVSMVMPDVALILRAQCAGQGFKSPRMLADRLKLVTEICSKQLGASVQHNFSLASLLGVIQYAGKRRAAQGPMGGKLNTTQADFGRPSSSQSV 2058          

HSP 4 Score: 129.028 bits (323), Expect = 5.522e-29
Identity = 84/355 (23.66%), Postives = 169/355 (47.61%), Query Frame = 3
Query: 2070 FLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQV-----AGMHSEFSKLLKYLATQKIYNFNHLLSKNWDSNEFTEAINKDLLAKKSTVQRTLEACSNILKEITEIISIVEKLDPNSSL 3119
            +L  +F   +   +AL I++ F+ +  R  ++ V   K  E+F  F++++    + Y+  K     +    +V   + W + LL  IE PM  F++ K  +  +++  IVK YN+++  L+  ++ +++ W S VD+  + LK  LL       ++ +N+   +  +I+E R + R+  +L   A+E+LK E+R+K +   L   +  + +V   +   +  L   H++ V    Q G S+L+W ++NID ++H+V      L  I+N +      G+  +  ++ + L    +++     SK W   +F EA  + +      +   ++   N L+E+  I        P S L
Sbjct:  324 YLKGVFTLKLNIRKALGILTSFNCVMTRPGLRAVFSEKFLEVFSWFENELEDVQKVYEAEKESPPLVRNAPIVSGAITWSRNLLRRIEEPMRVFKENKFTSSYRDFNRIVKFYNRIATALVKFENLWLSLWKSRVDSACSGLKATLLTRHPNTKQMVVNADGRIFELIHECRCLNRLGVELPENAVEILKQEKRLKQYKQSLELILQDYFSVCAKVPAPLTRLLTPHMESVQHYLQPGLSTLNWNSMNIDAYVHQVHTATNRLREIVNNIEDVIKEGVEEKIEEIRRIL----LFDPKLAYSKVWQVEDFVEAEGRAIKTLGRVLYDLVKDVENALQEVIAIAHQRRITSPGSPL 674          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO35852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK91])

HSP 1 Score: 438.728 bits (1127), Expect = 1.279e-122
Identity = 488/2146 (22.74%), Postives = 915/2146 (42.64%), Query Frame = 3
Query: 3627 LQSTVENLNEF-------DFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELIN-LRQYWSTLIKMAESQR-NKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLD------DVYVK-LTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSR----RGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCC-ISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEI-KSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDL--GYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNF-FFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNR---NDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLE--NKRS--IEVIALTKIFDKI----LDPVIQYIIQNHKELSINS-VTIAFQNSLKVLSQML------VDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKR----------ETLVLPDDDNSI--CIFDYYVDESG-EWDLWSSLLMDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLATNSSA-DLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSI-ENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEED-SSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKR---EYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSH---LSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQ-FRSRIRRDLHILLCLPPKNDIILESLNKYPGI 9866
            +Q+T+  LN++         LWK+    +  + + AK  T  +  EK+    +L   +   P   +++ + ++       + +    W  + G+ L++ AK  L       ET+  +LK+    LE L  +L ++  I D+ L ++     I+  Y  L+++E+ +    E EL+N + Q W  L    ES+R +  L   +  F +    Q+  FT ++ +F+  F  E PS  G+D       L+ F+ +Y+ +E+++  L    +LFGL +  + EL+ M+++L  L Q++ +Y+K  +    + + LW+ +D+       D Y+K L     E  ALP     +E   E K  I        + ++L ++ +R RHW ++M +TG  F L   TF   ++  + L      I  I   A KE+ +E  + ++ + W         + +    RG V+  V   + +LQ L+D+ + L +M  SR + P  +   +W   L  I EV+++W+ VQ+ W+ LE++FI   I   L +E ++F+ +DK++ K M    +   V + C   N   +  F+ N   GLE C  SL  YL  KRN F R +F+ D  +LSIL  S+D   +  H+  +F  +  L       +      + SS  E +     +  +  V +W+  +  E+  +   ++ +AI       +  E   ++   +  +   + W+ E+     ++ K DK  + + A+K + QI  + + +  N  K+         R++  ++ +  ++ RD + +     I D  +FE    ++      D   +   +L    CT +   GYE+ G    +  TP T++  LT+  +L      +  G + +GK+   ++LA+      V  +C   M  +S+     G+A  G WG  D    +D S LS+    I  +++++   S+ +  ++ EG  + +      F +  P  +    LP ++   FR V    PDL QI +       +  ++ LA ++  + K AS  +++       LR++ A L  A   K+        GS E+                                              E  +++ A+ ++ LP    E+      ++ D F G      +       P+  +A+       +  +  H  +K VQ+Y  +      ++ GPT  GK+  +                  N L++       A   L  H+   ++N                 E++G       D+ DGL + ++R +N+    +   +IVFDG +   W +N+ S++DD   L L +G R+   K+   +FE+  ++ ASP  VSR G+VY     +G+R   P W +  N RS   E   L ++F+K     +D +++ I+   +   + + + +   N ++ LS ML       ++    G    + +F+   IWS  + + +  +     L+KR           T+V P +  S    +++YY D     W  W  ++ +      L+   E+LV T+ T+R  + L +       V L+G  G+ K+    N+ R  D     +    +S  T S  ++  LEAN+E R    YG    K L + ++D+N+P   ++D    ++P  +L+ LL    + +         + D   + ++       + +DPR +  F    +  P    L+ I   +   H+    +N Q   D    + ++T +LY  +   L    T  + H  FNLR ++ +  G+     D   S    ++ W     RVF D L  + D            +   SG ISS     ++N   FS   D + R+     + R T     P++   + D ++ +   E ++ + N+         +NL+  D+ L  +  IHR + +   GH +L+G  GS    L+++ + +       I      ++ +  + +K +   +G E KK   L T  ++     L+ +N+++ SG  P L+P DE  G++  V    + E +   +    + I Q F ++   +LHI+L + P  DI+      +PG+
Sbjct:  835 VQNTLGTLNKYLNRWKRYRLLWKLDKSNMVMKFA-AKNPTCIAYDEKLQFYSNLVLEVGTQPMSRDVEFVRLNLDPLATTIQANARAWVKELGKMLNESAKDNLMTLKGEIETLCTDLKRAPDTLEDLKFVLRVIADIRDMSLDVELRTADIKERYRTLKMYEIEV-SDNETELVNGIDQLWDDLF--VESRRVDYSLVSVKMKFTEITQDQVSNFTSDISKFKESFINEGPSSIGTDLDAGVELLKKFQEEYNTFEKERQELTNAERLFGLSITMYPELQQMEKELKGLEQVFGIYEKQKEARDEWANTLWANLDVSVLSDGIDGYIKQLKRLPREVKALPLCHVLEEKMKEFKNSI-------PLFSDLKNEALRERHWKKLMDMTGMKFDLNPETFTLQNMFAMELHNFSDVIADITASATKELGIEKGIAEVSDTWNAMKFTVAKYMKGTQERGFVLGTV---DEILQILDDNAMNLQSMSASRFVGPFLETVNKWEKSLSHIGEVVEVWMVVQRKWMYLESIFIGGDIRAQLPEEARKFDDIDKTFKKIMADTAKNPKVLEACHAPNRLDQLQFIVN---GLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SHDPTCVQEHMIKMFDNIASLRFQEGSNKETLATAMISSEGESMDFRQAVPAEGRVEDWMTSVLKEMRRTNRLITKEAIYNYCNQITRIEWMMQYQGMVALAGNQVWWTWEVEDVFRKVKKGDKMGMKNYARKCHRQIDDLVVKVRSNLSKN--------DRKKFNTVLIIEVHARDIIDSFVRDSIMDSREFEWESQLRF---YWDQAPD---ELMIRQCTGEFGYGYEYMGLNGRLVITPLTDRIYLTITQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDFKSIGKIFSGLAQCGAWGCFDEFNRIDVSVLSVVSTQIKTLQNSL---SSGLKRLQFEGTEIALDARMGIFITMNPGYAGRTELPESVKALFRPVVCIVPDLQQICEIMLFSEGFLYAKVLAKKMTVLYKLASGQLSKQSHYDFGLRALKAVLVMAGELKR--------GSPELS---------------------------------------------EDVVLMRALRDMNLPKFVFEDVPLFLGLIADLFPGLDCPRVRY------PNFNDAVESSLTDNKYILLPHQADKVVQMYETMLTRHTTMIVGPTGGGKTVVI------------------NTLAM-------AQTRLGMHTKLYVMNAKACTV----------IELYGTLDPVTRDWTDGLLSNIFREINKPTDKNERKYIVFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQKHCALLFEVADLRYASPATVSRCGMVYVDPKNLGYR---PYWQKWCNARSNAKEREELDRLFEKYVPASVDLILEGILDGKQGKKLKTIIPLTNLNMVEQLSHMLDALLPPAESSNFLGPDVTEAIFISSLIWSTGAGLLEDGRIVYDQLIKRLAGIPANPAEGTVVGPGELPSAQPTLYEYYFDSKKLLWVPWLDVVPEYVHNPDLKYN-EILVPTVDTVRTTWLLQLMVNIHRPVLLVGETGTSKTATTANYLRGMDQDTTLLLNINFSSRTTSINVQHNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMP---QVDEYGTQQPIALLKLLLEKGGMYDRGKELIWKNVRDIGFVAAMGKPGGGRNEVDPRFISLFSVFNVTFPSEESLRRIYSSILTGHLQPFPKNIQ---DLVEHITTSTLELYTNIIRDL--PPTPSKFHYIFNLRDLSRVYQGLCLTTPDRFDSPAKFVRVWRNECMRVFCDRLTNEAD------------RETVSGYISS---LVDQN---FSEHTDIAMRDPCLFGDYRNTL-TEDPRLYEDVVDYDATKAIFEEILEEYNMDHA-----PMNLVLFDDALEHLTRIHR-VIRMDQGHALLVGVGGSGKQSLTKLAAFSAGCGVFEITLTRGYDENSFREDLKELYNSLGLENKKMVFLFTDAHVAQEGFLELINNMLTSGMVPALYPDDEKEGIIGQV----RDEANKAGVPPARESIWQYFVNKCANNLHIVLAMSPVGDILRTRCRNFPGL 2810          

HSP 2 Score: 132.109 bits (331), Expect = 5.927e-30
Identity = 266/1296 (20.52%), Postives = 532/1296 (41.05%), Query Frame = 3
Query: 11439 EYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERA-IFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSK-IEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSD--LHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRN-VKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIES-------SERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLP-CFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLS--LRATSPSSAILMKYLNNSYETNILFNQIHSSVKPRIIQSRVIDYSKEGLQLFYQQLQNQMSNIHEICLDSSLTTSNLTALNSVYIVIHLSST-----EHISSIHK--RVMSYIDEMNSF-----QRSALLKSRDQNVVTYNLFFTLPQNHSGVSSSQMNKMTTVYLDYPSNLRDFLLHLFKIGFLSANSIPSMSLDLLPVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFESHS------NISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVR--KEFEF---PKLKYHCPSVL---YSP--NVKFSEIKKAFLNISPFLFESAEACHLSSNLLTKINSEK-ILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPK-STIESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLL-AIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGIT---SSKWMLRGVFITIN 15179
            +Y+  + ++  ++ E + +  RL     L+  +   + +W    +  +D+R  +   CL+ +A+L+Y G   ++ R   L         + ++      SK  ++   L +++E+SK  S  LP  +  I+N       S    + L  D  ++A++W+ +     N  V++++D     +LE  +  G  ++  D D +    D ++  V     +  +  + F +L   + EV+  P+FRL+L+T  S  +      S   +V++  ++  L ++ LS  +   +  ++ + ++L++E  + KR L  LE+ +L +L+    N + ++E   T+        E++  L+          K  D Y   A   A +F + S M+ V   Y      YL +FD  +         S+RL N  I+D LT     Y+   + + +K +FS  ++I+I +    ++  + ++ +   ++AL+             S+ +KP+ WM ++   +V  L    P  F  + +++ ++  E  W+   D ++PE S+     ++ S+  +Q+L L+R  R DR+  A   F+   +  K+   VTP  +     L  ++P S ++      S   + L      S                G +L +  +      +    L+++++      L + ++++    T     E IS  H   R+    D    F     QRS  + +   N +  NL  T  +      S+QM        D P   + F   +F +GF  A                      +++ R  Y  +G+     I    N S+ + +   + N + + S       I W  L+Y + E++YG +V  + DR  + +  D ++        + F F    ++ Y  P      Y P  +V    I++  L  +P +F      H ++ +    N+ K + +  ++   QT  +   IS +  +TK       I  ++  KLP    ++ +++ L ++T   +    L++EL  ++ +   +   +   ++ +  E+G  +S     V  SL    +P  W  KL  P      S  +W+     +     + +  N  +    WL     P+S L A+ +          DRS  Y  V    ++ N D+  + E    G +V GL+L G  +D     L     K +   LPV  +    +   K +N+  +  P++  S  +    + +    +  T   +S W+L+GV +T+N
Sbjct: 3128 QYDDAMREKSSLQEEAEIMERRLIAADKLISGLGSEKIRWTKDLQDLKDQRVRLLGDCLLGAAFLSYLGAFTWDFRRDML----RKQWENDVIQREIPLSKPFKVDVLLTNDVEVSKWTSEGLPPDDLSIENGILTTQAS---RYPLCIDPQQQALNWIKKKEEKNNLKVVTFNDHDFLKQLELAIKYGFPILFKDVDEYI---DPVIDNVLDKNIKG-EPGREFVVL--GDKEVDYDPSFRLYLNTKLSNPKYTPAHFSRCMVVNYTVTMKGLEDQLLSVIVGVERKELEEQRERLIQETSENKRLLKDLEDTLLRELATSQGNMLDNVELVQTLEDTKTKAVEVSEKLKLGAKTAIDIDKLRDGYRPAAKLGAVLFFVLSEMSVVNSMYQYSLNSYLEVFDLSLRKSLPDTILSKRLKN--IMDTLTMNVYNYACTGLFERHKLLFSFQMTIKIMEADGKLKQEELDFFLK-GNIALEK------------SSRQKPYSWMPDQGWEDVIRLCQVTPEVFGSLADDIERN--EKGWREWSDLDAPE-SHPFPGKYEESLSDFQRLLLLRCFRVDRVYLAITHFVTGRMGEKY---VTPPVLSFESILEQSTPFSPVIFILSPGSDPASDLMKLAERS-------------GFGGNKLKFLAMGQGQEKLALQLLETAISRGQWLMLQNCHLLVKWLRTLEKVLERISKPHPDFRLWLTTDPTPEFPIGILQRSLKVVTEPPNGLKLNLRSTYHK-----ISNQM------LADCPH--QSFSPLVFVLGFFHA----------------------VVQERRKYGKIGW----NIAYDFNESD-FRVCMTLLNTYLTKSLQNTDVKIPWASLKYLIGEVMYGGRVIDDFDRRVVKTYMDEYMGDFIFDTFQPFHFYNNEEVDYCIPKNGENKYDPGRDVYVDYIEELPLANTPDVF----GLHPNAEIGYYTNAAKDMWLHLVELQPQTAGDSGGISREEFITK-------IASDIQGKLPPLFDVDRVRKNLSEITPTAV---VLLQELDRFNVLIRRMSTSLINLQRALAGEVG--MSSELDEVSRSLFNGMIPNIW-RKLA-PATLK--SLGNWMEHFQKRLDQYNKWV--NDGEPAVIWLSGLHIPDSYLTALVQATCRKHGWPLDRSTLYTTV---TKYHNADE--VTERAHSGCFVSGLYLEGASWDLAESCLRRPKPKVLVEELPVLKVIPIESHRLKLQNT--FRTPVYTTSQRRNAMGVGLVFEADLATTEHTSHWVLQGVCLTLN 4307          

HSP 3 Score: 59.3066 bits (142), Expect = 6.133e-8
Identity = 74/382 (19.37%), Postives = 165/382 (43.19%), Query Frame = 3
Query: 2088 LRPMRTGE-ALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVD-NCVAKLKNPLLVVDLVGNKVKINS------PENLLAIINETRNMIRIQSQLSPAAMEL-LKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAGMHSEFSKLLKYLATQKIY-----NFNHLLSKNWDSNEFTEAINKDLLAKKSTVQRTLEACSNILKEITEIIS-----IVEKLDPNSSLYESEDLIFGQMKEMYNKSL 3176
             + +R+ E A  ++  F +++ R++I   +  K  ++ V F  +            NQ         V   ++W + L   I+  ++RFQ+++++   +  +   K+Y  V++ +  ++      W   V+ N +  LK  LL      +     S      PE L  II ET+ + ++  Q+   A  + L+ E+ +KY    L   +  + TV  S+      L  ++IK + +  + GS  L+W ++ I  ++ +    IG  ES++NQ+     +    L+ +   +++       N ++    D+ E+ + + K    +   + R   A   +L ++  +++        KL P  + +  E+ ++  + +M  ++L
Sbjct:  380 FKSLRSAEGAFDMLLNFRHIRSREAINSQMMKKFNDILVQFGKE------------NQPP-------VAGAISWERSLFYRIKRTILRFQEMEDMLNNEHGKQASKKYLSVARLMKEYEDKKYEAWREQVEANLLIYLKKNLLTKPSTSSATTHRSYVVDFAPE-LAEIITETKYLEQLGFQVPELARNVALQEEKYLKYV-DGLKLMLERYHTVTGSLDVAETQLLDDNIKELKRVLKPGSKRLNWNSLGISDYVTRCGQAIGKFESLVNQIQKNAKDIYSRLEMIEITELFKTPPPKTNGIMP---DAKEYFDFLEKGRSQELEVLARKYRAIGPLLTKMEGLVAHTNTGRAPKLQPYYAFW--ENAVYEALTKMVTRNL 735          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 599.742 bits (1545), Expect = 5.090e-171
Identity = 520/2104 (24.71%), Postives = 943/2104 (44.82%), Query Frame = 3
Query: 3765 LKNNLQRLPKEIEIDCLVISTKVFRAVL----LSLLNDWQ---NKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKL--LNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPL--QIDKIFSSSREEIVLNNKIAIKDEVVNWLN-LLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLS----HLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSH--LMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWR---RVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGEL---HIQRLFVFCFIWSLNS--QISDLNKQAI----TTLLKRETLVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYL-SLQLTGE---VLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDS----IENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNC--ERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETS---NDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            L+  +   P  I +  L + T   +  L    +  +ND+Q   NK  Q   ++   ++DEA +       +L + + +L+ +   +  +D+I    + I+    PIE  Y  L  ++ P+ + E  ++  LR YW  L+  +   +++L  L  K   F +EL+  M     E   F   +D + P   G  P +V  +L  F+NQ+     K  T    +KLFG+ V    +L  ++ +L LL +LY LY    +    + D LW+ ++++ +  +L +F   C  LP  LKE +++ +LK  ID   +   +L  + SK +  RHW ++ +VTG N  +E+  FK  ++     L+ K+EI+ IC  A KE ++E KL ++  EW  +   F     RG ++L    T+ L+  LEDS ++L ++ ++R+  P K +  +W   L   S++++ W+ VQ LW+ LE VF+   I K L +E K F  +DKS++K M R +E  NV Q C+ +  +    L ++ + L++C  SL GYL +KR LF R +FV D  +L IL  ++D   I  HL ++F  +  +     F E +  +I  + S  +E + L+  I  +  V  WLN LL          +   A+   + G  L +    F +Q+    + + W+ +   A++    D+  +S    H     NT I              T   + A++R +  ++    ++ RD   +L    I +  DFE  K  +       +  + K  +     + D   EF G    +  TP T++  +TL  +L      +  G + +GK+  I+++ R   +Y V  +C   M    L     G+A +G WG  D    ++   LS+A   I  +    K +  T    + + + +      F T   P  +    LP N+   FR V++  PD   I++       +  +  LA + +T+ K     +++       LR+I++ L    A K+                                   +P+ +                   E  +V   + ++ L  +  E+E+    +++D F G        + +   P+L  AI K  K++   + +H     K +Q+Y   R   G++  GP+ SGK+T + I + A+                                      Q H    + P +     +MFG       D+ DG+F+ LWR   +  + + I WIV DG +   W +NL S+LDD  TL L +G R+P + N K VFE +++ +ASP  VSR+G+V+  S+++GW  I   WL+ +   E   L ++F      + ++ +Q+  E  ++ +          + Q L+  KE  GEL   H++RL++F  +WS  +  ++ D  K  +      +++R    +P       +FDYYV   G W  WS+ +    EY+    +T +   +LV  +  +R  + +D  ++    V LIG +G+ K++I+ +   K D          +S  T     +  +E+ ++ R G  YG    K ++++I+D+N+P   E         NE++RQL+      N + P E   + D   + ++       + +  RL R F      +P  + +  I   + E H  +    IE  Q TI    QL+  T++L++   + ++   T  + H  FNLR ++ I  G+   N +  +S  +LL  W +  +RV  D   +  D++WF+ TL  +++    GE     V+C  ER F+ F  +   +   +  +     +    PK+   +    S ++ L   +  + +    + ++++   + ++ +I + R I  P  G+ +L+G  GS    +  +A  IA   I ++  +   N   L++ +KS+ R  G +GK  + + T   +K    L+ +N+++ SG+   LF  +EM  +LS +   MKRE       TN +L + F SR+R +LH++LC  P  +       K+P ++S   ++W        L+  +++F++
Sbjct:  676 LETKINSEPDYINVGALALFTASLKTSLTVETMQWMNDYQMCCNKKYQQELEQILAIIDEAGK-------KLNRPIKDLDDIRIAMAAIDKIRKDQISIELQIGPIEESYAMLNKYKFPVQKEEGEKVETLRLYWDKLMFRSTEVQSELETLQPK---FKKELESNMIVLQEECQNFYQDYDKDGPMGVGLAPQDVSDRLIMFQNQFDNLFLKYTTYCDGAKLFGITVTQHPQLMKIRTELTLLQKLYGLYNNVIETVNGYYDILWTNINIEKINNELLDFQTRCRKLPQALKEWQAFLDLKRTIDEFSECCPLLELMTSKAMMARHWKRITEVTGHNLDVESENFKLRNIMEADPLKYKEEIEDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLMSNRYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGD-VTMGQLLPHLLEQLDSCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQ----FHEKIYDRILAVSSREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFLNLLNTLID------------MTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYF----NEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDRCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMN-PGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRA----------------------------------NPSDT-------------------ESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIE------LNKEGYPELEAAIDK--KIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTE----------------------------------CGQPHREMRMNPKAIT-APQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHI-WIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSL-EFKMDMLEAFVIMQCINMLQGLIPLKEQCGELPREHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREE-TMFDYYVTAEGHWVHWSTRV---EEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVT---NEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTI---PQLVLLTRRLWQ--LTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQL-GEEHKKVVDCGVERYFVDFLRDPPEATGEEPEE-----SDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTP-GGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRLYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPP-TNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLS 2629          

HSP 2 Score: 108.612 bits (270), Expect = 2.094e-22
Identity = 152/635 (23.94%), Postives = 290/635 (45.67%), Query Frame = 3
Query: 11397 EFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDE-RAIFIQCLISSAYLAYCGPLNFEQRSKFLD--FCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVIS--YSDLHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKM-YEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSERLSN-----KSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLI---SPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKN---SIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLSLRATSPSSAIL 13250
            E +  + E   + +EY   + ++  +  + K    ++ +   L+  +   +E+W   SK++  + + +    L+++A+L+Y GP N E RS  L+   C    RS     N      ++IT+ L     +S+     LP  E  I N   +   +    + L+ D   +  +W+          + S  +    N LE  L+ G+ ++I D    +L  D ++  V    F  +K   T+K+ +  + EV+    F+L++ T          +++ T ++ F  +I  L ++ L R I   K  ++ E   LL +    KRK+ +LE+ +L  L++   ++   E+   ++   K   EE+N  LQ           + + Y  +A R + ++ + + M+ V   Y     ++L LFD  +  S + SN     KSII+ +T K   Y+   + +E+KF+F+LLL+++I     NV     E+L      +S+ LK+ P             +KP +W+ + S +N+  L+  L  F +IL+ +     E  WK  FD E+PE     E +  N   S+D +++L LIR   PDR +  +  +I++ +  K+   V   D+  +   ++P + ++
Sbjct: 2942 ELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNN------LDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAA---RFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVG-EEL--DPVLDNVLEKNF--IKTGSTYKVKI-GDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNV--THKEFLTLIKGGASLDLKTCP-------------QKPAEWILDMSWLNLVELSK-LWQFSEILDQI--SHHEKLWKSWFDKEAPE-----EEVLPNSYQSLDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVI-LDVEGTWEESNPRTPLI 3537          

HSP 3 Score: 97.4413 bits (241), Expect = 4.524e-19
Identity = 106/473 (22.41%), Postives = 203/473 (42.92%), Query Frame = 3
Query: 13776 PVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFESHSN---ISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTIESIQERLKKVT-----NNFIYSKT--LMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGV 15164
            P+++  + L S ++ R  +  LG+     I    N ++    VQ + N  +       +SWN ++Y + EI YG +VT + D+  + + +  W   N   ++F F K  Y  P    S +   + I+      +P +F      H ++++  +    K +++ I     +I  K + S   +    E  +  +  ++  KLP   I    +RL+K+      N F+  +   + + +M+  S   ++   I  T  +IM+E    + DA +  +Y     ++P +W+      K ++  +   W + LL + +  +  +   K +  C+W+  F  P+  L   K+E++    R ++      +    E T   KD I  PP+ G+YV+GL+L G  +D+    L++   K +   +PV  +    N +  P     Y CPI+   T      +     K       W+LRGV
Sbjct: 3674 PMLYCVAFLHSTVQERRKFGPLGW----NIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYK-GYGIPKC-SSVDQYLAYIQGLPAYDTPEVF----GLHPNADITFQSKQAKDVLDTI----LSIQPKDSSSGGGETR--EAAVSRMADDMLEKLPPDYIPFEVKRLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGT--IIMSE---NLRDA-LDCMYD---ARIPARWM------KSWASSTLGFWFTELLERNRQFQTWLF--KGRPNCFWMTGFFNPQGFLTAMKQEIA----RANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNVVKDPR---LYSCPIYKKPTRTDINCIASVGLKTTQPPEHWVLRGV 4106          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 488.419 bits (1256), Expect = 2.754e-137
Identity = 517/2222 (23.27%), Postives = 939/2222 (42.26%), Query Frame = 3
Query: 3402 FILLVKYEIPMIKFEPELDAIQSIIEQMGQDIMAFHNDVSDFSGRKLNL-------YIKLESDLFYEFSQIISLKYSE-----------SRLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKI-TQVLH---LKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQ---NKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIES-MYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKL--LNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLN-LLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLS----HLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSH--LMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRV--NRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGEL---HIQRLFVFCFIWSLNS--QISDLNKQAI----TTLLKRETLVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYL----SLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSII---RGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNC--ERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETS--NDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWL 9893
            F + V   IP I   P L+ +Q  + Q+ + +++    V  +S  +L+L        I LE D     ++ ++  +                  ++  +N++E   + K+ S       S  K +  N L  K  +Q+++   L+  +   P  I +  L + T       +  +ND+Q   NK  Q   ++   ++DEA +       +L + + +L+ +   +  +D+I    + I+    PIE   Y  L  ++ P+ + E  ++  LR YW  L+  +   +++L  L  K   F +EL+  M      V+Q                        E  +N Y  Y++   T    +KLFG+ V    +L  ++ +L LL +LY LY    +    + D LW+ ++++ +  +L +F   C  LP  LKE +++ +LK  ID   +   +L  + SK +  RHW                               K+  + IC  A KE ++E KL ++  EW  +   F     RG ++L    T+ L+  LEDS ++L ++  S +  P K +  +W   L   S++++ W+ VQ LW+ LE VF+   I K L +E K F  +DKS++K M R +E  NV Q C+ +  +    L ++ + L++C  SL  YL +KR LF R +FV D  +L IL  ++D   I  HL ++F  +  +     +   L +    S  +E + L+  I  +  V  WLN LL          +   A+   + G  L +    F +Q+    + + W+ +   A++    D+  +S    H     NT I              T   + A++R +  ++    ++ RD   +L    I +  DFE  K  +       +  + K  +     + D   EF G    +  TP T++                            I+++ R   +Y V  +C   M    L   +  +A +G WG  D    ++   LS+A   I  +    K +  T    + + + +      F T   P  +    LP N+   FR V++  PD   I++       +  +  LA + +T+ K     +++       LR+I++ L    A K+                                   +P+ +                   E  +V   + ++ L  +  E+E+    +++D F G        + +   P+L  AI K  K++   + +H     K +Q+Y   R   G++  GP+ SGK+T + I + A+                                      Q H    + P +     +MFG       D+ DG+F+ LWR+    + + I WIV DG +   W +NL S+LDD  TL L +G R+P + N K VFE +++ +ASP  VSR+G+V+  S+++GW  I   WL+ +   E   L ++F      + ++ +Q+  E  ++ +          + Q L+  KE  GEL   H++RL++F  +WS  +  ++ D  K  +      +++R    +P       +FDYYV  +  W  WS+ +    EY+           +LV  +  +R  + +D  ++    V LIG +G+ K++I+ +   K D          +S  T     +  +E+ ++ R G  YG    K ++++I+D+N+P   E         NE++RQL+      N + P E   + D   + ++       + +  RL R F      +P  + +  I     G F      IE  Q TI    QL+  T++L++   + ++   T  + H  FNLR ++ I  G+   N +  +S  +LL  W +  +RV  D   +  D++WF+ TL  +++    GE     V+C  ER F+ F       R+  +       +    PK+   +    S ++ L   +  + +    + ++++   + ++ +I + R I  P  G+ +L+G  GS    +  +A  IA   I ++  +  N   L++ +KS+ R  G +GK  + + T   +K    L+ +N+++ SG+   LF  +EM  +LS +   MKRE       TN +L + F SR+R +LH++LC  P  +       K+P ++S   ++W 
Sbjct:  795 FRVDVVLSIPDIVINPALEKVQEALNQIVECVVSVSKGVGQWSKDRLSLGKMDERCMISLEQDNSESAAEDVATTHRSLAGSISSASVIQAFPFRNYYKNVSENKEVLKLVSILSSSITSTKKFNQTNPLLSKFESQIVYYQDLETKINSEPDYINVGALALFTLTVET--MQWMNDYQMCCNKKYQQELEQILAIIDEAGK-------KLNRPIKDLDDIRIAMAAIDKIRKDQISIELQIGPIEQESYAMLNKYKFPVQKEEGEKVETLRLYWDKLMFRSTEVQSELETLQPK---FKKELESNMI-----VLQ------------------------EECQNFYQDYDKVYTTYCDGAKLFGITVTQHPQLMKIRTELTLLQKLYGLYNNVIETVNGYYDILWTNINIEKINNELLDF-QTCRKLPQALKEWQAFLDLKRTIDEFSECCPLLELMTSKAMMARHW-------------------------------KRITEDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLM-SNYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGD-VTMGQLLPHLLEQLDSCQKSLT-YLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKYDRILAVS---SREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFLNLLNTLIDM------------TTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYF----NEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDE---------------------------TIKDMGRCLGKYVVVFNCSDQMDFRGL-GRIFKLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMN-PGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRA----------------------------------NPSDT-------------------ESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIE------LNKEGYPELEAAIDK--KIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMT-----------------------------------CGQPHREMRMNPKAIT-APQMFGRLDVATNDWTDGIFSTLWRKTLKAKKEHI-WIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSL-EFKMDMLEAFVIMQCINMLQGLIPLKEQCGELPREHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREE-TMFDYYV-TAEHWVHWSTRV---EEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVT---NEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFVIGEGHFCAQRGFIEEVQRTI---PQLVLLTRRLWQ--LTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQL-GEEHKKVVDCGVERYFVDF------LRDPPEATEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTP-GGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTLYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPP-TNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWF 2771          

HSP 2 Score: 99.7525 bits (247), Expect = 1.038e-19
Identity = 109/480 (22.71%), Postives = 213/480 (44.38%), Query Frame = 3
Query: 13776 PVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFESHSN---ISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTIE---SIQERLKKVT-----NNFIYSKT--LMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSK----WMLRGV 15164
            P+++  + L S ++ R  +  LG+     I    N ++    VQ + N  +       +SWN ++Y + EI YG +VT + D+  + + +  W   N   ++F F K  Y  P    S +   + I+      +P +F      H ++++  +    K +++ I     +I  K + S   +    E  +  +  ++  KLP   I     ++ERL+K+      N F+  +   + + +M+  S   ++   I  T  +IM+E    + DA +  +Y     ++P +W+ +        G+    W + LL + +  +  +   K +  C+W+  F  P+  L   K+E++    R ++      +    E T   KD I  PP+ G+YV+GL+L G  +D+    L++   K +   +PV  + +  N++  P     Y CPI+   T      +N  I+  G+ +++    W+LRGV
Sbjct: 3716 PMLYCVAFLHSTVQERRKFGPLGW----NIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYK-GYGIPKC-SSVDQYLAYIQGLPAYDTPEVF----GLHPNADITFQSKQAKDVLDTI----LSIQPKDSSSGGGETR--EAAVSRMADDMLEKLPPDYIPFEIQVRERLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGT--IIMSE---NLRDA-LDCMYDA---RIPARWMKQESWASSTLGF----WFTELLERNRQFQTWLF--KGRPNCFWMTGFFNPQGFLTAMKQEIA----RANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWM-YAENNVKDPR---LYSCPIYKKPTRTD---IN-CIASVGLKTTQPPEHWVLRGV 4152          

HSP 3 Score: 70.4774 bits (171), Expect = 6.532e-11
Identity = 109/442 (24.66%), Postives = 195/442 (44.12%), Query Frame = 3
Query: 11958 LHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKM-YEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESS------ERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKN---SIDAYQKLCLIRTLRPDR-IMQASYLFIQNTLNLKFKGTVTPSDIRLSLRATSPSSAIL 13250
              N LE  L+ G+ ++I D    +L  D ++  V    F  +K   T+K+ +  + EV+    F+L++ T          +++ T ++ F  +I  L ++ L R I   K +                         ++DD           E+   ++   K   EE+N  LQ           + + Y   A R + ++ + + M+ V   Y     ++L LFD  + SS      ER+  KSII+ +T K   Y+   + +E+KF+F+LLL+++I     NV   +   LI  +S+ LK+ P             +KP +W+ + S +N+  L+  L  F +IL+       E  WK  FD E+PE     E +  N   S+D +++L LIR   PDR I Q +  +I++ +  K+   V   D+  +   ++P + ++
Sbjct: 3205 FRNHLEESLSLGRPLLIEDVG-EEL--DPVLDNVLEKNF--IKTGSTYKVKI-GDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKRS-------------------------LVDD-----------ESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRP-ATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLASSKSSNTSERI--KSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGASLDLKTCP-------------QKPAEWILDMSWLNLVELSK-LWQFSEILDQQIS-HHEKLWKSWFDKEAPE-----EEVLPNSYQSLDCFRRLLLIRCWCPDRTIAQQARKYIRDAMGEKYTEGVI-LDVEGTWEESNPRTPLI 3580          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 353.599 bits (906), Expect = 1.941e-96
Identity = 442/2029 (21.78%), Postives = 852/2029 (41.99%), Query Frame = 3
Query: 3951 EELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELI-NLRQYWSTLIKMAES-QRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCC-----ISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEI-KSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDL--GYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQ-------KSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCIT------PENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNR--NDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQM------LVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSIC-----------IFDYYVDESGE-WDLWSSLLMDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSL-ATNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLIS-ATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYD-SESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKL---ETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNW 9890
            E++ Q     E L  +LG +  I D+ L ++     I+  Y  + +++       E EL+ N+ Q WS L   AES Q ++ L + R  F +   ++M+ F  ++  F   F+   P   G+D +E    +  F  + S    K+  L   +KL  L++  + E+ S+++ L  L+Q+Y++Y+   + +  ++  LW   D+  +   +  F +  + L   ++       L   +       S+L +L +  +R+ HW ++M+ TG +F +    F    L ++ L +   +ID I   A KE+ +EM   + +     Q+ V Q        V  +   +++L  L++  + L  M  SR   P  D   QW   L   SE +++WL+VQ  W+NLE +F    I   L +E K+ +++ K + + M+      N+ +CC     +S+ +  +  L+ IQ+ L N  DS       KRN F R + + D  +L++L  S D   I  H+  ++  +  L           +  + S+  E +     + ++  V +W+  +  E++ +   ++ +A+ +        +  + +   +  +A  + W+ E+  A+  + K DK +L   A++ + QI  +   L R        P     R ++ ++ +  ++ RD + N   + I++V DFE    ++           +   L    C   L  GYE+ G    +A TP T +  LTL  +L      ++ G + +GK+  +++LA+    + V  HC  +M   +L   + G+A  G WG  D    +  S LS+    I  I++A+         +   +S+ +  GI++ +  ++     LP ES +V         FR V +  PD+ QI +       +  ++ LA ++  + K A   +++       L S  + L  A         K K  S E+ +      LM        R I  P     K  + + PV L              +I  + P +       P   +T++EIL+ +              TI PD ++                   K VQ+Y ++   Q  ++ G TC GKS  ++    A                                   + L     +Y + P +   + E++G++  +  D+ DG+F+ L+R +N+  +    +I+FDG +  +W +N+ S+LDD   L L +G R+    +   +FE+  ++ ASP  VSR  VV+     + +      W++N+       L ++F+K +   I        ++++NS TI  +  + ++SQ+      L+++K    E+ ++  F+     SL + + +  +     L+K  + +   DD               ++D++ DE+ E W  WSSL+ +     +++     ++ T+ T R  + L+   +    V L+G  G+ K+ I+ N  + +   +       +S  T S  L+  LEANIE R    YG    K L +  +D+N+PK   +D    ++P  +LR LL+   + + K       + D   I ++  T    + +DPR +  F    I  P    L  I   + + H       +  I +  Q I+  T KL+  + + L    T  + H  F+ R ++ I  G+     D S  +    ++ W     R F D L  +TD    +  ++ +++  +                    E DS             A L+ P   +   D  + RE    ++      +          ++ +  +  +HR I +   GH +LIG+ GS    +  +A   A   + ++      N++   + +K++  ++G E +++  L T  ++     L+ +N+++IS   P LF  DE   ++  +     +E + +   +   + + F  +   +LHI+LCL    D +      +P ++S   ++W
Sbjct:  932 EKMHQRPDTFEDLKSILGTISDIRDMSLDVEIRVADIKERYRMMAMYD-------ELELVANIGQIWSNLF--AESRQVDQSLKDVRETFSKIKMEEMEAFKQDLSIFAESFNTHGPGTVGND-LEKLNIIGKFEKELSKIMAKQEHLTKTAKLLDLQLAEYPEIISIQKYLSGLSQIYNIYKAHKEAKTKWSQTLWVNFDIKLLQDGIDGFIESLMQLSKDVQTLPVAFFLDSHLKEFRVSLSLLLDLKNTALRD-HWNKLMERTGKSFDMNLQRFTLETLFSLELHKYANDIDEIVTSALKELSIEMTWKRTKFNMQPQLKVNQER------VFLLGAVDNILVNLDNDVMKLQCMAGSRFGGPFLDAIQQWEKNLTLFSETIEIWLQVQHKWMNLENIFCGEDICSQLPEEAKKLKKITKKFTEIMKSTENEPNIKKCCTVPGRLSSLWVLRNDLERIQKNLANHLDS-------KRNEFPRFFLISDDELLNVLG-SVDPACIQEHVIKMYDNIESLRLGVDSSGQTVVGAMVSNEGEVMEFRKPVPLEARVEDWIMAVLQEMKRTSRLITKEAVYHYV------DWIRSYQCMMVLAANRVWWTWEVENAIKNVNKGDKYALKKYAEQIHRQIDELVTCLGR--------PTKESDRLKISNVLVTDVHARDIVDNFVGRSIKEVHDFEWESQLRFYWV------KEHDSLFVRQCNTSLSYGYEYMGLNGRLAITPLTSRIYLTLTQALSMYLGGALAGPAGAGKTETVKDLAKALGLFCVVTHCTEDMDTITLGKIISGLAKCGFWGCFDEFNRIGASVLSVVSSQIQAIRNALTSHFKMFQFEGQQISLDDHMGIYITMNPSYERRPELP-ESVKVF--------FRPVVVVTPDVQQICEIMLFSQGFLQAKELAKKMTVLYKTAGIQLSKQPHYDFGLHSQKSVLKMAG--------KMKRDSLELSEDV---VLMR-----ALRDINLP-----KLVSEDVPVFL-------------GLISDIFPGLDSSRVGFPSFRETVEEILQKS------------NYTILPDQVD-------------------KVVQIYEIMLTQQATMIVGQTCGGKSVVINTLCQA-----------------------------------QTLGLCTKLYPLNPKATSVD-ELYGSFDPETRDWTDGIFSKLFREINQSTDKKERYILFDGDVDSQWLENMNSVLDDNKLLTLANGDRIRLQSHCALLFEVGDLQHASPATVSRCAVVFIDPKHLSYTPYWQRWMKNR-------LNRLFEKYVPSCI--------DVTLNSETIVPRTDVNMVSQLCLMLDVLLESKNSSAEV-LECYFLEALYCSLGATLVESGRLKFDKLVKSLSCLSTVDDEKAAAGPGEIPYLPTLYDFHFDETQEKWVPWSSLVPEYIHNPAMKFAD--ILPTVDTTRTHWILEQMVKIKRPVLLVGECGTSKTAIIQNLLKNTSTDSSISLTINFSSKTTSLDLQRNLEANIEKRTKDTYGPPIGKKLLVFFDDINMPK---VDDFGTQQPVALLRLLLDQGGLYDRKQKLSFKTIKDLGYIAAMRKTGGGRNEVDPRFLSLFSVFNIPPPATESLHLIYASIIKGHTRPF---KAAIQEVCQTITECTLKLFTTIITDL--PPTPSKFHYTFSQRELSRIYCGLTLTKPDFSCLTVEQFVRVWRNECLRNFHDRLTDETDKALVHGHIKKLVEEYF--------------------ETDSE------------AVLADP---ILFGDYRAAREECEQRVYEDIGDYDVSKAIFQLFEDAVEHLTRVHR-ILRSDRGHALLIGADGSWTQALTKLAAFTADCEVFEIILRRGYNELNFRNDLKTLYLKLGIENRRTVFLFTDAHIVEEGFLEQINNMLISM-VPTLFADDEKESIIKQINSEALQEGAGS---SKESVWQYFLRKSANNLHIVLCLSATGDALKTRCRNFP-LMSNTVIDW 2738          

HSP 2 Score: 98.2117 bits (243), Expect = 2.608e-19
Identity = 142/616 (23.05%), Postives = 272/616 (44.16%), Query Frame = 3
Query: 11397 EFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERAIFIQCLISSAYLAYCGPLNFEQRSKFL-DFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISY---SDLHNRLESCLASGQCMIIADC--DIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLS---RFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSID------NYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESS-------ERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKEN--HWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLN 13172
            +  N++KE   L+ +Y     ++ +   E K +  RL     LV  +    E  + + +  +    +   CLI++A+L+Y G  N++ R+  + D      +  G+  ++      +I  FL +++EIS   S  LP  E  + N       S    + L  D  ++A++W+       N   +S     D   +LE  +  G   ++ D   DI  +  + + R V       + E +T  +L   + EV   PNF+LFLHT  +  +    +     +++++T +  L ++ LS    F+EK       +H  L+ E  + K  L  L + +L +L     N+  ++N   I    K   E +  +++   L  +  K+++       Y  +A R A +F   S M  V + Y      YL+LF+  ++ S       +RL N  II+ LT     Y    +  ++K +FS+ ++++I +T   V   + ++LI              K      +  +KP +W+ +++  ++  LA   P   +   ++  D ++N  +WK  +D  +PE +    + +  S+ A+QKL L+R LR DR+ +A   ++  T+ 
Sbjct: 2999 DLNNMQKEASSLKEKYEDANLEKELQLDEAKLMERRLTAADKLVLGLTSEREWTKDLEELKQQHECLLGDCLIAAAFLSYAGAFNWDFRNNMVYDKWTQDVKQKGIPLSQ----PFKIENFLTNQLEIS-WGSEGLPPDEQSVQNGILTTKGS---RFPLCIDPQQQALNWIKNKEKDNNLKQVSSLNDPDFLKQLELSIKYGYPFLLQDVNEDIDPIIINVLERNVV------VSEGRTVIVL--GDKEVNYDPNFKLFLHTTLANPQYSPSVFEKALVINYST-LRGLEDQLLSVTTGFLEKV---FQQQHLLLVEEISENKTLLKSLGDSLLMELGTSTGNM--LDNTELIQTLEKTKTEASETIKK---LSVAQSKTVEFANLREGYRPVAKRGAVLFFALSDMALVNRMYQYSLTSYLSLFELSLQESLAHPNLQQRLEN--IINTLTYNVHNY----LFGKHKLLFSMNMTVKIEQTEGGVPQKELDFLI--------------KNLSGDGTKVQKPHEWIPDQAWQDITKLAELFP---EQFSSLPSDIEQNSTNWKSWWDLRAPEQAPFPLQ-YSESLSAFQKLLLLRCLRADRLHRAMADYVTVTMG 3565          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 330.872 bits (847), Expect = 1.018e-89
Identity = 298/1305 (22.84%), Postives = 558/1305 (42.76%), Query Frame = 3
Query: 6126 PTIAWTPTTEKYLLTLLFSLEHQKLSSIIG-----ESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSH--LMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRR---VNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHKELSINSV-TIAFQNSLKVLSQMLVDNKEIGGELHIQRLFVFCFIWSLNS--QISDLNKQAI----TTLLKRETLVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLS----LQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDS----IENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSES-SEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNC--ERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDV---ALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            P+  +  T   YL+T  +    Q L   +G      + +GK+  I+++ R   +Y V  +C   M    L     G+A +G WG  D    ++   LS+A   I  +    K +  T    + + + +      F T   P  +    LP N+   FR V++  PD   I++       +  +  LA + +T+ K     +++       LR+I++ L    A K+                                   +P+ +                   E  +V   + ++ L  +  E+E+    +++D F G        + +   P+L  AI K  K++   + +H     K +Q+Y   R   G++  GP+ SGK+T + I + A+                                      Q H    + P +     +MFG       D+ DG+F+ LWR+     + + I WIV DG +   W +NL S+LDD  TL L +G R+P + N K VFE +++ +ASP  VSR+G+V+  S+++GW  I   WL+ +   E   L ++F      + ++ +Q+  E  ++ +        + +L  ++     +    H++RL++F  +WS  +  ++ D  K  +      +++R    +P       +FDYYV   G W  WS+ +    EY+           +LV  +  +R  + +D  ++    V LIG +G+ K++I+ +   K D          +S  T     +  +E+ ++ R G  YG    K ++++I+D+N+P   E         NE++RQL+      N + P E   + D   + ++       + +  RL R F      +P  + +  I   + E H  +    IE  Q TI    QL+  T++L++   + ++   T  + H  FNLR ++ I  G+   N+ S +    +LL  W +  +RV  D   +  D++WF+ TL  +++    GE     V+C  ER F+ F  +   +   +  +     +    PK+   +    S ++ L   +  + +    + ++++   + ++ +I + R I  P  G+ +L+G  GS    +  +A  IA   I ++  +       LI  +KS+ R  G +GK  + + T   +K    L+ +N+++ SG+   LF  +EM  +LS +   MKRE       TN +L + F SR+R +LH++LC  P  +       K+P ++S   ++W        L+  +++F++
Sbjct:    3 PSSLFMFTNGTYLMTWCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMN-PGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRA----------------------------------NPSDT-------------------ESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIE------LNKEGYPELEAAIDK--KIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECG----------------------------------QPHREMRMNPKAIT-APQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHI-WIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSL-EFKMDMLEAFVIMQCINMLQGLIPLKVRLKLNQHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREET-MFDYYVTAEGHWVHWSTRV---EEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVT---NEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTI---PQLVLLTRRLWQ--LTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNHSSRNIIFQVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQL-GEEHKKVVDCGVERYFVDFLRDPPEATGEEPEE-----SDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTP-GGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSGLLEGLIAYLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPP-TNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLS 1188          

HSP 2 Score: 109.768 bits (273), Expect = 9.624e-23
Identity = 152/635 (23.94%), Postives = 291/635 (45.83%), Query Frame = 3
Query: 11397 EFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDE-RAIFIQCLISSAYLAYCGPLNFEQRSKFLD--FCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVIS--YSDLHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKM-YEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSERLSN-----KSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLI---SPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKN---SIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLSLRATSPSSAIL 13250
            E +  + E   + +EY   + ++  +  + K    ++ +   L+  +   +E+W   SK++  + + +    L+++A+L+Y GP N E RS  L+   C    RS     N      ++IT+ L     +S+     LP  E  I N   +   +    + L+ D   +  +W+          + S  +    N LE  L+ G+ ++I D    +L  D ++  V    F  +K   T+K+ +  + EV+    F+L++ T          +++ T ++ F  +I  L ++ L R I   K  ++ E   LL +    KRK+ +LE+ +L  L++   ++   E+   ++   K   EE+N  LQ           + + Y  +A R + ++ + + M+ V   Y     ++L LFD  +  S + SN     KSII+ +T K   Y+   + +E+KF+F+LLL+++I     NV     E+L      +S+ LK+ P             +KP +W+ + S +N+  L+  L  F +IL+ ++    E  WK  FD E+PE     E +  N   S+D +++L LIR   PDR +  +  +I++ +  K+   V   D+  +   ++P + ++
Sbjct: 1507 ELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNN------LDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAA---RFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVG-EEL--DPVLDNVLEKNF--IKTGSTYKVKI-GDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNV--THKEFLTLIKGGASLDLKTCP-------------QKPAEWILDMSWLNLVELSK-LWQFSEILDQVH--HHEKLWKSWFDKEAPE-----EEVLPNSYQSLDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVI-LDVEGTWEESNPRTPLI 2102          

HSP 3 Score: 90.8929 bits (224), Expect = 4.302e-17
Identity = 103/478 (21.55%), Postives = 203/478 (42.47%), Query Frame = 3
Query: 13776 PVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFESHSN---ISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTIESIQERLKKVT-----NNFIYSKT--LMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKP-----ENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGV 15164
            P+++  + L S ++ R  +  LG+     I    N ++    VQ + N  +       +SWN ++Y + EI YG +VT + D+  + + +  W   N   ++F F K  Y  P    S +   + I+      +P +F      H ++++  +    K +++ I     +I  K + S   +    E  +  +  ++  KLP   I    +RL+K+      N F+  +   + + +M+  S   ++   I  T  +IM+E    + DA    +  +   ++P +W+ +      ++  +   W + LL + +  +  +   K +  C+W+  F  P+  L   K+E++    R ++      +    E T   KD I  PP+ G+YV+GL+L G  +D+    L++   K +   +PV  +    N   +      ++   Y CPI+   T      +     K       W+LRGV
Sbjct: 2239 PMLYCVAFLHSTVQERRKFGPLGW----NIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYK-GYGIPKC-SSVDQYLAYIQGLPAYDTPEVF----GLHPNADITFQSKQAKDVLDTI----LSIQPKDSSSGGGETR--EAAVSRMADDMLEKLPPDYIPFEVKRLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGT--IIMSE---NLRDA----LDCMYDARIPARWMKE-----SWASSTLGFWFTELLERNRQFQTWLF--KGRPNCFWMTGFFNPQGFLTAMKQEIA----RANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNGSSEKKKKIVKDPRLYSCPIYKKPTRTDINCIASVGLKTTQPPEHWVLRGV 2680          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: DYNC2H1 (dynein cytoplasmic 2 heavy chain 1 [Source:NCBI gene;Acc:101163989])

HSP 1 Score: 250.366 bits (638), Expect = 2.791e-65
Identity = 389/1827 (21.29%), Postives = 767/1827 (41.98%), Query Frame = 3
Query: 3780 QRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECP---SMAGSDPIEVERKLESFRNQYSIYEE---KKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKL---WSVVDLDDVYVKLTEF---WDECLALPSKLKEKESYG-ELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTG--ANFQLEAGTFKCSDLTTIP--LLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHS-RRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQ-IDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPIT--ALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKF-QLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESF--EVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNR--NDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENK----RSIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSL-QLTGEVLVDTITTLRAK-----YFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEAN---IEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLATNSSADLLDPRLMRHFVPI----KIEMPEGSHLQSIIRGVFEC---HIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSE--PLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGE 9116
            +RLP + ++DC+ ++ +  ++ +  L+    +    +L    +  L     +    +E L      LE++       +QI     ++   +Q  E     L      +  +  + L +LR  W  L  + ES +  ++ E+  +       ++  +  ++ +F+  +D   P   ++ G D   +   L++ R++   ++E    ++ L+     F L    F   E +K D+  L+Q +SL   + ++++ F DK    W +      YV   EF   W + L    KLK+  S   +L+G++D    +  +L  +  + +   HW+ + ++ G      LE  TF  SDL  +   ++E  KE+  +   A+ E+ +   L +++            ++   G  +  ++    ++ Q+ D++ LL ++ +S +    +D+ + W  +L ++ E L     +Q+ W+ LE +F        L +E  RF+R+D+ +   M  +     V    +S+    K  L  I   L+ C  SL  +L +KR+ F R +F+ D  +L IL  + +   I  HL  +F  ++ +     F E  Q I  + S   E + L   + I   V  WL  L+ +++E++ +L  + +  +  G+ ++ L  ++PSQI   A  + ++ ++  A+ +     + L  L  + N+++        R    S D P T   + + +L+++ L +++    +  L+   +   DD+   K ++        +G  KF  +  +       YE+QG+   +  TP T+K  LTL  +++     +  G + +GK+  ++ L  L  R  +  +C   +  +S+     G+   G WG  D    ++ + LS   + I  I+D++K       ++ KE + L   +  F T     + +     LP N+ + FR VA++ PD   I +       ++    L  +L  V   A  L+         LR++                                T+++   S ++++ + P                    K  ++LVV+A+    +  +T  +      ++KD F G   +   ++++ I    L  + +EA+L    +    ++K ++L   +R   G+++ GP+ +GKST   +  AAL+                                  +  +    Y++ P +   + ++ G+      ++ DG+ T   R V R   ++ SWIV DG I PEW ++L S+LDD   L +P G R+    NV F+FE + +  ASP  +SR G+++     I    +   WL  +    RS     L   F + LD V +   QN   +  + V   F N+L  LS   V+ +   GE  +  L       +L ++  +  K+ ++    RE    P  D    +  YY ++S   D  ++      E L+L Q +   ++  I T   +     +F  +T        ++GP G GK ++L   +  S L +  +A    S  T S  +   L      +    G ++  K+ ++L L ++D+NLPKP +  +  +      L+Q L      +     E + L +  ++ S++T  S  +    L   F  I     I+ P+   L SI     +    H    +    +  +  QL  +  +LYE+V +   + + +   H  F    + +  L +  ++  +  S     +L+  +Y +RR+F+D L+   DL  F+  L ++I+  WS +
Sbjct:  881 ERLPSQEKVDCITVNCEPVKSTIDDLIQRLFDMLLLSLRKSIQGHLQAIDSFVSESMEALSTRPDNLEEIGAANSKYNQILSRKPEMLPQFQCAEEKNRLLRA----VAGAGFDSLSSLRSKWDKLELVMESHQ-LMIKEQVEVMRSHAAGRISTYRADLERFQLRWDQLKPKDENLEGGDHAALLACLQTIRDKQQEFQELELVRSKLLEDCTYFDLDPPDFSMAEEIKVDMEELSQTWSL---YEEWQQGFTDKAHEDW-ITFRSKTYV-FEEFLLTWQDRL---RKLKQPTSMSVKLQGEVDKYKNMVPVLKYVRGEHLSQDHWLDMFRMLGLPRGTTLERLTF--SDLLAVADTIVEKAKELKDLNSRAQAEVTIREALRELDLWGAAASFTLTEYTDSSGRTISLIKDWRDVVSQVGDNRCLLQSLKDSPYYRSFQDKVSLWEVRLSDLDEYLLNLNAIQRRWVYLEPIFGR----GALPREEARFKRVDEDFRSIMSDIQRDTRV--VSLSSRAGIKSSLVAILDQLQRCQKSLNEFLEEKRSAFPRFYFIGDDDLLEILGQATNPSVIQSHLKKLFAGIHSV----VFDEQCQHIVAMCSLEGEVVPLRTAVRISSLVEVWLGELSVQMKETLKHLLYECLMAVKKGN-VDPL--RYPSQILCLAEQIQFTEDVEKALKQ-----QHLHQLELELNSKLEHY----TRVDTNSDDSPNTESVILQLKLKALILDIIHNISMVKQLNQAGVTSTDDWAWKKQLRF------YMGPDKFCHIQMVDAQFSYTYEYQGNAAKLVHTPLTDKCYLTLTQAMKMGLGGNPYGPAGTGKTESVKALGGLFGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCFDEFNRLEEAVLSAVSMQIQAIQDSLKHHKNICELLGKE-VSLDPNSGVFITMNPAGKGYGGRQKLPDNLKQLFRPVAMSKPDNELIAEVILYSEGFKNGEMLGGKLVAVFNLARELLTPQQHYDWGLRAL-------------------------------KTVLKACGSLLQQQRRRPDKE-----------------KESNSLVVQALRLNTMSKLTFADSSRFDALVKDVFTGVDFT---DVEDQILIHALEQVYQEAQL---ELIPGQLKKALELNEQLRQRMGVVIVGPSGAGKSTLWRMLRAALS----------------------------------MTGKVVKQYTMNPKAMPRQ-QLLGHIDMDTREWADGVLTHSARCVVREPQEVNSWIVCDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFLFETHDLSCASPATISRMGMIFLSDEDIDVGALMKSWLRGQSDECRSQLENWLGDYFQRALDWVFK---QNDFVVETSLVGTVF-NALSHLSA--VNER---GEFLVGLLRGLGGNLNLKTR-QEFAKELLS--WARE----PPPDARKPLDTYYDNKS---DHLAAYTFQHPESLTLEQFSHAHMLPVIKTTGMQRGLHGFFPWLTASHRQPFMVVGPEGCGKGMLL--RYAFSQLRSTQVAVVHCSAQTSSRHVLQKLSQTCLLLSSNTGRVFRPKDCENLVLYLKDINLPKPDKWGTSNL---TAFLQQALTYKGFYDEN--LEWVSLENIQVVASMSTGGS--VCSHSLTSRFCSIVRICAIDYPDREQLHSIYSAYLQPVLQHSLGSQAGWASTGRTHQLAGSMVQLYEQVKA---KFTVDDHSHYLFTPCILTEWVLSLLRYDLTAAQSNLTQSVLEVIAYEARRLFRDRLVSSKDLHTFDNMLSSVIRGDWSSD 2543          
BLAST of Dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000012967.1 (SMESG000012967.1)

HSP 1 Score: 9970.88 bits (25873), Expect = 0.000e+0
Identity = 4995/5036 (99.19%), Postives = 4998/5036 (99.25%), Query Frame = 3
Query:   78 MDERHWWLATRVNESLTDKIKSNVSELETAFLEFNNSNCINSFFDEDGPLVLYFAKCINSSLKSVHVSSEIKDLNDKSLFPSEKLTILLVIKKRXXXXXXXXFENELFCIELKNYILQNITTIFTHGFIPLLMTKYNSCDNTEKIYPLTSQLNSMWQSVQNYTDQLYLNTNMEEPIHATIDLNKELQDPLKQFETFVTDVMSEIEVILEEVNDRTSEQDIFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIRRQILSIINNKIQAIVGFNQAPEDLWKRVQDEICEGSIESFLNMSLSQVKIILPKEDLLSNVEAFNSILHNNEIRTNTILGLLKFSNIIHDIFLENVTNLRETLNVSNSTKYSLHVPNKSTENINITIPRFDQASENGIGIYDDNKIFSNWLVINGEVKKFIEICNHQLKFEKILSMKMVRISTLKFDIIHLLEKASKTQNAMQYSHKTVNSSDDEPEENNLSDGSEEESSAIKQNWSYSTLASSRDSLEWLLNLSTENTADVSLLEVINKTRSLTLSNMTSTFNILEITNLDRSSLTDNMHIGKTSEMHEEIMNNFDKTFSIFLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAGMHSEFSKLLKYLATQKIYNFNHLLSKNWDSNEFTEAINKDLLAKKSTVQRTLEACSNILKEITEIISIVEKLDPNSSLYESEDLIFGQMKEMYNKSLSQSLYRSIINNLVYLAICSNCQKEHLELLTSRAEYDPVTGINDNLCSSYGEEVFCINDIKPIYDSDHAESKTLIKFILLVKYEIPMIKFEPELDAIQSIIEQMGQDIMAFHNDVSDFSGRKLNLYIKLESDLFYEFSQIISLKYSESRLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLATNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNHSLNEIDLYLSEEKDKDQLAQYLANLHKEVLKFTVTPSIVSGKSVKIGKIIMNDKKKEIYKYDSTSLAPYSQLFLREKLRNLNDNSIQKKIYNGPCTFHRFLYILRRLLHQKTIEKTQSTQTISRALNSIKQTKHDITTINNLISHQKVKFNEISIKSQQLLKTLINKVTLLRIILAKKGDNSYLNEILIKNANISVSELYKDPLLIDAERDELDDEFERIREESLKNRKNIIKGTLEKTRKEYFALKKDLAYATEQVCYWKSKIDRQVIDRIKSFQNPPSLVIDVIEMIFILIGKQIQNTRKDSNADDDETNDEKSNARSRWKRMQQFMADPVKFVDIIHNVSWTDGLNPDVYNGVKSYLATSKDGQLGVTGEGTMLNQAENVNIKAKKNKQMTPELSESENLINRSISVSATKYASEDXXXXXXXXXXXXEYTEKCEPLRQALQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSDLHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLSLRATSPSSAILMKYLNNSYETNILFNQIHSSVKPRIIQSRVIDYSKEGLQLFYQQLQNQMSNIHEICLDSSLTTSNLTALNSVYIVIHLSSTEHISSIHKRVMSYIDEMNSFQRSALLKSRDQNVVTYNLFFTLPQNHSGVSSSQMNKMTTVYLDYPSNLRDFLLHLFKIGFLSANSIPSMSLDLLPVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFESHSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTIESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGVFITINPF 15185
            MDERHWWLATRVNESLTDKIKSNVSELETAFLEFNNSNCINSFFDEDGPLVLYFAKCINSSLKSVHVSSEIKDLNDKSLFPSEKLTILLVIKKRNSSISISNFENELFCIELKNYILQNITTIFTHGFIPLLMTKYNSCDNTEKIYPLTSQLNSMWQSVQNYTDQLYLNTNMEEPIHATIDLNKELQDPLKQFETFVTDVMSEIEVILEEVNDRTSEQDIFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIRRQILSIINNKIQAIVGFNQAPEDLWKRVQDEICEGSIESFLNMSLSQVKIILPKEDLLSNVEAFNSILHNNEIRTNTILGLLKFSNIIHDIFLENVTNLRETLNVSNSTKYSLHVPNKSTENINITIPRFDQASENGIGIYDDNKIFSNWLVINGEVKKFIEICNHQLKFEK+LSMKMVRISTLKFDIIHLLEKASKTQNAMQYSHKTVNSSDDEPEENNLSDGSEEESSAIKQNWSYSTLASSRDSLEWLLNLSTENTADVSLLEVINKTRSLTLSNMTSTFNILEITNLDRSSLTDNMHIGKTSEMHEEIMNNFDKTFSIFLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAGMHSEFSKLLKYLATQKIYNFNHLLSKNWDSNEFTEAINKDLLAKKSTVQRTLEACSNILKEITEIISIVEKLDPNSSLYESEDLIFGQMKEMYNKSLSQSLYRSIINNLVYLAICSNCQKEHLELLTSRAEYDPVTGINDNLCSSYGEEVFCINDIKPIYDSDHAESKTLIKFILLVKYEIPMIKFEPELDAIQSIIEQMGQDIMAFHNDVSDFSGRKLNLYIKLESDLFYEFSQIISLKYSESRLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFR VLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDLLLLTQLYSLYQKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTNEIEESISNLSSDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVS EADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLP   N+K                                EIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLATNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNHSLNEIDLYLSEEKDKDQLAQYLANLHKEVLKFTVTPSIVSGKSVKIGKIIMNDKKKEIYKYDSTSLAPYSQLFLREKLRNLNDNSIQKKIYNGPCTFHRFLYILRRLLHQKTIEKTQSTQTISRALNSIKQTKHDITTINNLISHQKVKFNEISIKSQQLLKTLINKVTLLRIILAKKGDNSYLNEILIKNANISVSELYKDPLLIDAERDELDDEFERIREESLKNRKNIIKGTLEKTRKEYFALKKDLAYATEQVCYWKSKIDRQVIDRIKSFQNPPSLVIDVIEMIFILIGKQIQNTRKDSNADDDETNDEKSNARSRWKRMQQFMADPVKFVDIIHNVSWTDGLNPDVYNGVKSYLATSKDGQLGVTGEGTMLNQAENVNIKA KNKQMTPELSESENLINRSISVSATKYASEDAALLVQYAVALVEYTEKCEPLRQALQKIHELEIEIEENENSSEDSIKENEINNYDYTNLDLNDEEFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSDLHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVEHKKLLREKEKMKRKLHKLEEQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLSLRATSPSSAILMKYLNNS+ETNILFNQIHSSVKPRIIQSRVIDYSKEGLQLFYQQLQNQMSNIHEICLDSSLTTSNLTALNSVYIVIHLSSTEHISSIHKRVMSYIDEMNSFQRSALLKSRDQNVVTYNLFFTLPQNHSGVSSSQMNKMTTVYLDYPSNLRDFLLHLFKIGFLSANSIPSMSLDLLPVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFESHSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTIESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGVFITINPF
Sbjct:    1 MDERHWWLATRVNESLTDKIKSNVSELETAFLEFNNSNCINSFFDEDGPLVLYFAKCINSSLKSVHVSSEIKDLNDKSLFPSEKLTILLVIKKRNSSISISNFENELFCIELKNYILQNITTIFTHGFIPLLMTKYNSCDNTEKIYPLTSQLNSMWQSVQNYTDQLYLNTNMEEPIHATIDLNKELQDPLKQFETFVTDVMSEIEVILEEVNDRTSEQDIFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIRRQILSIINNKIQAIVGFNQAPEDLWKRVQDEICEGSIESFLNMSLSQVKIILPKEDLLSNVEAFNSILHNNEIRTNTILGLLKFSNIIHDIFLENVTNLRETLNVSNSTKYSLHVPNKSTENINITIPRFDQASENGIGIYDDNKIFSNWLVINGEVKKFIEICNHQLKFEKMLSMKMVRISTLKFDIIHLLEKASKTQNAMQYSHKTVNSSDDEPEENNLSDGSEEESSAIKQNWSYSTLASSRDSLEWLLNLSTENTADVSLLEVINKTRSLTLSNMTSTFNILEITNLDRSSLTDNMHIGKTSEMHEEIMNNFDKTFSIFLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKEVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVAGMHSEFSKLLKYLATQKIYNFNHLLSKNWDSNEFTEAINKDLLAKKSTVQRTLEACSNILKEITEIISIVEKLDPNSSLYESEDLIFGQMKEMYNKSLSQSLYRSIINNLVYLAICSNCQKEHLELLTSRAEYDPVTGINDNLCSSYGEEVFCINDIKPIYDSDHAESKTLIKFILLVKYEIPMIKFEPELDAIQSIIEQMGQDIMAFHNDVSDFSGRKLNLYIKLESDLFYEFSQIISLKYSESRLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFREVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDLLLLTQLYSLYQKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTNEIEESISNLSSDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSREADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLP---NLKI-------------------------------EIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQMLVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRETLVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLATNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNHSLNEIDLYLSEEKDKDQLAQYLANLHKEVLKFTVTPSIVSGKSVKIGKIIMNDKKKEIYKYDSTSLAPYSQLFLREKLRNLNDNSIQKKIYNGPCTFHRFLYILRRLLHQKTIEKTQSTQTISRALNSIKQTKHDITTINNLISHQKVKFNEISIKSQQLLKTLINKVTLLRIILAKKGDNSYLNEILIKNANISVSELYKDPLLIDAERDELDDEFERIREESLKNRKNIIKGTLEKTRKEYFALKKDLAYATEQVCYWKSKIDRQVIDRIKSFQNPPSLVIDVIEMIFILIGKQIQNTRKDSNADDDETNDEKSNARSRWKRMQQFMADPVKFVDIIHNVSWTDGLNPDVYNGVKSYLATSKDGQLGVTGEGTMLNQAENVNIKAMKNKQMTPELSESENLINRSISVSATKYASEDAALLVQYAVALVEYTEKCEPLRQALQKIHELEIEIEENENSSEDSIKENEINNYDYTNLDLNDEEFENLKKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDERAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSKIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSDLHNRLESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVEHKKLLREKEKMKRKLHKLEEQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTVTPSDIRLSLRATSPSSAILMKYLNNSFETNILFNQIHSSVKPRIIQSRVIDYSKEGLQLFYQQLQNQMSNIHEICLDSSLTTSNLTALNSVYIVIHLSSTEHISSIHKRVMSYIDEMNSFQRSALLKSRDQNVVTYNLFFTLPQNHSGVSSSQMNKMTTVYLDYPSNLRDFLLHLFKIGFLSANSIPSMSLDLLPVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFESHSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTIESIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPENSDQYYCPIFFDSTAKQEPILNITISKEGITSSKWMLRGVFITINPF 5002          
BLAST of Dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000039073.1 (SMESG000039073.1)

HSP 1 Score: 610.912 bits (1574), Expect = 1.745e-174
Identity = 547/2239 (24.43%), Postives = 1003/2239 (44.80%), Query Frame = 3
Query: 3426 IPMIKFEPELDAIQSIIEQMGQDI------------MAFH--------------NDVSDFSG----RKLNLYIKLESDLFYEFSQIISLKYSESRLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWL-NLLTXXXXXXXXXXXXDAIKYISTGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCT---HDLGY----EFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRR---VNRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALT--KIFDKILDPVIQYIIQNHKELSINSVTIA---FQNSLKVLSQML--VDNKEIGGELHIQRLFVFCFIWSLNS--QISD-LNKQAITTLLKRETLVLPDDDNSICIFDYYVDESGEWDLWSSLLMDE-------GEYLSLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIR----GVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGS---HLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            IP I  +P LD IQ I+ +  Q I            M  H              ND +   G    + LN  I    D+    SQ+  +  +  + ++Q+ +   + +  LWK    +   +E +  K   + +  +I     ++  +   P   ++  +V  ++  +  L+S  + W+  + Q L+++  + +D   +  +++ + L + V +L+ +   +  L ++ + ++KI+   QPIE  Y  L  +E+         + +L   +S L   A++ ++ LL E +  F  EL + +K F   VI F   +D   P   G  P E   +L  ++ ++     K  T     +LFGL+V  + +++ ++++L LL +LY LY        ++ D  WS +++D +  +L +F ++C  LP  LKE ++Y +L+  ID   +   +L  ++   +  RHW ++  VTG  F++++  F   +L   PLL NK+EI+ IC  A KE ++E KL  +  +W+ Q   F S   RG ++L+   T  ++  +EDS + L  + ++R+  P K +  +W  KL   +E+++ WL VQ LW+ LE VF+   I K L QE KRF  +DKS+ K M+R +E  NV QCC+ ++ +    L ++ + LE C  SL GYL +KR +F R +FV D  +L IL  ++D   I  HL S+F     +  D    +  +I  I S   E + L+  I  +  V  WL +LL    +   S + S +I    +   L E    FPSQ+    + + W+ +   A+++ K+DKK +    ++F   ++ +     +N        +T ++R +  ++    ++ RD   +L   KI    DFE  K  +             F+  T  C     D+ +    EF G    +  TP T++  +TL  +L      +  G + +GK+   +++ R   ++ V  +C   M    L     G+A +G WG  D    ++   LS+A   I  +    K++       + + + +      F T   P  +    LP N+   FR VA+  PD   I++       +  +  L+ + YT+ K     +++       LR+I++ L       +TL      G++                     K ++P  S                   E  +V+  + ++ L  +  E+E     +++D F          +     PD+  AI K+ +  +         K +QL+   R   G++  GP+ +GK+  +++ + A+    E                    P      +P+ +                  +MFG       D+ DG+F+ LWRR   V + + I W++ DG +   W +NL S+LDD  TL L +G R+P + N K +FE++++ +ASP  VSR+G+VY  S+++ W+ I   WL    + + ++ T    F  I     +Y+ Q    LS   VT+     + ++ +L+ ++  +D KEI    H+++L VF  +WSL +  ++ D L  Q   T  K   + +  DD++  IF+Y V++ GEW+ W++ + +         EY+S      +LV  +   R  + ++  ++ +  V LIG +G+ K++I+  +  K +          +S  T  +  +  LE+ ++ R G  +G    + +T+ I+D+N+P   E         NE++RQ++    + + + P +   + D  II ++       + +  RL R F      +P  + +  I R    G F        + Q T++    L++AT+KL++K    ++   T  + H  FNLR ++ I  G+   N D  +S   L+  W +   RV  D      D  WF  TL+   +     E+ +G +  E  F+ F  +   +   +          L APKI   +       + L+  +  + E      ++L+   + +  ++ I R + +   GH +L+G  GS    L+++ S         I    + N   L++ +K + R  G  GK    L T   +K    L+ LN+++ SG+   LF  DEM  +L  +   MK+E       +N +L E + SR+ + LH++LC  P  +       ++PG++S   ++W +      L+A +NYF++
Sbjct: 1026 IPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKLPGPGSVKSLNKLISDHKDVAKAVSQLSGI-MNTFKSQVQTLLSEFSGYSTLWK-EEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLL-EIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKELNLLQKLYQLYNNVLDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQSFSFSSFKSRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDD-TLSQLLPHLLEQLELCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYD--KILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQN--------LTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFY-----------FKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLGGAPAGPAGTGKTETTKDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMN-PGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVL-------RTL------GAF---------------------KRENPDDS-------------------EPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFP------EMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGE--------------------PHKEMRMNPKAITAP---------------QMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHI-WLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQT---LSPKMVTLECNYIRQAIDLLAGLVHGMDIKEIKTS-HLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICKDDDT--IFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYIS------ILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQIT---NEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVN---NLVTATRKLWQKTK--IKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAG-LQTEPYFVDFLQDAPEATGEE-----NEETELEAPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISR-VIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTRSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPP-SNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLS 3115          

HSP 2 Score: 134.035 bits (336), Expect = 2.903e-30
Identity = 149/615 (24.23%), Postives = 297/615 (48.29%), Query Frame = 3
Query: 11412 KKECRDLESEYNGLIGDRFIVETELKALSERLDMNVWLVENIKPMEEKWQTMSKQYEDE-RAIFIQCLISSAYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCSK-IEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVV--ISYSDLHNRLESCLASGQCMIIADCDIH-QLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHT-CSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDN----YHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIE-------SSERLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSNS--KKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKF-KGTVT 13196
            +KE   +++EYN  + ++  +E + +A   ++     L+  +    E+W   SK ++ + + +    LI +A+L+YCGP N + R+      +  +    LVTN    +  +     L     IS+     LP  E  + N   +        + L+ D   +  SW+     ++   V  +++    N LE  L+ G+ ++I D       A D ++ +       F+K   TFK+ +  + EV+    F+L++ T   + S  P+V    T ++ F  +I  L ++ L   I   K  ++ E  KL+ E  + KRK  +LE+ +L  L++      S+    ++I+ L++ +E   ++QQK  +    +  I++    Y  +A R + ++ +   M+ V + Y    +++L LFD  +        +S+R++N  II+ LT +  +Y+     + +KF F++LL+++I   +  ++   +E+ I            FIK   +   N+   KP  W+ + + +N+  L+  LP F+ I E + K+ K   WK  FDS++PE ++I +    ++++ ++KL LIR+  PDR +  +  +I+ T+ ++F +G +T
Sbjct: 3439 QKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRN-----ILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAP---RYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEK------NFIKSGSTFKVKV-GDKEVDVMKGFQLYVTTKLPNPSYTPEVFAK-TSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTS---TEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINN--IIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIK--HEEFQI------------FIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSK-LPYFQQITEQVAKNDK--GWKTWFDSDAPEEAHIPDGY--DNLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVIT 4013          

HSP 3 Score: 90.8929 bits (224), Expect = 3.161e-17
Identity = 105/483 (21.74%), Postives = 213/483 (44.10%), Query Frame = 3
Query: 13776 PVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNLYEIVQRMCNWFES---HSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAE--ACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTIE-SIQERLKKVT-----NNFIYSKT--LMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHI-TFTLND--LDKPENSDQYY-CPIFFDSTAKQEPILNITIS---KEGITSSKWMLRGV 15164
            P++   + L + ++ R  +  +G+     I    N S+    VQ + N  +       +SW  + Y + E+ YG +VT + D+  + +    W +      +F F K  Y  PS       K  +  +AF++  P L +S E    H +++++ + ++   ++  I      +N +   S        E+ ++ +  ++  +LP+      ++E+L+K+      N F+  +   + K + +  S   ++   I  T  +IM+E    + DA    + ++   ++P  W+ KL       G+    W + LL + +     +   +    C+W+  F  P+  L   ++E++    R  +      V    + T   K+ +   PS+G+YVHGL+L G G++  + +L +   K + TPLPV H+   ++N+   DK + ++++Y CP++      +   LN       K       W+LRGV
Sbjct: 4166 PMLFCVAFLHTTVQERRKFGPIGW----NIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYK-GYPIPSG------KSLDEYRAFIDKLP-LIDSPECFGLHANADIIYETSNANQMLTTI------VNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGT--IIMSE---NLKDA----LDNIFDARIPSFWM-KLSWESATLGF----WFTDLLDRNEQFHSWLYEGRP--VCFWMTGFFNPQGFLTAMRQEIT----RNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVY---KKPRRTDLNYIFPLNLKTNEAPDHWILRGV 4607          

HSP 4 Score: 90.8929 bits (224), Expect = 3.524e-17
Identity = 66/277 (23.83%), Postives = 135/277 (48.74%), Query Frame = 3
Query: 2070 FLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGVICH-KICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIK-EVTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVV----DLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKVMAVIGNLESIINQVA 2882
            FL+  F + M   + L+++ KF+ +   K    + C  K  ++  NF   +    + Y+++K+    +  +  +   ++W + L   IE PMI F++ + E+ +M E   +VK YNK++K L+  +  Y N W   ++N    L + LL+     +  G K  +N    +L +I E + +  +   +   A  L+ +E  IK  +  + E +  +  +  S+ P +  + + HI  + +TF  G  +L+WT++ I  ++ KV   + +   +I +V+
Sbjct:  591 FLDTWFEKSMPIDKQLNLLKKFEQIDCLK----LDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVS 863          

HSP 5 Score: 67.0106 bits (162), Expect = 5.648e-10
Identity = 55/228 (24.12%), Postives = 109/228 (47.81%), Query Frame = 3
Query:  531 LNSMWQSVQNYTDQLYLNTNMEEPIHATIDLNK------ELQDPLKQFETFVTDVMSEIEVILEEVND-RTSEQDIFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIRRQILSIINNKIQAIVG--FNQAPEDLWKRV 1187
            LN++  + +N   Q+ L  + +E + A I++           + +++ E  +   + +IE +L E    R    D+    E+  W++R      L+ Q+K K   + I  L   KS+ ++KWR+L+S IT+A N +KD +KYL T     G + +    P  ++  +P +   ++   S S+ ++ S  M S    +  Q+++   + +   V   ++   E+L KR+
Sbjct:  244 LNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCN--PVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMYEGVSKIWDLGREELAKRI 469          
BLAST of Dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000049144.1 (SMESG000049144.1)

HSP 1 Score: 585.489 bits (1508), Expect = 8.646e-167
Identity = 526/2150 (24.47%), Postives = 960/2150 (44.65%), Query Frame = 3
Query: 3591 IISLKYSESRLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYIS-TGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGY--EFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSH--LMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRV--NRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWL----ENKRSIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQMLV-----DNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRET---LVLP--DDDNSICIFDYYVDESGEWDLWSSLLMDEGEYL----SLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQ-LISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITF--STEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKL---ETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            ++S   + +R ++++ +   + +  LW    D    EE L      +     I + L L++ +    +  +   + + T+  +  LLS    W+  +G+  + + K  +++   + E + + L + + +L+ +   +G L +I + +++ID    PIE  Y  L  +ELP+ + E   +  LR  W  L+      ++ L+  +   F   L + ++ F  +  +F   +D   P + G  P E   +L   +N+Y   E +  T     +LFGL V  + +L+ +K++L LL +LYSLY         + D LW  VD++ +  +LTEF + C  LP  LK+  ++ +L+  ID    +  +L  + +  ++ RHW ++  +T  +F +E+  F   ++   PLL+ K+EI+ IC  A KE ++E KL  ++ EW+   L F +   RG ++L    T+ ++  +EDS ++L ++ ++R+  P K +     +KL   SE+++ W+ VQ LW+ LE VF+   I K L +E KRF  +DKS+IK M R +E  NV QCC+ +E +    L ++ + LE C  SL GYL +KR LF R +FV D  +L IL  ++D   I  HL S+F  +  +       E   I   +S   E + L   +  +  V  WL  L N  + S+  +   A   I+ T  ++ E    +P+Q+    + L W+ +   A+   KSD+K +    ++F   ++           + T   +  ++R +  ++    ++ +D    L   K++   DF+      +K T    V +    + ++T   D  Y  EF G    +  TP T++  +TL  +L      +  G + +GK+  ++++ R   +Y V  +C   M    L     G++ +G WG  D    +D   LS+A   I  +    K++       + + + +      F T   P  +    LP N+   FR VA+  PD   I++       +  +  LA + YT+ K     + +       LR+I++ L       +TL           GQ                           +++AN T          E   V+  + ++ L  +  ++E     ++ D F G        + +   P+L  AI ++  +    I SH   + K +QL+   R   G++  GP+ +GK+  + + + AL    E                    P      +P+ +                  +MFG       D+ DG+F+ LWRR    +     W+V DG +   W +NL S+LDD  TL L +G R+P S + K +FE++++ +ASP  VSR+G+VY  S+ + W  +   WL     N+R I +   T  F  I    IQY+I   + L         + +  +L  ++      D+ +I   +H +RL++F  +WS+ + +   ++  +   ++      L LP  + D+   +FDY V E+GEW  W+S +    EY+    S    G +LV  +  +R  + ++        V LIG +G+ K+++++ +    +          +S  T     +  +E+ ++ R G  YG    + +T+ I+D+N+P    I+    +  NE++RQLL      N + P +   + D   + ++       + +  RL R F      +P  S +  I   +   H          + Q  Q LI  T++L+  + +  +   T  + H  FNLR ++ I  G+ +   D  ++   LL  W +   RV  D      D+ WFN  L  I+ N   GE+  G++  ER F+ F    +E +     D            PK+   +   +  ++ L     L+ E      ++++   + +  ++ I R I  P  G+ +L+G  GS    +  +A  IA   I ++    + N   L++ +K + R  G +GK    L T + +K    L+ +N+++ SG    LF  DEM  +   +   MK+E       TN +L E F SR +++LH++LC  P  +       K+PG++S   ++W +      L+A A ++++
Sbjct: 1159 LLSTCINSTRKEVETAMLRFSAYSHLWAKVKDTT-LEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPE-FRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDE-TLSQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYE--TILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTNEQFLLLLN--------LLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDW-----LKQTRFYFVEDVDRCIVSITDV-DFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMN-PGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVL-------RTL-----------GQ---------------------------QKRANPTDT--------EQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGI------QLDKGGYPELEAAINRQ--IDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGE--------------------PHREMRMNPKAITA---------------PQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLE----AFVVRQACDLLEGLIPRKDEKDSSQI-SRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKV---EEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPV---INEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLW--ILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFTAHEDISWFNKVLLRIV-NEDLGEVHVGSLQDERYFVDFLRDAKEATGEEPDD-------TDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTP-RGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPP-TNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLS 3169          

HSP 2 Score: 101.293 bits (251), Expect = 2.844e-20
Identity = 129/579 (22.28%), Postives = 273/579 (47.15%), Query Frame = 3
Query: 11523 LVENIKPMEEKWQTMSKQYEDERAIFIQCLISS-AYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCS-KIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSDLHNR--LESCLASGQCMIIADCDIH-QLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHT-CSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDN----YHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSER--LSNK---SIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSN--SKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKF-KGTVTPSD 13205
            L+E +   + +W   S +++ +    +  ++S+ A+L+YCGP N E R+      + ++    L T +   S  + I   L     + +     LP  E  + N   +   S    + L+ D   +   W+          V S +  + R  LE  L+ G+ ++I D       A D ++ +       F+K+  TFK+ +  + EV+    F L++ T   + S  P++    T ++ F  ++  L ++ L   I+  K  ++ +  +L+ + +  K+K+ +LE+ +L  L++      S+ +   +IK LK  +  +A + QK  + S  +  I++    Y  +A R + ++ +   M+ V   Y     ++L LFD  +  S++  ++ K   +II+ +T +  +Y++  + + +K  F+LL+++++      +++  +E+              FIK   S   N    KP  W+++ + +N+  L+  L  F  +L+ + ++ K+  W+  FD E+PE   I +  +  ++D +++L L+R   PDR +  +  +IQ++L  KF +G +  +D
Sbjct: 3530 LIEGLAGEKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-----ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKAS---RYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEK------NFIKQGSTFKVKV-GDKEVDVMKGFELYITTKLPNPSYTPEIFAR-TSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTS---TKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKI--EEFHT------------FIKGGASLDMNVVQPKPKAWITDMTWLNLVELSN-LHQFSAVLDQVSRNEKQ--WRQWFDKEAPEEEVIPDG-YNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDAD 4071          

HSP 3 Score: 85.8853 bits (211), Expect = 1.021e-15
Identity = 98/451 (21.73%), Postives = 191/451 (42.35%), Query Frame = 3
Query: 13776 PVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNL---YEIVQRMCNWFESHSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTIE-SIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNN--------KDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPEN------SDQYYCPIF 15074
            P+++  + L + ++ R  +  LG+     I    N ++L    + VQ   +  +    +SW  + Y + EI YG +VT + D+  + +    W   +    +F F K  +  P+V  S   ++ +I     N     ++S E   L SN    I  +    + I      I  K   +   +    E+ ++ +C ++  KLP   +   + ERL+           +M  L   +    + ++ +QK    ++ ++   + D  +++  +++ N+     L+ + + +  S +S + W SS L  +     LI  N        K +  C+W+  F   +  L   ++EV+    R  +      V    + T   +D I +PPS+G+YV+GL+L G G+D+   +L +   K +  PLPV  I     D+ K          + Y CP++
Sbjct: 4221 PMVYAVAYLHTCVQERRKFGPLGW----NIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFK-DHSIPAV--SKLNEYIDIINELPN-----YDSPEMFGLHSN--ADITYQSKTAQSILDCILNIQPKDASAGGGETR--ESVVYRMCDDMLGKLPSDYVSFEVMERLQ-----------IMGILQPMNIFLRQEVDRMQK----VIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPSSWSKVSWESSTLGFW--FTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVT----RAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPV--ILIQAIDISKEGEISRDLLKNMYQCPVY 4632          

HSP 4 Score: 83.5741 bits (205), Expect = 5.870e-15
Identity = 63/278 (22.66%), Postives = 128/278 (46.04%), Query Frame = 3
Query: 2007 IGKTSEMHEEIMNNFDKTFSIFLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKE-VTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKV 2837
            I +  E+H  I+N  D  F    +        T  A+  + +F+ L         I  K  ++  ++  D+    + Y   K        M L+   +AW ++L   I+ PM  F+   + + +  E + I+K YNK+++ LIS +  Y   W+  +++    L + L++      ++ +N   ++L +  ET  M++++ ++ PAA+ L   +  +K F +KL   VNY + V  SI  E   L    +  + +  + G ++ +WT++ +  ++  V
Sbjct:  549 IRQIQELHNNILNFMDGGFDHITS--------TTRAIQSLRRFERLNIPDL---GIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFETQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQQYIDSV 815          

HSP 5 Score: 73.559 bits (179), Expect = 6.751e-12
Identity = 55/187 (29.41%), Postives = 95/187 (50.80%), Query Frame = 3
Query:  645 LKQFETFVTDVMSEIEVILEEVNDRTSEQD-IFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIRRQILS-----IINNKIQAIVGFNQAPEDLWKRV 1187
            L + E  V   + +IE +L E +    E D I    E++ W+ R      L+ QLK    K +IG L + KSK +K W +++  IT+A N +KD +K+L T +  C  +  Y + PS ++  +PK+   ++   S S+ ++ S  M S    I  Q+++     I N+  + +  +   PE+L KR+
Sbjct:  258 LMKVEQCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPL--YQNNPSLMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETV--WTLEPEELMKRL 440          
BLAST of Dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000049144.1 (SMESG000049144.1)

HSP 1 Score: 574.704 bits (1480), Expect = 1.749e-163
Identity = 523/2149 (24.34%), Postives = 961/2149 (44.72%), Query Frame = 3
Query: 3591 IISLKYSESRLKLQSTVENLNEFDFLWKMTSDKLDFEESLAKKDTYNSLKEKITQVLHLKNNLQRLPKEIEIDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYIS-TGDSLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGY--EFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNFFFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSH--LMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRV--NRNDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWL----ENKRSIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTIAFQNSLKVLSQMLV-----DNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRET---LVLP--DDDNSICIFDYYVDESGEWDLWSSLLMDEGEYL----SLQLTGEVLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQ-LISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSGNVNCERNFITFSTEEDSSRNSKDLQNIRT-TAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKL---ETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVN 9944
            ++S   + +R ++++ +   + +  LW    D    EE L      +     I + L L++ +    +  +   + + T+  +  LLS    W+  +G+  + + K  +++   + E + + L + + +L+ +   +G L +I + +++ID    PIE  Y  L  +ELP+ + E   +  LR  W  L+      ++ L+  +   F   L + ++ F  +  +F   +D   P + G  P E   +L   +N+Y   E +  T     +LFGL V  + +L+ +K++L LL +LYSLY         + D LW  VD++ +  +LTEF + C  LP  LK+  ++ +L+  ID    +  +L  + +  ++ RHW ++  +T  +F +E+  F   ++   PLL+ K+EI+ IC  A KE ++E KL  ++ EW+   L F +   RG ++L    T+ ++  +EDS ++L ++ ++R+  P K +     +KL   SE+++ W+ VQ LW+ LE VF+   I K L +E KRF  +DKS+IK M R +E  NV QCC+ +E +    L ++ + LE C  SL GYL +KR LF R +FV D  +L IL  ++D   I  HL S+F  +  +       E   I   +S   E + L   +  +  V  WL  L N  + S+  +   A   I+ T  ++ E    +P+Q+    + L W+ +   A+   KSD+K +    ++F   ++           + T   +  ++R +  ++    ++ +D    L   K++   DF+      +K T    V +    + ++T   D  Y  EF G    +  TP T++  +TL  +L      +  G + +GK+  ++++ R   +Y V  +C   M    L     G++ +G WG  D    +D   LS+A   I  +    K++       + + + +      F T   P  +    LP N+   FR VA+  PD   I++       +  +  LA + YT+ K     + +       LR+I++ L       +TL           GQ                           +++AN T          E   V+  + ++ L  +  ++E     ++ D F G        + +   P+L  AI ++  +    I SH   + K +QL+   R   G++  GP+ +GK+  + + + AL    E                    P      +P+ +                  +MFG       D+ DG+F+ LWRR    +     W+V DG +   W +NL S+LDD  TL L +G R+P S + K +FE++++ +ASP  VSR+G+VY  S+ + W  +   WL     N+R I +   T  F  I    IQY+I   + L         + +  +L  ++      D+ +I   +H +RL++F  +WS+ + +   ++  +   ++      L LP  + D+   +FDY V E+GEW  W+S +    EY+    S    G +LV  +  +R  + ++        V LIG +G+ K+++++ +    +          +S  T     +  +E+ ++ R G  YG    + +T+ I+D+N+P    I+    +  NE++RQLL      N + P +   + D   + ++       + +  RL R F      +P  S +  I   +   H          + Q  Q LI  T++L+  + +  +   T  + H  FNLR ++ I  G+ +   D  ++   LL  W +   RV  D  +   D+ WF  TL+  +    S ++S   V+  + F T +   D  R++K+             PK+   +   +  ++ L     L+ E      ++++   + +  ++ I R I  P  G+ +L+G  GS    +  +A  IA   I ++    + N   L++ +K + R  G +GK    L T + +K    L+ +N+++ SG    LF  DEM  +   +   MK+E       TN +L E F SR +++LH++LC  P  +       K+PG++S   ++W +      L+A A ++++
Sbjct: 1159 LLSTCINSTRKEVETAMLRFSAYSHLWAKVKDTT-LEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPE-FRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDE-TLSQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYE--TILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTNEQFLLLLN--------LLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDW-----LKQTRFYFVEDVDRCIVSITDV-DFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMN-PGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVL-------RTL-----------GQ---------------------------QKRANPTDT--------EQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGI------QLDKGGYPELEAAINRQ--IDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGE--------------------PHREMRMNPKAITA---------------PQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLE----AFVVRQACDLLEGLIPRKDEKDSSQI-SRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKV---EEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPV---INEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLW--ILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCL----SEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTP-RGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPP-TNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLS 3172          

HSP 2 Score: 100.908 bits (250), Expect = 3.067e-20
Identity = 130/581 (22.38%), Postives = 271/581 (46.64%), Query Frame = 3
Query: 11523 LVENIKPMEEKWQTMSKQYEDERAIFIQCLISS-AYLAYCGPLNFEQRSKFLDFCVASARSSGLVTNRFGCS-KIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSDLHNR--LESCLASGQCMIIADCDIH-QLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHT-CSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMYEEINANLQQKEFLFSSNKKSIDN----YHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSE-------RLSNKSIIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVALKSNPDFIKQNESKTSN--SKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKF-KGTVTPSD 13205
            L+E +   + +W   S +++ +    +  ++S+ A+L+YCGP N E R+      + ++    L T +   S  + I   L     + +     LP  E  + N   +   S    + L+ D   +   W+          V S +  + R  LE  L+ G+ ++I D       A D ++ +       F+K+  TFK+ +  + EV+    F L++ T   + S  P++    T ++ F  ++  L ++ L   I+  K  ++ +  +L+ + +  K+K+ +LE+ +L  L++      S+ +   +IK LK  +  +A + QK  + S  +  I++    Y  +A R + ++ +   M+ V   Y     ++L LFD  +  S+       R+ N  II+ +T +  +Y++  + + +K  F+LL+++++      +++  +E+              FIK   S   N    KP  W+++ + +N+  L+  L  F  +L+ + ++ K+  W+  FD E+PE   I +  +  ++D +++L L+R   PDR +  +  +IQ++L  KF +G +  +D
Sbjct: 3533 LIEGLAGEKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-----ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKAS---RYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEK------NFIKQGSTFKVKV-GDKEVDVMKGFELYITTKLPNPSYTPEIFAR-TSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTS---TKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQN--IIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKI--EEFHT------------FIKGGASLDMNVVQPKPKAWITDMTWLNLVELSN-LHQFSAVLDQVSRNEKQ--WRQWFDKEAPEEEVIPDG-YNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDAD 4074          

HSP 3 Score: 85.8853 bits (211), Expect = 1.056e-15
Identity = 98/451 (21.73%), Postives = 191/451 (42.35%), Query Frame = 3
Query: 13776 PVIHNCSLLMSIMKSRSSYLSLGFQDSETIVKITNPSNL---YEIVQRMCNWFESHSNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTIE-SIQERLKKVTNNFIYSKTLMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNN--------KDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDLDKPEN------SDQYYCPIF 15074
            P+++  + L + ++ R  +  LG+     I    N ++L    + VQ   +  +    +SW  + Y + EI YG +VT + D+  + +    W   +    +F F K  +  P+V  S   ++ +I     N     ++S E   L SN    I  +    + I      I  K   +   +    E+ ++ +C ++  KLP   +   + ERL+           +M  L   +    + ++ +QK    ++ ++   + D  +++  +++ N+     L+ + + +  S +S + W SS L  +     LI  N        K +  C+W+  F   +  L   ++EV+    R  +      V    + T   +D I +PPS+G+YV+GL+L G G+D+   +L +   K +  PLPV  I     D+ K          + Y CP++
Sbjct: 4224 PMVYAVAYLHTCVQERRKFGPLGW----NIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFK-DHSIPAV--SKLNEYIDIINELPN-----YDSPEMFGLHSN--ADITYQSKTAQSILDCILNIQPKDASAGGGETR--ESVVYRMCDDMLGKLPSDYVSFEVMERLQ-----------IMGILQPMNIFLRQEVDRMQK----VIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPSSWSKVSWESSTLGFW--FTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVT----RAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPV--ILIQAIDISKEGEISRDLLKNMYQCPVY 4635          

HSP 4 Score: 83.5741 bits (205), Expect = 6.225e-15
Identity = 63/278 (22.66%), Postives = 128/278 (46.04%), Query Frame = 3
Query: 2007 IGKTSEMHEEIMNNFDKTFSIFLNLLFLRPMRTGEALSIVSKFDYLKFRKSIKGVICHKICELFVNFKSDITGAFESYKEFKNQSAQIPGMSLVYSTVAWIQKLLSNIEIPMIRFQDIKE-VTQMKEYESIVKQYNKVSKNLISHQSAYINYWLSAVDNCVAKLKNPLLVVDLVGNKVKINSPENLLAIINETRNMIRIQSQLSPAAMELLKSERRIKYFFSKLNEAVNYFETVKQSIFPEMLFLFQNHIKLVMQTFQTGSSSLSWTTINIDVFLHKV 2837
            I +  E+H  I+N  D  F    +        T  A+  + +F+ L         I  K  ++  ++  D+    + Y   K        M L+   +AW ++L   I+ PM  F+   + + +  E + I+K YNK+++ LIS +  Y   W+  +++    L + L++      ++ +N   ++L +  ET  M++++ ++ PAA+ L   +  +K F +KL   VNY + V  SI  E   L    +  + +  + G ++ +WT++ +  ++  V
Sbjct:  549 IRQIQELHNNILNFMDGGFDHITS--------TTRAIQSLRRFERLNIPDL---GIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFETQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQQYIDSV 815          

HSP 5 Score: 73.1738 bits (178), Expect = 6.808e-12
Identity = 55/187 (29.41%), Postives = 95/187 (50.80%), Query Frame = 3
Query:  645 LKQFETFVTDVMSEIEVILEEVNDRTSEQD-IFLIGEMEKWQNRHHLLQTLVSQLKGKMFKNSIGYLVSKKSKMIKKWRQLESLITEALNNSKDKMKYLETFKIECGIMERYASLPSCLLLTVPKIFKKMKQKESFSRSFSRSGLMGSFLSMIRRQILS-----IINNKIQAIVGFNQAPEDLWKRV 1187
            L + E  V   + +IE +L E +    E D I    E++ W+ R      L+ QLK    K +IG L + KSK +K W +++  IT+A N +KD +K+L T +  C  +  Y + PS ++  +PK+   ++   S S+ ++ S  M S    I  Q+++     I N+  + +  +   PE+L KR+
Sbjct:  258 LMKVEQCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPL--YQNNPSLMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETV--WTLEPEELMKRL 440          
BLAST of Dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000056575.1 (SMESG000056575.1)

HSP 1 Score: 535.798 bits (1379), Expect = 9.307e-152
Identity = 494/2068 (23.89%), Postives = 908/2068 (43.91%), Query Frame = 3
Query: 3804 IDCLVISTKVFRAVLLSLLNDWQNKHGQNLHDEAKRLLDEATQYRETVVEELKQDVTELEQLNELLGILDQIFDLDLKIDSIYQPIESMYTDLEIFELPILRSEENELINLRQYWSTLIKMAESQRNKLLNEKRNIFHQELDKQMKKFTVEVIQFRNYFDFECPSMAGSDPIEVERKLESFRNQYSIYEEKKNTLVAISKLFGLKVQSFHELESMKEDXXXXXXXXXXXXKFSKFEKNFNDKLWSVVDLDDVYVKLTEFWDECLALPSKLKEKESYGELKGKIDYLIKIHSILTNLASKEIRNRHWIQVMQVTGANFQLEAGTFKCSDLTTIPLLENKKEIDRICYDARKEMELEMKLNQIEEEWTEQVLVFQSHSRRGLVVLEVRFTNSLLQQLEDSQILLMNMFNSRHIEPMKDEAAQWAAKLMEISEVLDLWLEVQQLWLNLETVFINPIIMKDLSQEYKRFERLDKSYIKSMRRVYETKNVFQCCISNEYSKKGFLKNIQQGLENCFDSLRGYLHQKRNLFARLWFVPDSTILSILNCSNDIKNIGLHLPSIFTAVNDLHTDPAFREPLQIDKIFSSSREEIVLNNKIAIKDEVVNWLNLLTXXXXXXXXXXXXDAIKYISTGD-SLEELSKKFPSQICYSALHLHWSNEINTAVSEIKSDKKSLSHLAKKFNTQISRIPITLNRNSWKSTDDPITALQRRRLRSMTLGVLYLRDSLVNLSAKKIRDVDDFELYKIIKMKTTVMDSVGNQKFQLATLTCTHDLGYEFQGSLPTIAWTPTTEKYLLTLLFSLEHQKLSSIIGESQSGKSLLIEELARLTNRYRVKKHCQSNMSNESLINFMCGIASNGCWGILDNVEYMDPSQLSLAIVMIGQIKDAIKQKSATVSIVEKEGIHLQVGTNF-FFTSCLPLESFEVLLPGNIIEEFRIVAITPPDLLQILKWYCVHFNYRVSRTLALRLYTVIKQASSLINEHGKPIITLRSIVAALNKASAWKKTLIIKEKTGSYEVGQTTGGSTLMEFWPSFVERKIKSPTSSFIKQKANETPVSLSAAAKHEHNLVVEAIIEIVLPCITPENEKTIKEILKDTFQGYSDSHSKNIKETIPPDLLNAIIKEAKLRRCSISSHLMEKYVQLYNVVRFHQGLILCGPTCSGKSTSLDIFLAALNHLNENRFNTSNDLSVSWEADEQASPDLARHSDPELLNQSHHMYSIYPMSFEHESEMFGNWSTKKEDFHDGLFTFLWRRVNR--NDLISWIVFDGTIQPEWSQNLRSILDDEHTLHLPDGHRLPQSKNVKFVFEMNSMKDASPGMVSRSGVVYFPSNMIGWREIKPLWLENKRSIEVIALTKIFDKILDPVIQYIIQNHKELSINSVTI-AF--QNSLKVLSQMLVDNKEIGGELHIQRLFVFCFIWSLNSQISDLNKQAITTLLKRE----TLVLPDDDNSICIFDYYVDESGEWDLWSSLLMDEGEYLSLQLTGE---VLVDTITTLRAKYFLDITTRASLNVALIGPRGSGKSLILDNHWRKSDLTAMNIARFVYSYFTKSSQLKSFLEANIEHRQGLMYGGKEHKHLTLVIEDLNLPKPIEIDSDCIRRPNEVLRQLLNSNVIQNSKYPFEQMKLSDFNIIVSLA-TNSSADLLDPRLMRHFVPIKIEMPEGSHLQSIIRGVFECHIDSIENCQITIDQASQLISATQKLYEKVTSVLQRSSTEGRCHLNFNLRSINDIALGIKSFNYDSESSEPLLLQYWSYLSRRVFQDCLILDTDLKWFNATLQAIIQNVWSGEISSG---NVNCERNFITF--STEEDSSRNSKDLQNIRTTAHLSAPKIAVAMNDINSKREYLVSQINLHQEKFGKDSINLMPTDNVLLQIINIHRQITKPFNGHIVLIGSVGSHLSQMCSIALQIAKIPIQKLETSNDVALIDSMKSILRQVGSEGKKSAILLTARNLKSSLILDTLNSLMISGDCPLLFPPDEMAGLLSAVQISMKREKSSTTILTNFDLIEQFRSRIRRDLHILLCLPPKNDIILESLNKYPGILSYVAVNWLKDSEDSYLMADANYFVNH 9947
            I  L I T  F+   L+ L  ++  +     +     ++      + +   L +++T L+ +  ++  L  I  +D+K+D      E     +  F++P  +S  +++  +R  ++ + K  E Q    +   +  + + L   + +  +++  F N ++   P   G  P+E   K   F+N++     K  +      LFGL   S+     + ++L LL +LY LY + +K    + + +W  VD+D +   L EF ++C  LP  LK+  +Y +L+  ID   +   +L  + +K ++ RHW ++  +T  +F +   TF C                                   + +W  Q L   S   RG ++L+    + ++  LEDS ++L ++ ++R+  P K    +W  KL   SEVL+ W++VQ LW+ LE VF+   I K L QE KRF+ +DKSY+K M R  +T NV QCC S+++S    L  + + LE C  SL GYL +KR +F R +FV D  +L IL  ++D  +I  HL SIF     +  D   R+   I   FSS  EE+ +   +  +  V +WL  L    + S+  +  +A   I   D  L E     PSQ+    + + W+     A+ E ++D K +    K F   ++ +     R+        +T   R +  ++    ++ RD   +L    ++  +DFE  K  + +   M+ V   K  ++      +   EF G    +  TP T++  +T+  +L     ++  G + +GK+   +++ R   +Y V  +C   M    L     G+A +G WG  D    ++   LS+A   I  I     +K      +  +G  +++   F  F +  P  +    LP N+   FR VA+  PD   I++       +  +  LA + + + K     + +       LR+I++ L    + ++                                   +P  S                   E   V+  + ++ L  +  ++E     ++ D F G        + +   P+L +++ K+    +    S  + K +QLY       G++  GP+ +GKS  + + + AL                                DP      H    + P +    SEMFG       D+ DG+F+ LWRR  +       W++ DG +   W +NL S+LDD  TL L +G R+P   N K +FE++++ +ASP  VSR+G+V+  S+ + W  I   WL  +   E   L  +F+K     +++I+ N   L++  V + AF  + +  +L  ++   +E   + H++RL+ F  +WSL + + +LN++A      R      L LP+ ++   +F+Y V+  G+WD W++  MDE  Y     T E   +LV  +  +R ++ +D   +   +V LIG  G+ K++++  +  KS++       F +S  T  +  +  +E+ +E R G  +G    K +++ I+D+N+P    I+    +  NE++RQ +      + + P E   + D   + ++       + +  RL RHF                   +F C + S      +ID++  L+     + ++V+     ++   + H  FNLR ++ I  GI + N D  +++ +LL  W +   RV  D  +   D +WF      IIQ + S EIS+    ++     F+ F     E +    +D          S PKI   ++ ++S +  L   +N + E      ++L+  ++ +  ++ + R I  P  G+ +L+G  GS    +  +A  IA        + N   L++ +K++ R  G EGK +  + T  ++K    L+ +N+++ SG    LF  DE+  + + +   MK+E       TN +L+E F SR+R++LH++LC  P           +PG++S    +W +      L+A A +++ +
Sbjct: 1237 IGPLYIDTTEFKLAALANLKQFKQVYVTGCTERFVGRIEAIQTQLDEIERNLSKNITNLDDIAFIMDTLAYIRQIDIKMDYDIMTAEYASQTMSKFDIPYPKSTGDQVEAVRCNYNRM-KENEFQAIDHILAIQGSYKEGLLNNINQLKIDIEDFINDYNERGPMKPGLPPVEALDKQILFKNRFDNLLRKLESYAKGEILFGLPTSSYPSFLQIGKELELLQRLYGLYNEVNKTVSGYYEIIWKNVDMDKIGSDLQEFQNKCKRLPKALKDWPAYTDLQKTIDDFNEKVPLLEMMTNKAMKPRHWQRLADLTNYSFDMMLKTFAC-----------------------------------QHDWANQDLKLASFKNRGELLLKGDRVSEVISLLEDSLMVLSSLMSNRYNAPFKKPITEWVQKLTTSSEVLENWMKVQNLWVYLEAVFVGGDIAKQLPQEAKRFQGIDKSYVKVMERARDTTNVVQCC-SSDHSLVELLPRLFEQLEICQKSLTGYLEKKRLVFPRFFFVSDPVLLEILGQASDPHSIQAHLLSIFDNTKRVKFDD--RQYDLIVSAFSSENEELKMIRPVKCEGHVESWLGRLLKVAQYSLHTVIQNAAFQIQDEDLDLVEFLDAQPSQVGLLGIQILWTRNATDALREARNDPKIMQKTNKTFLLLLNLLIGETTRD--------LTKYARTKYETLITIHVHQRDIFDDLCKLNVKSQNDFEWTK--QTRFYFMEDV--DKCVISITDVDFEYQNEFLGCTERLVITPLTDRCYITIAQALSMSLGAAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIILQC--KKEGKTQFIFSDGDTVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLAACGFIENIILARKFFVLYKLCEEQLTKQVHYDFGLRNILSVLRSLGSARRV----------------------------------APNDS-------------------EDRTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGIV------LDKAGYPELESSVRKQVDSLKMINHSPWVLKVIQLYETQCVRHGMMTLGPSGAGKSVCITVLMKALTDC----------------------------GDP------HREMRMNPKAI-LASEMFGKLDVATNDWTDGIFSTLWRRTLKLKKGEHCWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMGPNCKIIFEVHNIDNASPATVSRNGMVFMSSSALNWSPILKGWLLTRPMSEREKLYALFEKSFPQTLKFIVNN---LTMKMVILEAFIIRQACDILQGIIF--QESLPDKHLERLYAFALMWSLGAFL-ELNERAKMEEFIRNDNSINLDLPEVESDSTMFEYKVNAEGKWDHWNN-YMDEYIY-PHDFTPEYSKILVPNVDNVRTEFLMDNIAKQEKSVLLIGEPGTAKTVMITKYMGKSNIETRVSKSFNFSSATTPALFQRTIESFVEKRVGTTFGPPAGKKMSVFIDDINMPL---INEWGDQIANEIVRQTMEMKGFYSLERPGEFTNIVDVQFLSAMIHPGGGRNDIPERLKRHF------------------NIFNCTLPS----NNSIDKSLVLLVWDIIVRKEVSVKKSLNTLRTKFHYVFNLRDLSRIWQGIINTNSDVIANKEVLLALWKHECMRVISDRFVSLDDEQWF----IKIIQRMVSEEISTDLAESIEDSSYFVDFLRDAPEPTGEEPEDFD-------FSPPKIYEPISGLDSLKSRLFMFMNHYNESIRGAGMDLVFFNDAMGHLVKVSRIIRTPL-GNALLVGVGGSGKQSLTRLAAHIA-----GYSSYNVSNLLEDLKTLYRSAGQEGKGTTFIFTDNDIKDEGFLEYMNNILSSGVVSGLFQKDEIDEMTAMLVPVMKKEFPKRPP-TNENLLEYFFSRVRKNLHVVLCFSPVGQKFRTRALYFPGLISGCITDWFQKWPKDALLAVAEHYLGN 3106          

HSP 2 Score: 93.2041 bits (230), Expect = 7.297e-18
Identity = 121/527 (22.96%), Postives = 247/527 (46.87%), Query Frame = 3
Query: 11649 NFEQRSKFLDFCVASARSSGLVTNRFGCS---KIEITQFLHSEIEISKMESYNLPCCEDEIDNAYFILNESLIRNWILICDQTRRAISWLDRYLIHYNPVVISYSDLHNR--LESCLASGQCMIIADCDIHQLAEDEIMRQVFRHQFRFLKEKKTFKILLENNHEVECHPNFRLFLHTCSSTSEIPDVLTSLTFLVSFNTSIPILINEFLSRFIEKAKPTIDVXXXXXXXXXXXXXXXXXXXXXQMLDDLSNGIRNVKSIENCNTIIKYLKMY-EEINANLQQKEFLFSSNKKSIDNYHQIAVRFATIFQMASRMTNVQKDYSVDFEKYLNLFDSMIESSER--LSNKS---IIDKLTKKTSQYSLLSMKDENKFVFSLLLSIEIHKTTNNVELCQDEYLISPSSVA-LKSNPDFIKQNESKTSNSKKPFDWMSEESLMNVKILAACLPCFKDILENMYKDSKENHWKMLFDSESPEASNIMERLFKNSIDAYQKLCLIRTLRPDRIMQASYLFIQNTLNLKFKGTV 13193
            +F+ ++K LDF V    +  L   R        +++ + L     IS+     LP  E  I N   I+  S  R  +LI  Q +  I W+          + S +  + R  LE  L+ G+ M+I D +  +L  D  + QV    F  +K     K+ +  + EV+    F L++ T          + + T L+ F  +I  L ++ L R I+  K  ++    +L+      KR++ +LE+ +L+ L+N   ++   ++   ++   K+  +E++  L Q          + + Y  +A R + ++ + + M+NV + Y +  +++L LFD  +  S++  ++++    II+ +T    ++++  M  E++   +L+L+++I   + N+   + + LI   SV  LK+ P              KP  W+++ + +N+  L+  L  F  I+E + +   E +WK  +D E+PE   I    +++++D +++L ++R+  PDR +  +  +I ++L   F   V
Sbjct: 3483 SFKDQTKKLDFRVKLMTTWNLEVVRKSIPSTHGLDLIKVLTDAPTISEWNLQGLPNDELSIQNG--IIVTSAARYPLLIDPQGQGKI-WIKNREAAKELQITSLNHKYFRQHLEDALSLGRPMLIEDIN-EEL--DPALDQVLEKNF--IKMGTGLKVKV-GDKEVDVMKGFMLYITTKLPNPHYTPEIYAKTSLIDFTVTIKGLEDQLLGRVIKTEKEELEKSRIELVENMTNNKRRMQELEDSLLERLANTQGSLVDDQDLLDVLSNTKVTSQEVSLQLSQATETEKEINTAREEYRPVATRGSVLYFLFTEMSNVNQMYQIGLKQFLTLFDQSMHKSDKSPITHRRISIIIEYMTFDMWKFAVRGMYKEDRMTLTLMLALKIDIQSKNIRQEEFDVLIKGGSVLDLKTVP-------------PKPAKWITDLTWLNLNALSV-LNQFSAIIEQVVQ--TEKNWKQWYDKENPENEQI-PCGYESNLDTFRRLLMVRSWCPDRTLPQAKKYISSSLGESFAEEV 3983          

HSP 3 Score: 72.4034 bits (176), Expect = 1.161e-11
Identity = 98/423 (23.17%), Postives = 172/423 (40.66%), Query Frame = 3
Query: 13935 SNISWNILRYFVSEIIYGSKVTSENDRITIASITDFWLTSNAVRKEFEFPKLKYHCPSVLYSPNVKFSEIKKAFLNISPFLFESAEACHLSSNLLTKINSEKILIEKIDKVSQTINEKSTISFQIDLTKVENELFEICKNLASKLPKSTIE-SIQERLKKVT-----NNFIYSKT--LMKELMMYSSVFGEILNFIQKTRKVIMNELGNEISDADVSVVYSLLKNQVPEKWLNKLCNPKGYSGYSTIDWISSLLVKYQHIERLILNNKDKVTCYWLGAFQKPESLLAIFKEEVSAQFIRTDRSGNYKDVKCLIEFTNKDKDHIREPPSDGIYVHGLHLWGCGFDKMTGELSDVSIKGMCTPLPVAHITFTLNDL--DKPENSDQYYCPIFFDSTAKQEPILNITISKEGI---TSSKWMLRGV 15164
            S I W  +RY +SEI YG +V            TD +     + +   F +L    P           +  +AF              H ++++     + K +++ I     +I  K   S   +    E+ +   C ++  KLP + I   +QE+L+K+      N F+  +   + K + M  +   ++   IQ T  +IMNE    + DA    + +L   ++P  WL K+       G+    W S L+ +       +  N  +   +W+  F   +  L   ++EV+    R+        V    + T    D +REPP +G+YV+GL + G  +DK    L++   K +   LPV +I F + +   +K + S  Y  PI+      +   L    S E +   T   W++RGV
Sbjct: 4195 SGIDWKCVRYMISEIQYGGRV------------TDDYDKKKCLHRNSIFTRL----PG---------KDTPEAF------------GLHPNADITYSTKTTKQILDTI----LSIQPKDAASGGGETR--ESVVMRQCGDMLQKLPSNYIPYQVQEKLQKMGALAPMNIFLRQEVDRMNKVIKMVRATLNDLQLAIQGT--IIMNE---NLRDA----LDNLYDAKIPHVWL-KISWDSATLGF----WFSELIDRNNQFSSWL--NDGRPVAFWMTGFFNAQGFLTAMRQEVT----RSHDGWALDSVVLTSKVTKHLHDELREPPKEGVYVYGLFIEGAAWDKRNSRLTEPKPKELYDNLPVINI-FAIQEATKNKIDTSKLYTTPIY---KKPRRTDLTYVASVELVCSKTPDHWVMRGV 4550          
The following BLAST results are available for this feature:
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH83.124e-17424.95dynein axonemal heavy chain 8 [Source:HGNC Symbol;... [more]
DNAH81.040e-17324.95dynein axonemal heavy chain 8 [Source:HGNC Symbol;... [more]
DNAH81.260e-17324.95dynein axonemal heavy chain 8 [Source:HGNC Symbol;... [more]
DNAH105.659e-11819.90dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
DNAH101.035e-11620.01dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dhc-12.383e-9821.79Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-18.584e-9821.79Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-18.584e-9821.79Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
che-31.174e-6521.62Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG94924.488e-16923.96gene:FBgn0037726 transcript:FBtr0309029[more]
CG94921.463e-16824.40gene:FBgn0037726 transcript:FBtr0309028[more]
CG94922.446e-16723.80gene:FBgn0037726 transcript:FBtr0344344[more]
CG94926.305e-16724.22gene:FBgn0037726 transcript:FBtr0309027[more]
kl-32.602e-14923.94gene:FBgn0267432 transcript:FBtr0346771[more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah5l3.850e-2323.33dynein, axonemal, heavy chain 5 like [Source:ZFIN;... [more]
dnah52.387e-17424.80dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:Z... [more]
si:dkeyp-86b9.14.912e-12421.90si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-1... [more]
DNAH104.912e-12421.90si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-1... [more]
dnah71.382e-10522.29dynein, axonemal, heavy chain 7 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000035049.13.928e-1924.66dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
ENSXETT00000021690.11.430e-2024.63dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
ENSXETT00000021565.11.514e-2024.57dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
ENSXETT00000021598.11.573e-2024.50dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
nifk1.211e-17524.63nucleolar protein interacting with the FHA domain ... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah57.597e-16924.57dynein, axonemal, heavy chain 5 [Source:MGI Symbol... [more]
Dnah107.832e-11919.98dynein, axonemal, heavy chain 10 [Source:MGI Symbo... [more]
Dnah101.670e-11720.14dynein, axonemal, heavy chain 10 [Source:MGI Symbo... [more]
Dnah171.064e-11521.92dynein, axonemal, heavy chain 17 [Source:MGI Symbo... [more]
Dnah174.494e-11222.04dynein, axonemal, heavy chain 17 [Source:MGI Symbo... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q39575|DYHG_CHLRE1.268e-18022.46Dynein gamma chain, flagellar outer arm OS=Chlamyd... [more]
sp|Q96JB1|DYH8_HUMAN4.996e-17324.95Dynein heavy chain 8, axonemal OS=Homo sapiens OX=... [more]
sp|Q8VHE6|DYH5_MOUSE5.314e-16824.57Dynein heavy chain 5, axonemal OS=Mus musculus OX=... [more]
sp|Q9SMH3|DYH1A_CHLRE1.100e-11621.42Dynein-1-alpha heavy chain, flagellar inner arm I1... [more]
sp|Q8IVF4|DYH10_HUMAN4.968e-11620.01Dynein heavy chain 10, axonemal OS=Homo sapiens OX... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M6TXG60.000e+026.80Uncharacterized protein OS=Pocillopora damicornis ... [more]
R7U2K29.210e-5029.97Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A210PM492.045e-15129.34Dynein heavy chain 5, axonemal OS=Mizuhopecten yes... [more]
V4A7860.000e+028.99Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
K1S1H21.556e-14229.49Dynein beta chain, ciliary OS=Crassostrea gigas OX... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah51.575e-17123.76dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:Z... [more]
si:dkeyp-86b9.15.891e-11621.78dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
dnah57.107e-8923.44dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:Z... [more]
ENSAMXT00000016401.21.015e-8422.72pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
DYNC1H13.768e-6722.44dynein cytoplasmic 1 heavy chain 1 [Source:HGNC Sy... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006497.12.040e-17824.36pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 ge... [more]
ENSPMAT00000001372.13.381e-13424.11pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 ge... [more]
ENSPMAT00000001140.11.439e-9922.16pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 ge... [more]
ENSPMAT00000001370.19.711e-7323.83pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 ge... [more]
ENSPMAT00000001365.13.135e-7223.80pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 ge... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYN11.178e-6021.43Cytoplasmic heavy chain dynein; microtubule motor ... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5