Tryptophan 5-hydroxylase

Overview
NameTryptophan 5-hydroxylase
Smed IDSMED30004098
Length (bp)2144
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tryptophan 5-hydroxylase (SMED30004098) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tryptophan 5-hydroxylase (SMED30004098) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Human
Match: PAH (phenylalanine hydroxylase [Source:HGNC Symbol;Acc:HGNC:8582])

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 260/425 (61.18%), Postives = 325/425 (76.47%), Query Frame = 2
Query:  797 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            Y+ED  ++ G  +++ +   ++G+LA +L +F++N VNL HIESRPS+  K++Y+F  + D R+   +  I  +    +   V     D  K  VPWFPR I++LDRFANQILSYG+ELDADHPGF DPVYR RRKQFADIA+ Y+HGQPI RVEY +EE  TW TVF  L +LY THAC E+N++FPLL++ CG++ DNIPQL+DVS FL+ CTGF LRPVAGLLSSRDFL GL+FRVFH TQYIRH   P+YTPEPD+CHELLGHVPLF +  FAQFSQEIGLASLGA DEYIEKLAT YWFTVEFGLCK+ D IKAYGAGLLSSFGELQYCL+++PK L  + + T +Q Y + E+QP+Y+VAESF DAK ++RNF+  + RPF+V+YDPYTQ +EVLD   Q+K L  S+  +  +L  AL
Sbjct:   24 YIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSAL 448          

HSP 2 Score: 272.322 bits (695), Expect = 3.541e-83
Identity = 126/226 (55.75%), Postives = 165/226 (73.01%), Query Frame = -2
Query:    2 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 679
            Y+ED  ++ G  +++ +   ++G+LA +L +F++N VNL HIESRPS+  K++Y+F  + D R+   +  I  +    +   V     D  K  VPWFPR I++LDRFANQILSYG+ELDADHPGF DPVYR RRKQFADIA+ Y+HGQPI RVEY +EE  TW TVF  L +LY THAC E+N++FPLL++ CG++ DNIPQL+DVS FL+ CTGF LRPVAGLL
Sbjct:   24 YIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLL 249          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Human
Match: PAH (phenylalanine hydroxylase [Source:HGNC Symbol;Acc:HGNC:8582])

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 260/426 (61.03%), Postives = 325/426 (76.29%), Query Frame = 2
Query:  797 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            Y+ED  ++ G  +++ +   ++G+LA +L +F++N VNL HIESRPS+  K++Y+F  + D R+   +  I  +    +   V     D  K  VPWFPR I++LDRFANQILSYG+ELDADHPGF DPVYR RRKQFADIA+ Y+HGQPI RVEY +EE  TW TVF  L +LY THAC E+N++FPLL++ CG++ DNIPQL+DVS FL+ CTGF LRPVAGLLSSRDFL GL+FRVFH TQYIRH   P+YTPEPD+CHELLGHVPLF +  FAQFSQEIGLASLGA DEYIEKLAT YWFTVEFGLCK+ D IKAYGAGLLSSFGELQYCL+++PK L  + + T +Q Y + E+QP+Y+VAESF DAK ++RNF+  + RPF+V+YDPYTQ +EVLD   Q+K L  S+  +  +L  AL 
Sbjct:   19 YIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQ 444          

HSP 2 Score: 272.322 bits (695), Expect = 2.709e-83
Identity = 126/226 (55.75%), Postives = 165/226 (73.01%), Query Frame = -2
Query:    2 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 679
            Y+ED  ++ G  +++ +   ++G+LA +L +F++N VNL HIESRPS+  K++Y+F  + D R+   +  I  +    +   V     D  K  VPWFPR I++LDRFANQILSYG+ELDADHPGF DPVYR RRKQFADIA+ Y+HGQPI RVEY +EE  TW TVF  L +LY THAC E+N++FPLL++ CG++ DNIPQL+DVS FL+ CTGF LRPVAGLL
Sbjct:   19 YIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLL 244          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Human
Match: TPH1 (tryptophan hydroxylase 1 [Source:HGNC Symbol;Acc:HGNC:12008])

HSP 1 Score: 479.945 bits (1234), Expect = 1.523e-163
Identity = 230/427 (53.86%), Postives = 303/427 (70.96%), Query Frame = 2
Query:  803 EDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGD----VPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            +D   + G  +++ +  +++G L   L+IF++ HVNLLHIESR SK    +++  ++ D     L      L+  +  + V    +  LK D    VPWFP+KI DLD  AN++L YGSELDADHPGF D VYR+RRK FAD+A  YKHG PI +VE+T+EEI TW TVF +L  LYPTHAC+E+    PLL + CGY  DNIPQL+DVS+FLK+ TGF++RPVAG LS RDFL+GL+FRVFH TQY+RHS  P YTPEPD CHELLGHVPL   P FAQFSQEIGLASLGAS+E ++KLATCY+FTVEFGLCK+  +++ +GAGLLSS  EL++ L+   K   FDP++T  Q+  I  +Q +YFV+ESF DAK ++R F+K + RPF VKY+PYT+++++L     I   M  L+ D +V+ +AL
Sbjct:    9 KDHSLERGRASLIFSLKNEVGGLIKALKIFQEKHVNLLHIESRKSKRRNSEFEIFVDCDINREQLNDIFHLLKSHTNVLSVNLPDNFTLKEDGMETVPWFPKKISDLDHCANRVLMYGSELDADHPGFKDNVYRKRRKYFADLAMNYKHGDPIPKVEFTEEEIKTWGTVFQELNKLYPTHACREYLKNLPLLSKYCGYREDNIPQLEDVSNFLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQYVRHSSDPFYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASEEAVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDAL 435          

HSP 2 Score: 230.335 bits (586), Expect = 1.518e-67
Identity = 113/223 (50.67%), Postives = 154/223 (69.06%), Query Frame = -2
Query:    2 GNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINAD------NRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 652
            G  +++ +  +++G L   L+IF++ HVNLLHIESR SK    +++  ++ D      N    L+ +  N+  ++L     + + D ++  VPWFP+KI DLD  AN++L YGSELDADHPGF D VYR+RRK FAD+A  YKHG PI +VE+T+EEI TW TVF +L  LYPTHAC+E+    PLL + CGY  DNIPQL+DVS+FLK+ TGF++RPVAG L
Sbjct:   16 GRASLIFSLKNEVGGLIKALKIFQEKHVNLLHIESRKSKRRNSEFEIFVDCDINREQLNDIFHLLKSHTNVLSVNLPDN-FTLKEDGMET-VPWFPKKISDLDHCANRVLMYGSELDADHPGFKDNVYRKRRKYFADLAMNYKHGDPIPKVEFTEEEIKTWGTVFQELNKLYPTHACREYLKNLPLLSKYCGYREDNIPQLEDVSNFLKERTGFSIRPVAGYL 236          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Human
Match: TPH2 (tryptophan hydroxylase 2 [Source:HGNC Symbol;Acc:HGNC:20692])

HSP 1 Score: 471.085 bits (1211), Expect = 2.146e-159
Identity = 229/448 (51.12%), Postives = 316/448 (70.54%), Query Frame = 2
Query:  755 PVMNKEEGGGTLGYYVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLS--------RQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            P   K +  G  G    +   + G T ++ +  +++G L   L +F++  VN++HIESR S+    + +  ++ +    G     E +Q L  +  +++         + + L+ DVPWFPRKI +LD+ ++++L YGSELDADHPGF D VYR+RRK F D+A  YK+GQPI RVEYT+EE  TW  VF +L+ LYPTHAC+E+   FPLL + CGY  DN+PQL+DVS FLK+ +GFT+RPVAG LS RDFLAGL++RVFH TQYIRH   PLYTPEPD CHELLGHVPL  +P+FAQFSQEIGLASLGASDE ++KLATCY+FT+EFGLCK+  +++AYGAGLLSS GEL++ L+D+    +FDP+ T LQ+  I  +Q  YFV+ESF +AK ++R+F+K + RPF+V ++PYTQ++E+L     I+ ++  L+ D N + +ALN
Sbjct:   39 PNSGKNDDKGNKGSSKREAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSSEVEIFVDCE---CGKTEFNELIQLLKFQTTIVTLNPPENIWTEEEELE-DVPWFPRKISELDKCSHRVLMYGSELDADHPGFKDNVYRQRRKYFVDVAMGYKYGQPIPRVEYTEEETKTWGVVFRELSKLYPTHACREYLKNFPLLTKYCGYREDNVPQLEDVSMFLKERSGFTVRPVAGYLSPRDFLAGLAYRVFHCTQYIRHGSDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDEDVQKLATCYFFTIEFGLCKQEGQLRAYGAGLLSSIGELKHALSDKACVKAFDPKTTCLQECLITTFQEAYFVSESFEEAKEKMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALN 482          

HSP 2 Score: 213.386 bits (542), Expect = 1.173e-60
Identity = 109/244 (44.67%), Postives = 157/244 (64.34%), Query Frame = -2
Query:    2 KEEGGGTLGYYVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLS--------RQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 709
            K +  G  G    +   + G T ++ +  +++G L   L +F++  VN++HIESR S+    + +  ++ +    G     E +Q L  +  +++         + + L+ DVPWFPRKI +LD+ ++++L YGSELDADHPGF D VYR+RRK F D+A  YK+GQPI RVEYT+EE  TW  VF +L+ LYPTHAC+E+   FPLL + CGY  DN+PQL+DVS FLK+ +GFT+RPVAG L
Sbjct:   43 KNDDKGNKGSSKREAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSSEVEIFVDCE---CGKTEFNELIQLLKFQTTIVTLNPPENIWTEEEELE-DVPWFPRKISELDKCSHRVLMYGSELDADHPGFKDNVYRQRRKYFVDVAMGYKYGQPIPRVEYTEEETKTWGVVFRELSKLYPTHACREYLKNFPLLTKYCGYREDNVPQLEDVSMFLKERSGFTVRPVAGYL 282          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Human
Match: TH (tyrosine hydroxylase [Source:HGNC Symbol;Acc:HGNC:11782])

HSP 1 Score: 442.965 bits (1138), Expect = 2.217e-148
Identity = 211/428 (49.30%), Postives = 296/428 (69.16%), Query Frame = 2
Query:  809 FPDKEGNTTILITAS---SKIGSLASILEIFKKNHVNLLHIESRPSKNLKE---QYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            F +KEG   + +  S   +K  +L+  +++F+     + H+E+RP++  +      ++ +  + R G L   +  ++ +S +V+            VPWFPRK+ +LD+  + +  +  +LD DHPGF+D VYR+RRK  A+IAF Y+HG PI RVEYT EEI TW+ V+  L  LY THAC E    F LL+   GY  DNIPQL+DVS FLK+ TGF LRPVAGLLS+RDFLA L+FRVF  TQYIRH+  P+++PEPD CHELLGHVP+  +  FAQFSQ+IGLASLGASDE IEKL+T YWFTVEFGLCK++ ++KAYGAGLLSS+GEL +CL++EP+  +FDP+   +Q Y    YQ +YFV+ESF+DAK +LR+++  + RPF+VK+DPYT  ++VLD    +++ +  ++D+ + L  AL+
Sbjct:   73 FEEKEGKAVLNLLFSPRATKPSALSRAVKVFETFEAKIHHLETRPAQRPRAGGPHLEYFVRLEVRRGDLAALLSGVRQVSEDVR------SPAGPKVPWFPRKVSELDKCHHLVTKFDPDLDLDHPGFSDQVYRQRRKLIAEIAFQYRHGDPIPRVEYTAEEIATWKEVYTTLKGLYATHACGEHLEAFALLERFSGYREDNIPQLEDVSRFLKERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASSPMHSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTLYWFTVEFGLCKQNGEVKAYGAGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALS 494          

HSP 2 Score: 187.578 bits (475), Expect = 3.199e-51
Identity = 96/228 (42.11%), Postives = 138/228 (60.53%), Query Frame = -2
Query:    2 FPDKEGNTTILITAS---SKIGSLASILEIFKKNHVNLLHIESRPSKNLKE---QYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 667
            F +KEG   + +  S   +K  +L+  +++F+     + H+E+RP++  +      ++ +  + R G L   +  ++ +S +V+            VPWFPRK+ +LD+  + +  +  +LD DHPGF+D VYR+RRK  A+IAF Y+HG PI RVEYT EEI TW+ V+  L  LY THAC E    F LL+   GY  DNIPQL+DVS FLK+ TGF LRPVAGLL
Sbjct:   73 FEEKEGKAVLNLLFSPRATKPSALSRAVKVFETFEAKIHHLETRPAQRPRAGGPHLEYFVRLEVRRGDLAALLSGVRQVSEDVR------SPAGPKVPWFPRKVSELDKCHHLVTKFDPDLDLDHPGFSDQVYRQRRKLIAEIAFQYRHGDPIPRVEYTAEEIATWKEVYTTLKGLYATHACGEHLEAFALLERFSGYREDNIPQLEDVSRFLKERTGFQLRPVAGLL 294          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Celegans
Match: pah-1 (Phenylalanine-4-hydroxylase [Source:UniProtKB/Swiss-Prot;Acc:P90925])

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 259/431 (60.09%), Postives = 327/431 (75.87%), Query Frame = 2
Query:  797 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLIN----ADNR-TGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            YV D     G TTI+ T   K G+LA  L++F+ + VNL HIESRPSK  +  Y+ L+      D+R   G++   +      + VQ  + ++   K  VPWFP+KI D+D+FAN+ILSYG+ELDADHPGF D  YRERRK FADIAF +KHG  I  + YT EEI TWRTV+++LT +YP +AC+EFNY+FPLLQ+NCG+  D IPQLQDVSDFLKDCTG+T+RPVAGLLSSRDFLAGL+FRVFHSTQYIRH   P YTPEPD+CHELLGHVPLF + EFAQFSQEIGLASLGA D+ IEKLAT YWFT+EFG+C++  + KAYGAGLLSSFGELQY L+D+P+ + FDP V  + KYPI EYQP YF+AESFA AK +L++++  ++RPF ++Y+ YTQ VE+LDK + +++L   ++ D + LEEAL 
Sbjct:   15 YVADVNADIGKTTIVFTLREKAGALAETLKLFQAHDVNLSHIESRPSKTHEGCYEVLVEFAEAEDHRKIEGVIEHFQQKAEKKVLVQDWNTKNKQNKDSVPWFPQKINDIDQFANRILSYGAELDADHPGFKDMTYRERRKFFADIAFNFKHGDKIPTITYTDEEIATWRTVYNELTVMYPKNACQEFNYIFPLLQQNCGFGPDRIPQLQDVSDFLKDCTGYTIRPVAGLLSSRDFLAGLAFRVFHSTQYIRHHSAPKYTPEPDICHELLGHVPLFADVEFAQFSQEIGLASLGAPDDVIEKLATLYWFTIEFGICQQDGEKKAYGAGLLSSFGELQYALSDKPEVVDFDPAVCCVTKYPITEYQPKYFLAESFASAKNKLKSWAATINRPFQIRYNAYTQRVEILDKVAALQRLARDIRSDISTLEEALG 445          

HSP 2 Score: 260.766 bits (665), Expect = 3.804e-79
Identity = 129/231 (55.84%), Postives = 164/231 (71.00%), Query Frame = -2
Query:    2 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLIN----ADNR-TGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 679
            YV D     G TTI+ T   K G+LA  L++F+ + VNL HIESRPSK  +  Y+ L+      D+R   G++   +      + VQ  + ++   K  VPWFP+KI D+D+FAN+ILSYG+ELDADHPGF D  YRERRK FADIAF +KHG  I  + YT EEI TWRTV+++LT +YP +AC+EFNY+FPLLQ+NCG+  D IPQLQDVSDFLKDCTG+T+RPVAGLL
Sbjct:   15 YVADVNADIGKTTIVFTLREKAGALAETLKLFQAHDVNLSHIESRPSKTHEGCYEVLVEFAEAEDHRKIEGVIEHFQQKAEKKVLVQDWNTKNKQNKDSVPWFPQKINDIDQFANRILSYGAELDADHPGFKDMTYRERRKFFADIAFNFKHGDKIPTITYTDEEIATWRTVYNELTVMYPKNACQEFNYIFPLLQQNCGFGPDRIPQLQDVSDFLKDCTGYTIRPVAGLL 245          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Celegans
Match: pah-1 (Phenylalanine-4-hydroxylase [Source:UniProtKB/Swiss-Prot;Acc:P90925])

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 259/431 (60.09%), Postives = 327/431 (75.87%), Query Frame = 2
Query:  797 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLIN----ADNR-TGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            YV D     G TTI+ T   K G+LA  L++F+ + VNL HIESRPSK  +  Y+ L+      D+R   G++   +      + VQ  + ++   K  VPWFP+KI D+D+FAN+ILSYG+ELDADHPGF D  YRERRK FADIAF +KHG  I  + YT EEI TWRTV+++LT +YP +AC+EFNY+FPLLQ+NCG+  D IPQLQDVSDFLKDCTG+T+RPVAGLLSSRDFLAGL+FRVFHSTQYIRH   P YTPEPD+CHELLGHVPLF + EFAQFSQEIGLASLGA D+ IEKLAT YWFT+EFG+C++  + KAYGAGLLSSFGELQY L+D+P+ + FDP V  + KYPI EYQP YF+AESFA AK +L++++  ++RPF ++Y+ YTQ VE+LDK + +++L   ++ D + LEEAL 
Sbjct:   19 YVADVNADIGKTTIVFTLREKAGALAETLKLFQAHDVNLSHIESRPSKTHEGCYEVLVEFAEAEDHRKIEGVIEHFQQKAEKKVLVQDWNTKNKQNKDSVPWFPQKINDIDQFANRILSYGAELDADHPGFKDMTYRERRKFFADIAFNFKHGDKIPTITYTDEEIATWRTVYNELTVMYPKNACQEFNYIFPLLQQNCGFGPDRIPQLQDVSDFLKDCTGYTIRPVAGLLSSRDFLAGLAFRVFHSTQYIRHHSAPKYTPEPDICHELLGHVPLFADVEFAQFSQEIGLASLGAPDDVIEKLATLYWFTIEFGICQQDGEKKAYGAGLLSSFGELQYALSDKPEVVDFDPAVCCVTKYPITEYQPKYFLAESFASAKNKLKSWAATINRPFQIRYNAYTQRVEILDKVAALQRLARDIRSDISTLEEALG 449          

HSP 2 Score: 260.381 bits (664), Expect = 5.074e-79
Identity = 129/231 (55.84%), Postives = 164/231 (71.00%), Query Frame = -2
Query:    2 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLIN----ADNR-TGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 679
            YV D     G TTI+ T   K G+LA  L++F+ + VNL HIESRPSK  +  Y+ L+      D+R   G++   +      + VQ  + ++   K  VPWFP+KI D+D+FAN+ILSYG+ELDADHPGF D  YRERRK FADIAF +KHG  I  + YT EEI TWRTV+++LT +YP +AC+EFNY+FPLLQ+NCG+  D IPQLQDVSDFLKDCTG+T+RPVAGLL
Sbjct:   19 YVADVNADIGKTTIVFTLREKAGALAETLKLFQAHDVNLSHIESRPSKTHEGCYEVLVEFAEAEDHRKIEGVIEHFQQKAEKKVLVQDWNTKNKQNKDSVPWFPQKINDIDQFANRILSYGAELDADHPGFKDMTYRERRKFFADIAFNFKHGDKIPTITYTDEEIATWRTVYNELTVMYPKNACQEFNYIFPLLQQNCGFGPDRIPQLQDVSDFLKDCTGYTIRPVAGLL 249          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Celegans
Match: tph-1 (TryPtophan Hydroxylase [Source:UniProtKB/TrEMBL;Acc:Q2V4U7])

HSP 1 Score: 372.859 bits (956), Expect = 4.449e-121
Identity = 197/450 (43.78%), Postives = 275/450 (61.11%), Query Frame = 2
Query:  815 DKEGNTTIL--ITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQ-YDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQ--------------HDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKE-------------HDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            D+E    IL  I  SS++    S +     +H  + H+E+R S++   +  D L+  +    G   A++ ++   L+V  +S                 D+      WFP+ I DLD  A +++ YG+ LDADHPGF D  YR+RR  FA++A  YKHG+PI R EYT  E  TW  ++ KL  L+  HACK+F   F LL+ +CGY+ +NIPQL+D+  FLK  TGF +RPVAG LS+RDFLAGL++RVF  TQY+RH   P YTPEPD  HEL+GH+ LF +P+FAQFSQEIGLASLGAS+E ++KLAT Y+F++EFGL  +             H++ K YGAGLLSS GELQ+ +      + FDP     Q+  I  +Q  YF   +F +A+ +LR F+  + RPF V+Y+PYT++VEVL+ +  I   + SL+ D N+L  AL+
Sbjct:   80 DEEEGVQILTIIVKSSRVSEDISKMIANLPDHTRIKHLETRDSQDGSSKTMDVLLEIELFHYGKQEAMDLMRLNGLDVHEVSSTIRPTAIKEQYTEPGSDDATTGSEWFPKSIYDLDICAKRVIMYGAGLDADHPGFKDTEYRQRRMMFAELALNYKHGEPIPRTEYTSSERKTWGIIYRKLRELHKKHACKQFLDNFELLERHCGYSENNIPQLEDICKFLKAKTGFRVRPVAGYLSARDFLAGLAYRVFFCTQYVRHHADPFYTPEPDTVHELMGHMALFADPDFAQFSQEIGLASLGASEEDLKKLATLYFFSIEFGLSSDDAADSPVKENGSNHERFKVYGAGLLSSAGELQHAVEGSATIIRFDPDRVVEQECLITTFQSAYFYTRNFEEAQQKLRMFTNNMKRPFIVRYNPYTESVEVLNNSRSIMLAVNSLRSDINLLAGALH 529          

HSP 2 Score: 163.31 bits (412), Expect = 6.911e-43
Identity = 92/237 (38.82%), Postives = 132/237 (55.70%), Query Frame = -2
Query:    2 DKEGNTTIL--ITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQ-YDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQ--------------HDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 661
            D+E    IL  I  SS++    S +     +H  + H+E+R S++   +  D L+  +    G   A++ ++   L+V  +S                 D+      WFP+ I DLD  A +++ YG+ LDADHPGF D  YR+RR  FA++A  YKHG+PI R EYT  E  TW  ++ KL  L+  HACK+F   F LL+ +CGY+ +NIPQL+D+  FLK  TGF +RPVAG L
Sbjct:   80 DEEEGVQILTIIVKSSRVSEDISKMIANLPDHTRIKHLETRDSQDGSSKTMDVLLEIELFHYGKQEAMDLMRLNGLDVHEVSSTIRPTAIKEQYTEPGSDDATTGSEWFPKSIYDLDICAKRVIMYGAGLDADHPGFKDTEYRQRRMMFAELALNYKHGEPIPRTEYTSSERKTWGIIYRKLRELHKKHACKQFLDNFELLERHCGYSENNIPQLEDICKFLKAKTGFRVRPVAGYL 316          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Celegans
Match: tph-1 (TryPtophan Hydroxylase [Source:UniProtKB/TrEMBL;Acc:Q2V4U7])

HSP 1 Score: 367.851 bits (943), Expect = 1.353e-120
Identity = 189/420 (45.00%), Postives = 263/420 (62.62%), Query Frame = 2
Query:  899 NHVNLLHIESRPSKNLKEQ-YDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQ--------------HDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKE-------------HDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            +H  + H+E+R S++   +  D L+  +    G   A++ ++   L+V  +S                 D+      WFP+ I DLD  A +++ YG+ LDADHPGF D  YR+RR  FA++A  YKHG+PI R EYT  E  TW  ++ KL  L+  HACK+F   F LL+ +CGY+ +NIPQL+D+  FLK  TGF +RPVAG LS+RDFLAGL++RVF  TQY+RH   P YTPEPD  HEL+GH+ LF +P+FAQFSQEIGLASLGAS+E ++KLAT Y+F++EFGL  +             H++ K YGAGLLSS GELQ+ +      + FDP     Q+  I  +Q  YF   +F +A+ +LR F+  + RPF V+Y+PYT++VEVL+ +  I   + SL+ D N+L  AL+
Sbjct:    7 DHTRIKHLETRDSQDGSSKTMDVLLEIELFHYGKQEAMDLMRLNGLDVHEVSSTIRPTAIKEQYTEPGSDDATTGSEWFPKSIYDLDICAKRVIMYGAGLDADHPGFKDTEYRQRRMMFAELALNYKHGEPIPRTEYTSSERKTWGIIYRKLRELHKKHACKQFLDNFELLERHCGYSENNIPQLEDICKFLKAKTGFRVRPVAGYLSARDFLAGLAYRVFFCTQYVRHHADPFYTPEPDTVHELMGHMALFADPDFAQFSQEIGLASLGASEEDLKKLATLYFFSIEFGLSSDDAADSPVKENGSNHERFKVYGAGLLSSAGELQHAVEGSATIIRFDPDRVVEQECLITTFQSAYFYTRNFEEAQQKLRMFTNNMKRPFIVRYNPYTESVEVLNNSRSIMLAVNSLRSDINLLAGALH 426          

HSP 2 Score: 160.229 bits (404), Expect = 1.654e-42
Identity = 84/207 (40.58%), Postives = 120/207 (57.97%), Query Frame = -2
Query:    2 NHVNLLHIESRPSKNLKEQ-YDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQ--------------HDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 577
            +H  + H+E+R S++   +  D L+  +    G   A++ ++   L+V  +S                 D+      WFP+ I DLD  A +++ YG+ LDADHPGF D  YR+RR  FA++A  YKHG+PI R EYT  E  TW  ++ KL  L+  HACK+F   F LL+ +CGY+ +NIPQL+D+  FLK  TGF +RPVAG L
Sbjct:    7 DHTRIKHLETRDSQDGSSKTMDVLLEIELFHYGKQEAMDLMRLNGLDVHEVSSTIRPTAIKEQYTEPGSDDATTGSEWFPKSIYDLDICAKRVIMYGAGLDADHPGFKDTEYRQRRMMFAELALNYKHGEPIPRTEYTSSERKTWGIIYRKLRELHKKHACKQFLDNFELLERHCGYSENNIPQLEDICKFLKAKTGFRVRPVAGYL 213          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Celegans
Match: cat-2 (Tyrosine 3-monooxygenase [Source:UniProtKB/Swiss-Prot;Acc:P90986])

HSP 1 Score: 353.214 bits (905), Expect = 1.490e-114
Identity = 180/420 (42.86%), Postives = 260/420 (61.90%), Query Frame = 2
Query:  833 TILITASSKIGS--LASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLS----RQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            +I++T++    S  ++ IL+      V + H+E+R ++     +D L+        L+ + E L    + +   S    +  D       WFPR I +LD+ +  I  Y    D  HPG  D  Y  RRK   D A  +K G  I  V+YT+EE  TW+ V++KL  L+ +H C  +     +LQE      D IPQ++DV+ FL+  TGF LRP +GLLS+RDFLA L+FRVF +T Y+RH K P ++PEPD+ HELLGHVP+F +P  AQ SQ+IGL SLGASDE+IEKL+T YWF VEFGLCKE  K+KA GAGLLS++GEL +  +D P+   FDP VT +QKY   +YQP+YFVA+S  DA  +LR ++  +DRPF+V YDP+T+++E ++ ++ +++    L +D + +  A +
Sbjct:   30 SIILTSTDPTLSNFVSDILQNMSSAKVQICHVETRGNE---ASHDVLLACKATKNQLIHSAELLTQNHVALTKFSIFAKKLSDEKNQSQIWFPRHISELDQCSKCITKYEPTTDPRHPGHGDVAYIARRKFLNDQALEFKFGDEIGYVDYTEEEHATWKAVYEKLGDLHLSHTCAVYRQNLKILQEEKVLTADRIPQIRDVNKFLQKKTGFELRPCSGLLSARDFLASLAFRVFQTTTYLRHHKSPHHSPEPDLIHELLGHVPMFSDPLLAQMSQDIGLMSLGASDEHIEKLSTVYWFIVEFGLCKEDGKLKAIGAGLLSAYGELMHACSDAPEHKDFDPAVTAVQKYEDDDYQPLYFVADSIHDALAKLRKYASSMDRPFSVVYDPFTKSIEAIESSADLEKAFSRLSNDLSAITHAAD 446          

HSP 2 Score: 114.775 bits (286), Expect = 8.053e-27
Identity = 72/220 (32.73%), Postives = 110/220 (50.00%), Query Frame = -2
Query:    2 TILITASSKIGS--LASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLS----RQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 643
            +I++T++    S  ++ IL+      V + H+E+R ++     +D L+        L+ + E L    + +   S    +  D       WFPR I +LD+ +  I  Y    D  HPG  D  Y  RRK   D A  +K G  I  V+YT+EE  TW+ V++KL  L+ +H C  +     +LQE      D IPQ++DV+ FL+  TGF LRP +GLL
Sbjct:   30 SIILTSTDPTLSNFVSDILQNMSSAKVQICHVETRGNE---ASHDVLLACKATKNQLIHSAELLTQNHVALTKFSIFAKKLSDEKNQSQIWFPRHISELDQCSKCITKYEPTTDPRHPGHGDVAYIARRKFLNDQALEFKFGDEIGYVDYTEEEHATWKAVYEKLGDLHLSHTCAVYRQNLKILQEEKVLTADRIPQIRDVNKFLQKKTGFELRPCSGLL 246          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Fly
Match: Hn (gene:FBgn0001208 transcript:FBtr0334645)

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 264/431 (61.25%), Postives = 336/431 (77.96%), Query Frame = 2
Query:  791 GYYVEDFPDKEGNTTILI----TASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
             Y VE    KE   T L+     +S   G+LA+IL IFKK+ +NL+HIESR S  +   Y+F + AD ++G L  AIE+++       ++SR + +    VPWFPR+I+DLDRFANQILSYGSELDADHPGFTDP YR+RRK FADIA+ YKHG+P+  V+YTKEEI TW  +F  LT LY THAC+E+N+VFPLL +NCG+  DNIPQL+DVS+FL+DCTGFTLRPVAGLLSSRDFLAGL+FRVFHSTQYIRH   P+YTPEPDVCHEL+GHVPLF +P FAQFSQEIGLASLGA D+YIEKL+T +WFTVE+G+C++  ++KAYGAGLLSS+GEL+YCLTD+P+   F+P+VTG+ KYPI ++QP+Y+VA+SF  AK +   F+  + RPF V+Y+ YTQ+VEVLD   QI  LM ++  +F +L+ A+
Sbjct:   18 AYIVEGVDIKEARNTCLLFSPKDSSLSSGALANILAIFKKHDINLVHIESRSSLRVP-GYEFFVEADGKSGALGKAIEDVKEQCSYFNIISRDYKDNATAVPWFPRRIRDLDRFANQILSYGSELDADHPGFTDPEYRKRRKYFADIAYNYKHGEPLPHVDYTKEEIETWGIIFRNLTKLYKTHACREYNHVFPLLVDNCGFREDNIPQLEDVSNFLRDCTGFTLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPMYTPEPDVCHELMGHVPLFADPAFAQFSQEIGLASLGAPDDYIEKLSTIFWFTVEYGVCRQEGELKAYGAGLLSSYGELEYCLTDKPQLKDFEPEVTGVTKYPITQFQPLYYVADSFETAKEKTIKFANSIPRPFGVRYNAYTQSVEVLDSKPQISNLMDNINSEFQILQNAV 447          

HSP 2 Score: 282.337 bits (721), Expect = 2.661e-87
Identity = 137/232 (59.05%), Postives = 172/232 (74.14%), Query Frame = -2
Query:    2 GYYVEDFPDKEGNTTILI----TASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 685
             Y VE    KE   T L+     +S   G+LA+IL IFKK+ +NL+HIESR S  +   Y+F + AD ++G L  AIE+++       ++SR + +    VPWFPR+I+DLDRFANQILSYGSELDADHPGFTDP YR+RRK FADIA+ YKHG+P+  V+YTKEEI TW  +F  LT LY THAC+E+N+VFPLL +NCG+  DNIPQL+DVS+FL+DCTGFTLRPVAGLL
Sbjct:   18 AYIVEGVDIKEARNTCLLFSPKDSSLSSGALANILAIFKKHDINLVHIESRSSLRVP-GYEFFVEADGKSGALGKAIEDVKEQCSYFNIISRDYKDNATAVPWFPRRIRDLDRFANQILSYGSELDADHPGFTDPEYRKRRKYFADIAYNYKHGEPLPHVDYTKEEIETWGIIFRNLTKLYKTHACREYNHVFPLLVDNCGFREDNIPQLEDVSNFLRDCTGFTLRPVAGLL 248          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Fly
Match: Hn (gene:FBgn0001208 transcript:FBtr0076811)

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 264/431 (61.25%), Postives = 336/431 (77.96%), Query Frame = 2
Query:  791 GYYVEDFPDKEGNTTILI----TASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
             Y VE    KE   T L+     +S   G+LA+IL IFKK+ +NL+HIESR S  +   Y+F + AD ++G L  AIE+++       ++SR + +    VPWFPR+I+DLDRFANQILSYGSELDADHPGFTDP YR+RRK FADIA+ YKHG+P+  V+YTKEEI TW  +F  LT LY THAC+E+N+VFPLL +NCG+  DNIPQL+DVS+FL+DCTGFTLRPVAGLLSSRDFLAGL+FRVFHSTQYIRH   P+YTPEPDVCHEL+GHVPLF +P FAQFSQEIGLASLGA D+YIEKL+T +WFTVE+G+C++  ++KAYGAGLLSS+GEL+YCLTD+P+   F+P+VTG+ KYPI ++QP+Y+VA+SF  AK +   F+  + RPF V+Y+ YTQ+VEVLD   QI  LM ++  +F +L+ A+
Sbjct:   18 AYIVEGVDIKEARNTCLLFSPKDSSLSSGALANILAIFKKHDINLVHIESRSSLRVP-GYEFFVEADGKSGALGKAIEDVKEQCSYFNIISRDYKDNATAVPWFPRRIRDLDRFANQILSYGSELDADHPGFTDPEYRKRRKYFADIAYNYKHGEPLPHVDYTKEEIETWGIIFRNLTKLYKTHACREYNHVFPLLVDNCGFREDNIPQLEDVSNFLRDCTGFTLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPMYTPEPDVCHELMGHVPLFADPAFAQFSQEIGLASLGAPDDYIEKLSTIFWFTVEYGVCRQEGELKAYGAGLLSSYGELEYCLTDKPQLKDFEPEVTGVTKYPITQFQPLYYVADSFETAKEKTIKFANSIPRPFGVRYNAYTQSVEVLDSKPQISNLMDNINSEFQILQNAV 447          

HSP 2 Score: 282.337 bits (721), Expect = 2.661e-87
Identity = 137/232 (59.05%), Postives = 172/232 (74.14%), Query Frame = -2
Query:    2 GYYVEDFPDKEGNTTILI----TASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 685
             Y VE    KE   T L+     +S   G+LA+IL IFKK+ +NL+HIESR S  +   Y+F + AD ++G L  AIE+++       ++SR + +    VPWFPR+I+DLDRFANQILSYGSELDADHPGFTDP YR+RRK FADIA+ YKHG+P+  V+YTKEEI TW  +F  LT LY THAC+E+N+VFPLL +NCG+  DNIPQL+DVS+FL+DCTGFTLRPVAGLL
Sbjct:   18 AYIVEGVDIKEARNTCLLFSPKDSSLSSGALANILAIFKKHDINLVHIESRSSLRVP-GYEFFVEADGKSGALGKAIEDVKEQCSYFNIISRDYKDNATAVPWFPRRIRDLDRFANQILSYGSELDADHPGFTDPEYRKRRKYFADIAYNYKHGEPLPHVDYTKEEIETWGIIFRNLTKLYKTHACREYNHVFPLLVDNCGFREDNIPQLEDVSNFLRDCTGFTLRPVAGLL 248          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Fly
Match: Hn (gene:FBgn0001208 transcript:FBtr0100225)

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 264/431 (61.25%), Postives = 336/431 (77.96%), Query Frame = 2
Query:  791 GYYVEDFPDKEGNTTILI----TASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
             Y VE    KE   T L+     +S   G+LA+IL IFKK+ +NL+HIESR S  +   Y+F + AD ++G L  AIE+++       ++SR + +    VPWFPR+I+DLDRFANQILSYGSELDADHPGFTDP YR+RRK FADIA+ YKHG+P+  V+YTKEEI TW  +F  LT LY THAC+E+N+VFPLL +NCG+  DNIPQL+DVS+FL+DCTGFTLRPVAGLLSSRDFLAGL+FRVFHSTQYIRH   P+YTPEPDVCHEL+GHVPLF +P FAQFSQEIGLASLGA D+YIEKL+T +WFTVE+G+C++  ++KAYGAGLLSS+GEL+YCLTD+P+   F+P+VTG+ KYPI ++QP+Y+VA+SF  AK +   F+  + RPF V+Y+ YTQ+VEVLD   QI  LM ++  +F +L+ A+
Sbjct:   13 AYIVEGVDIKEARNTCLLFSPKDSSLSSGALANILAIFKKHDINLVHIESRSSLRVP-GYEFFVEADGKSGALGKAIEDVKEQCSYFNIISRDYKDNATAVPWFPRRIRDLDRFANQILSYGSELDADHPGFTDPEYRKRRKYFADIAYNYKHGEPLPHVDYTKEEIETWGIIFRNLTKLYKTHACREYNHVFPLLVDNCGFREDNIPQLEDVSNFLRDCTGFTLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPMYTPEPDVCHELMGHVPLFADPAFAQFSQEIGLASLGAPDDYIEKLSTIFWFTVEYGVCRQEGELKAYGAGLLSSYGELEYCLTDKPQLKDFEPEVTGVTKYPITQFQPLYYVADSFETAKEKTIKFANSIPRPFGVRYNAYTQSVEVLDSKPQISNLMDNINSEFQILQNAV 442          

HSP 2 Score: 282.337 bits (721), Expect = 2.186e-87
Identity = 137/232 (59.05%), Postives = 172/232 (74.14%), Query Frame = -2
Query:    2 GYYVEDFPDKEGNTTILI----TASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 685
             Y VE    KE   T L+     +S   G+LA+IL IFKK+ +NL+HIESR S  +   Y+F + AD ++G L  AIE+++       ++SR + +    VPWFPR+I+DLDRFANQILSYGSELDADHPGFTDP YR+RRK FADIA+ YKHG+P+  V+YTKEEI TW  +F  LT LY THAC+E+N+VFPLL +NCG+  DNIPQL+DVS+FL+DCTGFTLRPVAGLL
Sbjct:   13 AYIVEGVDIKEARNTCLLFSPKDSSLSSGALANILAIFKKHDINLVHIESRSSLRVP-GYEFFVEADGKSGALGKAIEDVKEQCSYFNIISRDYKDNATAVPWFPRRIRDLDRFANQILSYGSELDADHPGFTDPEYRKRRKYFADIAYNYKHGEPLPHVDYTKEEIETWGIIFRNLTKLYKTHACREYNHVFPLLVDNCGFREDNIPQLEDVSNFLRDCTGFTLRPVAGLL 243          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Fly
Match: Trh (gene:FBgn0035187 transcript:FBtr0072638)

HSP 1 Score: 432.95 bits (1112), Expect = 5.048e-144
Identity = 223/427 (52.22%), Postives = 287/427 (67.21%), Query Frame = 2
Query:  833 TILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINA-------DNRTGGLMMAIENLQGLSLEVQVLSRQHDNLK------GDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKI-KAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            +I+ T  +++G+LA  L++F++  +N+LH+E  P +    Q D L++        D     L   + ++   S+  Q L+R            GD+ WFPRKI DLD+ A  +L YGSELDADHPGF DPVYR+RR+QF+ IA  +KHG PI RV+YT EE+ TW TVF +L  LY  HA  E+   +P L++ CGY  DN+PQLQDVS +LK  TGF LRPVAG LS RDFL+GL+FRVFH TQYIRHS  P YTPEPD CHELLGH+PL  N  FAQFSQEIGLASLGASD  IEKLAT Y+FTVEFGLCK+ D   K YGAGLLSS  ELQ+ +T E K   FDP+VT  Q+  I  YQ  Y+  +SF +AK ++R F++ + RPF V+Y+PYT +VEVL    +I  ++  L+ D +++  AL
Sbjct:   80 SIIFTLRNQVGNLARALQVFQELGINVLHLELSPLEMATNQADVLVDVECDQRRLDQVVKMLNREVASVNYTSVNTQGLARAPSLSACSSFDFGDMVWFPRKISDLDK-AQNVLMYGSELDADHPGFKDPVYRKRREQFSAIANNFKHGNPIPRVQYTPEEVKTWGTVFLELHRLYVLHAVPEYMDNWPELEKYCGYREDNVPQLQDVSVYLKRKTGFQLRPVAGYLSPRDFLSGLAFRVFHCTQYIRHSSDPFYTPEPDCCHELLGHMPLLANSSFAQFSQEIGLASLGASDADIEKLATLYFFTVEFGLCKQADSTFKVYGAGLLSSVAELQHAITAENKIKKFDPEVTCQQECIITSYQNAYYYTDSFEEAKEQMRAFAESIQRPFGVRYNPYTMSVEVLSNAKKITAVVSELRGDLSIVCSAL 505          

HSP 2 Score: 196.052 bits (497), Expect = 3.613e-54
Identity = 105/227 (46.26%), Postives = 142/227 (62.56%), Query Frame = -2
Query:    2 TILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINA-------DNRTGGLMMAIENLQGLSLEVQVLSRQHDNLK------GDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 643
            +I+ T  +++G+LA  L++F++  +N+LH+E  P +    Q D L++        D     L   + ++   S+  Q L+R            GD+ WFPRKI DLD+ A  +L YGSELDADHPGF DPVYR+RR+QF+ IA  +KHG PI RV+YT EE+ TW TVF +L  LY  HA  E+   +P L++ CGY  DN+PQLQDVS +LK  TGF LRPVAG L
Sbjct:   80 SIIFTLRNQVGNLARALQVFQELGINVLHLELSPLEMATNQADVLVDVECDQRRLDQVVKMLNREVASVNYTSVNTQGLARAPSLSACSSFDFGDMVWFPRKISDLDK-AQNVLMYGSELDADHPGFKDPVYRKRREQFSAIANNFKHGNPIPRVQYTPEEVKTWGTVFLELHRLYVLHAVPEYMDNWPELEKYCGYREDNVPQLQDVSVYLKRKTGFQLRPVAGYL 305          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Fly
Match: ple (gene:FBgn0005626 transcript:FBtr0076956)

HSP 1 Score: 413.69 bits (1062), Expect = 3.987e-137
Identity = 199/416 (47.84%), Postives = 274/416 (65.87%), Query Frame = 2
Query:  827 NTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            +  +++     I SL  IL+  +  H  + H+ESR S+     +D LI  D   G L+  I +L+       +     +NL    PWFP+   +LD   + +  Y  +LD +HPGF D VYR+RRK+ A+IAF YK+G PI  ++Y+  E+ TWR+VF  +  L P HAC E+   F  LQ+   +    +PQLQ++SDFL+  TGF+LRP AGLL++RDFLA L+FR+F STQY+RH   P +TPEPD  HELLGH+PL  +P FAQFSQEIGLASLGASDE IEKL+T YWFTVEFGLCKEH +IKAYGAGLLSS+GEL + ++D+ +  +F+P  T +Q Y   EYQPIY+VAESF DAK + R +   + RPF V+++P+T+ VEVLD   +++ L+  +  +   L  A++
Sbjct:   87 SAALVVRLKEGISSLGRILKAIETFHGTVQHVESRQSRVEGVDHDVLIKLDMTRGNLLQLIRSLRQSGSFSSMNLMADNNLNVKAPWFPKHASELDNCNHLMTKYEPDLDMNHPGFADKVYRQRRKEIAEIAFAYKYGDPIPFIDYSDVEVKTWRSVFKTVQDLAPKHACAEYRAAFQKLQDEQIFVETRLPQLQEMSDFLRKNTGFSLRPAAGLLTARDFLASLAFRIFQSTQYVRHVNSPYHTPEPDSIHELLGHMPLLADPSFAQFSQEIGLASLGASDEEIEKLSTVYWFTVEFGLCKEHGQIKAYGAGLLSSYGELLHAISDKCEHRAFEPASTAVQPYQDQEYQPIYYVAESFEDAKDKFRRWVSTMSRPFEVRFNPHTERVEVLDSVDKLETLVHQMNTEILHLTNAIS 502          

HSP 2 Score: 167.548 bits (423), Expect = 1.996e-44
Identity = 84/216 (38.89%), Postives = 123/216 (56.94%), Query Frame = -2
Query:    2 NTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 649
            +  +++     I SL  IL+  +  H  + H+ESR S+     +D LI  D   G L+  I +L+       +     +NL    PWFP+   +LD   + +  Y  +LD +HPGF D VYR+RRK+ A+IAF YK+G PI  ++Y+  E+ TWR+VF  +  L P HAC E+   F  LQ+   +    +PQLQ++SDFL+  TGF+LRP AGLL
Sbjct:   87 SAALVVRLKEGISSLGRILKAIETFHGTVQHVESRQSRVEGVDHDVLIKLDMTRGNLLQLIRSLRQSGSFSSMNLMADNNLNVKAPWFPKHASELDNCNHLMTKYEPDLDMNHPGFADKVYRQRRKEIAEIAFAYKYGDPIPFIDYSDVEVKTWRSVFKTVQDLAPKHACAEYRAAFQKLQDEQIFVETRLPQLQEMSDFLRKNTGFSLRPAAGLL 302          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Zebrafish
Match: pah (phenylalanine hydroxylase [Source:ZFIN;Acc:ZDB-GENE-031006-2])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 266/434 (61.29%), Postives = 330/434 (76.04%), Query Frame = 2
Query:  770 EEGGGTLGYYVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            E  G     Y+E+  +K G  + + +   ++G+L   L++F++  +NL HIESRPS+   E+Y+F I+ D  +  ++  I +     +  QV     +  K  VPWFP  I+DLDRFANQILSYGSELDADHPGFTD VYR RRK+FADIA+ Y+HGQPI RVEYT EE  TW TVF +L TLYPTHAC+E N VFPLL++ CGY  DNIPQL+D+S +L+ CTGF LRPVAGLLSSRDFLAGL+FRVFHSTQYIRHS  P+YTPEPD+CHELLGHVPLF +P FAQFSQEIGLASLGA DE+IEKLAT YWFTVEFGLCK+ +++KAYGAGLLSSFGELQYCLT+EPK   F+P+ T  QKYPI E+QP+YFVAESF DAK ++R F+  + RPF+V+Y+ YTQ +E+LD   Q+K L  S+  + ++L  AL
Sbjct:   13 ERKGSLTSSYLEEPKNKSGVVSCIFSLKEEVGALVKALKLFEEKGINLTHIESRPSRKNNEEYEFFISVDQASSKVLDEIVDGLRTQIRGQVHELSRNKQKDTVPWFPNDIQDLDRFANQILSYGSELDADHPGFTDTVYRARRKEFADIAYNYRHGQPIPRVEYTAEEKATWGTVFRELKTLYPTHACREHNRVFPLLEKYCGYREDNIPQLEDISHYLQSCTGFRLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHSSKPMYTPEPDICHELLGHVPLFADPNFAQFSQEIGLASLGAPDEFIEKLATVYWFTVEFGLCKQGNEVKAYGAGLLSSFGELQYCLTNEPKLQPFEPEKTCQQKYPITEFQPVYFVAESFEDAKEKVRRFATTIPRPFSVRYNAYTQRIEMLDNAQQLKNLADSINGEISILCNAL 446          

HSP 2 Score: 270.781 bits (691), Expect = 8.827e-83
Identity = 128/235 (54.47%), Postives = 164/235 (69.79%), Query Frame = -2
Query:    2 EEGGGTLGYYVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 706
            E  G     Y+E+  +K G  + + +   ++G+L   L++F++  +NL HIESRPS+   E+Y+F I+ D  +  ++  I +     +  QV     +  K  VPWFP  I+DLDRFANQILSYGSELDADHPGFTD VYR RRK+FADIA+ Y+HGQPI RVEYT EE  TW TVF +L TLYPTHAC+E N VFPLL++ CGY  DNIPQL+D+S +L+ CTGF LRPVAGLL
Sbjct:   13 ERKGSLTSSYLEEPKNKSGVVSCIFSLKEEVGALVKALKLFEEKGINLTHIESRPSRKNNEEYEFFISVDQASSKVLDEIVDGLRTQIRGQVHELSRNKQKDTVPWFPNDIQDLDRFANQILSYGSELDADHPGFTDTVYRARRKEFADIAYNYRHGQPIPRVEYTAEEKATWGTVFRELKTLYPTHACREHNRVFPLLEKYCGYREDNIPQLEDISHYLQSCTGFRLRPVAGLL 247          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Zebrafish
Match: tph1a (tryptophan hydroxylase 1 (tryptophan 5-monooxygenase) a [Source:ZFIN;Acc:ZDB-GENE-030317-1])

HSP 1 Score: 481.871 bits (1239), Expect = 6.586e-164
Identity = 226/424 (53.30%), Postives = 307/424 (72.41%), Query Frame = 2
Query:  824 GNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQ-------HDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            G   ++ +  +++G L   L++F++NHVNL+HIESR SK    +++  ++ D+    L    E +Q L   V V+           ++   +VPWFP+KI DLD+ AN++L YGS+LDADHPGF D VYR+RRK FAD+A  YKHG PI R+E+T+EE+ TW  VF +L  LYP+HAC+E+    PLL ++C    DNIPQL+DVS FLK+ TGFT+RPVAG LS RDFLAGL+FRVFH TQY+RHS  PLYTPEPD CHELLGHVPL   P FAQFSQEIGLASLGASD+ I+KLATCY+FTVEFGLCK+  K++AYGAGLLSS  EL++ L+   + L FDP VT  Q+  I  +Q +YF+++SF +AK+++R F+K + RPF+V+Y+PYTQ+V+VL   + I  ++  L+ + +++ +AL+
Sbjct:   55 GRAAVVFSLKNEVGGLVKALKLFQENHVNLVHIESRKSKRRNSEFEIFVDCDSNREQLH---EIIQLLRKHVNVVEMDAPDNRLPEESEMENVPWFPKKISDLDKCANRVLMYGSDLDADHPGFKDNVYRKRRKYFADLAMSYKHGDPIPRIEFTEEEVKTWGVVFRELNKLYPSHACREYLKNLPLLIKHCDSREDNIPQLEDVSRFLKERTGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDDSIQKLATCYFFTVEFGLCKQEGKLRAYGAGLLSSISELKHALSGNARILPFDPNVTCKQECIITTFQDVYFMSDSFEEAKVKMREFAKTIKRPFSVRYNPYTQSVDVLKDTTSINNVVEELRHELDIIGDALS 475          

HSP 2 Score: 224.557 bits (571), Expect = 4.954e-65
Identity = 108/224 (48.21%), Postives = 150/224 (66.96%), Query Frame = -2
Query:    2 GNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQ-------HDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 652
            G   ++ +  +++G L   L++F++NHVNL+HIESR SK    +++  ++ D+    L    E +Q L   V V+           ++   +VPWFP+KI DLD+ AN++L YGS+LDADHPGF D VYR+RRK FAD+A  YKHG PI R+E+T+EE+ TW  VF +L  LYP+HAC+E+    PLL ++C    DNIPQL+DVS FLK+ TGFT+RPVAG L
Sbjct:   55 GRAAVVFSLKNEVGGLVKALKLFQENHVNLVHIESRKSKRRNSEFEIFVDCDSNREQLH---EIIQLLRKHVNVVEMDAPDNRLPEESEMENVPWFPKKISDLDKCANRVLMYGSDLDADHPGFKDNVYRKRRKYFADLAMSYKHGDPIPRIEFTEEEVKTWGVVFRELNKLYPSHACREYLKNLPLLIKHCDSREDNIPQLEDVSRFLKERTGFTIRPVAGYL 275          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Zebrafish
Match: tph1a (tryptophan hydroxylase 1 (tryptophan 5-monooxygenase) a [Source:ZFIN;Acc:ZDB-GENE-030317-1])

HSP 1 Score: 481.485 bits (1238), Expect = 8.091e-164
Identity = 226/424 (53.30%), Postives = 307/424 (72.41%), Query Frame = 2
Query:  824 GNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQ-------HDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            G   ++ +  +++G L   L++F++NHVNL+HIESR SK    +++  ++ D+    L    E +Q L   V V+           ++   +VPWFP+KI DLD+ AN++L YGS+LDADHPGF D VYR+RRK FAD+A  YKHG PI R+E+T+EE+ TW  VF +L  LYP+HAC+E+    PLL ++C    DNIPQL+DVS FLK+ TGFT+RPVAG LS RDFLAGL+FRVFH TQY+RHS  PLYTPEPD CHELLGHVPL   P FAQFSQEIGLASLGASD+ I+KLATCY+FTVEFGLCK+  K++AYGAGLLSS  EL++ L+   + L FDP VT  Q+  I  +Q +YF+++SF +AK+++R F+K + RPF+V+Y+PYTQ+V+VL   + I  ++  L+ + +++ +AL+
Sbjct:   55 GRAAVVFSLKNEVGGLVKALKLFQENHVNLVHIESRKSKRRNSEFEIFVDCDSNREQLH---EIIQLLRKHVNVVEMDAPDNRLPEESEMENVPWFPKKISDLDKCANRVLMYGSDLDADHPGFKDNVYRKRRKYFADLAMSYKHGDPIPRIEFTEEEVKTWGVVFRELNKLYPSHACREYLKNLPLLIKHCDSREDNIPQLEDVSRFLKERTGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDDSIQKLATCYFFTVEFGLCKQEGKLRAYGAGLLSSISELKHALSGNARILPFDPNVTCKQECIITTFQDVYFMSDSFEEAKVKMREFAKTIKRPFSVRYNPYTQSVDVLKDTTSINNVVEELRHELDIIGDALS 475          

HSP 2 Score: 224.172 bits (570), Expect = 5.215e-65
Identity = 108/224 (48.21%), Postives = 150/224 (66.96%), Query Frame = -2
Query:    2 GNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQ-------HDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 652
            G   ++ +  +++G L   L++F++NHVNL+HIESR SK    +++  ++ D+    L    E +Q L   V V+           ++   +VPWFP+KI DLD+ AN++L YGS+LDADHPGF D VYR+RRK FAD+A  YKHG PI R+E+T+EE+ TW  VF +L  LYP+HAC+E+    PLL ++C    DNIPQL+DVS FLK+ TGFT+RPVAG L
Sbjct:   55 GRAAVVFSLKNEVGGLVKALKLFQENHVNLVHIESRKSKRRNSEFEIFVDCDSNREQLH---EIIQLLRKHVNVVEMDAPDNRLPEESEMENVPWFPKKISDLDKCANRVLMYGSDLDADHPGFKDNVYRKRRKYFADLAMSYKHGDPIPRIEFTEEEVKTWGVVFRELNKLYPSHACREYLKNLPLLIKHCDSREDNIPQLEDVSRFLKERTGFTIRPVAGYL 275          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Zebrafish
Match: tph1b (tryptophan hydroxylase 1b [Source:ZFIN;Acc:ZDB-GENE-030805-6])

HSP 1 Score: 474.167 bits (1219), Expect = 5.708e-161
Identity = 227/425 (53.41%), Postives = 303/425 (71.29%), Query Frame = 2
Query:  818 KEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNL-------KGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            K  +  I+ +  +++G L   L++F+ N VNLLHIESR S+    + + L++ D+    L    E +Q L  +  +++    +          +VPWFP+KI DLD+ A ++L YGSELDADHPGF D VYR+RRK FAD+A  YKHG PI  VE+T+EE+ TW  VF +L  LYPTHAC+E+    PLL + CGY  DNIPQL+DVS+FL++ TGFT+RPVAG LS RDFLAGL+FRVFH TQY+RHS  PLYTPEPD CHELLGHVPL   P FAQFSQE+GLASLGASD+ ++KLATCY+FTVEFGLCK+   ++AYGAGLLSS  EL++ L+D  K L F+P+VT  Q+  I  +Q +YFV+ESF +AK R+R F+K + RPF+++Y+PYTQ+V VL     I  ++  L+ + +++ +AL
Sbjct:   50 KREHAAIVFSLKNEVGGLVKALKLFQDNQVNLLHIESRKSRRRNSELEVLVDCDSDRETLK---EIVQLLRKQTSIIAMNSPDKFWTPASDLAEVPWFPKKISDLDKSACRVLMYGSELDADHPGFKDNVYRKRRKYFADLAMSYKHGDPIPHVEFTEEEVKTWGVVFRELNKLYPTHACREYLQNLPLLSQFCGYREDNIPQLEDVSNFLRERTGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQELGLASLGASDDAVQKLATCYFFTVEFGLCKQEGSLRAYGAGLLSSISELKHSLSDSAKILPFEPKVTCKQECLITTFQDVYFVSESFEEAKCRMREFAKTIQRPFSLRYNPYTQSVCVLKDMPSINDVVEELRHELDIVGDAL 471          

HSP 2 Score: 221.861 bits (564), Expect = 3.773e-64
Identity = 109/226 (48.23%), Postives = 149/226 (65.93%), Query Frame = -2
Query:    2 KEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNL-------KGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 658
            K  +  I+ +  +++G L   L++F+ N VNLLHIESR S+    + + L++ D+    L    E +Q L  +  +++    +          +VPWFP+KI DLD+ A ++L YGSELDADHPGF D VYR+RRK FAD+A  YKHG PI  VE+T+EE+ TW  VF +L  LYPTHAC+E+    PLL + CGY  DNIPQL+DVS+FL++ TGFT+RPVAG L
Sbjct:   50 KREHAAIVFSLKNEVGGLVKALKLFQDNQVNLLHIESRKSRRRNSELEVLVDCDSDRETLK---EIVQLLRKQTSIIAMNSPDKFWTPASDLAEVPWFPKKISDLDKSACRVLMYGSELDADHPGFKDNVYRKRRKYFADLAMSYKHGDPIPHVEFTEEEVKTWGVVFRELNKLYPTHACREYLQNLPLLSQFCGYREDNIPQLEDVSNFLRERTGFTIRPVAGYL 272          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Zebrafish
Match: tph1b (tryptophan hydroxylase 1b [Source:ZFIN;Acc:ZDB-GENE-030805-6])

HSP 1 Score: 474.167 bits (1219), Expect = 5.708e-161
Identity = 227/425 (53.41%), Postives = 303/425 (71.29%), Query Frame = 2
Query:  818 KEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNL-------KGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            K  +  I+ +  +++G L   L++F+ N VNLLHIESR S+    + + L++ D+    L    E +Q L  +  +++    +          +VPWFP+KI DLD+ A ++L YGSELDADHPGF D VYR+RRK FAD+A  YKHG PI  VE+T+EE+ TW  VF +L  LYPTHAC+E+    PLL + CGY  DNIPQL+DVS+FL++ TGFT+RPVAG LS RDFLAGL+FRVFH TQY+RHS  PLYTPEPD CHELLGHVPL   P FAQFSQE+GLASLGASD+ ++KLATCY+FTVEFGLCK+   ++AYGAGLLSS  EL++ L+D  K L F+P+VT  Q+  I  +Q +YFV+ESF +AK R+R F+K + RPF+++Y+PYTQ+V VL     I  ++  L+ + +++ +AL
Sbjct:   50 KREHAAIVFSLKNEVGGLVKALKLFQDNQVNLLHIESRKSRRRNSELEVLVDCDSDRETLK---EIVQLLRKQTSIIAMNSPDKFWTPASDLAEVPWFPKKISDLDKSACRVLMYGSELDADHPGFKDNVYRKRRKYFADLAMSYKHGDPIPHVEFTEEEVKTWGVVFRELNKLYPTHACREYLQNLPLLSQFCGYREDNIPQLEDVSNFLRERTGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQELGLASLGASDDAVQKLATCYFFTVEFGLCKQEGSLRAYGAGLLSSISELKHSLSDSAKILPFEPKVTCKQECLITTFQDVYFVSESFEEAKCRMREFAKTIQRPFSLRYNPYTQSVCVLKDMPSINDVVEELRHELDIVGDAL 471          

HSP 2 Score: 221.861 bits (564), Expect = 3.773e-64
Identity = 109/226 (48.23%), Postives = 149/226 (65.93%), Query Frame = -2
Query:    2 KEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNL-------KGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 658
            K  +  I+ +  +++G L   L++F+ N VNLLHIESR S+    + + L++ D+    L    E +Q L  +  +++    +          +VPWFP+KI DLD+ A ++L YGSELDADHPGF D VYR+RRK FAD+A  YKHG PI  VE+T+EE+ TW  VF +L  LYPTHAC+E+    PLL + CGY  DNIPQL+DVS+FL++ TGFT+RPVAG L
Sbjct:   50 KREHAAIVFSLKNEVGGLVKALKLFQDNQVNLLHIESRKSRRRNSELEVLVDCDSDRETLK---EIVQLLRKQTSIIAMNSPDKFWTPASDLAEVPWFPKKISDLDKSACRVLMYGSELDADHPGFKDNVYRKRRKYFADLAMSYKHGDPIPHVEFTEEEVKTWGVVFRELNKLYPTHACREYLQNLPLLSQFCGYREDNIPQLEDVSNFLRERTGFTIRPVAGYL 272          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Xenopus
Match: hmgcr (3-hydroxy-3-methylglutaryl-CoA reductase [Source:Xenbase;Acc:XB-GENE-5840593])

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 271/442 (61.31%), Postives = 336/442 (76.02%), Query Frame = 2
Query:  752 NPVMNKEEGGGTLGYYVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNR-TGGLMMAIENLQG-LSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            N   +K +GG T      +   ++   +++ +   ++G+LA +L IF++  ++L HIESRPS+  K++Y F IN D++ T  L   I  L+  +   V  LSR  +  K  VPWFPR I+DLD+FANQILSYG+ELDADHPGFTDPVYR  RK+FADIA+ YKHGQPI  V YT +E  TW TVF +L TLYPTHAC E N+VFPLL+E CGYN +NIPQL+DVS+FL+ CTGF LRPVAGLLSSRDFLAGL+FRVFHSTQYIRH   P+YTPEPDVCHELLGH PLF +P FAQFSQEIGLASLGA DEYIE LAT YWFT+EFG+CK+  K+KAYGAGLLSSFGELQYCLTD+P+   F+P+ T LQKYPI E+QPIYF+AESF +AK ++R F+  + RPF+V+Y+PYTQ++EVLD   Q+K L  S+  +  +L  AL
Sbjct:    2 NGEASKIKGGHTYEVNGIENNQEDNRISLIFSLKEEVGALAKVLRIFEEKDISLTHIESRPSRLNKDEYQFFINLDDKSTHALDDIISCLRNDIGATVHELSR--NKRKDAVPWFPRTIQDLDKFANQILSYGAELDADHPGFTDPVYRALRKEFADIAYNYKHGQPIPHVTYTDQEKKTWGTVFRELKTLYPTHACYEHNHVFPLLEEYCGYNENNIPQLEDVSNFLQKCTGFRLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHWSKPMYTPEPDVCHELLGHAPLFADPGFAQFSQEIGLASLGAPDEYIEMLATVYWFTIEFGICKQDGKLKAYGAGLLSSFGELQYCLTDKPEFKPFEPEKTALQKYPITEFQPIYFIAESFEEAKEKIRKFATTIPRPFSVRYNPYTQSIEVLDNIQQLKNLAESINSEIGILCSAL 441          

HSP 2 Score: 261.922 bits (668), Expect = 2.287e-79
Identity = 129/221 (58.37%), Postives = 164/221 (74.21%), Query Frame = -2
Query:    2 KEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNR-TGGLMMAIENLQG-LSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 658
            ++   +++ +   ++G+LA +L IF++  ++L HIESRPS+  K++Y F IN D++ T  L   I  L+  +   V  LSR  +  K  VPWFPR I+DLD+FANQILSYG+ELDADHPGFTDPVYR  RK+FADIA+ YKHGQPI  V YT +E  TW TVF +L TLYPTHAC E N+VFPLL+E CGYN +NIPQL+DVS+FL+ CTGF LRPVAGLL
Sbjct:   24 EDNRISLIFSLKEEVGALAKVLRIFEEKDISLTHIESRPSRLNKDEYQFFINLDDKSTHALDDIISCLRNDIGATVHELSR--NKRKDAVPWFPRTIQDLDKFANQILSYGAELDADHPGFTDPVYRALRKEFADIAYNYKHGQPIPHVTYTDQEKKTWGTVFRELKTLYPTHACYEHNHVFPLLEEYCGYNENNIPQLEDVSNFLQKCTGFRLRPVAGLL 242          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Xenopus
Match: hmgcr (3-hydroxy-3-methylglutaryl-CoA reductase [Source:Xenbase;Acc:XB-GENE-5840593])

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 266/420 (63.33%), Postives = 328/420 (78.10%), Query Frame = 2
Query:  818 KEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNR-TGGLMMAIENLQG-LSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            ++   +++ +   ++G+LA +L IF++  ++L HIESRPS+  K++Y F IN D++ T  L   I  L+  +   V  LSR  +  K  VPWFPR I+DLD+FANQILSYG+ELDADHPGFTDPVYR  RK+FADIA+ YKHGQPI  V YT +E  TW TVF +L TLYPTHAC E N+VFPLL+E CGYN +NIPQL+DVS+FL+ CTGF LRPVAGLLSSRDFLAGL+FRVFHSTQYIRH   P+YTPEPDVCHELLGH PLF +P FAQFSQEIGLASLGA DEYIE LAT YWFT+EFG+CK+  K+KAYGAGLLSSFGELQYCLTD+P+   F+P+ T LQKYPI E+QPIYF+AESF +AK ++R F+  + RPF+V+Y+PYTQ++EVLD   Q+K L  S+  +  +L  AL
Sbjct:   20 EDNRISLIFSLKEEVGALAKVLRIFEEKDISLTHIESRPSRLNKDEYQFFINLDDKSTHALDDIISCLRNDIGATVHELSR--NKRKDAVPWFPRTIQDLDKFANQILSYGAELDADHPGFTDPVYRALRKEFADIAYNYKHGQPIPHVTYTDQEKKTWGTVFRELKTLYPTHACYEHNHVFPLLEEYCGYNENNIPQLEDVSNFLQKCTGFRLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHWSKPMYTPEPDVCHELLGHAPLFADPGFAQFSQEIGLASLGAPDEYIEMLATVYWFTIEFGICKQDGKLKAYGAGLLSSFGELQYCLTDKPEFKPFEPEKTALQKYPITEFQPIYFIAESFEEAKEKIRKFATTIPRPFSVRYNPYTQSIEVLDNIQQLKNLAESINSEIGILCSAL 437          

HSP 2 Score: 261.922 bits (668), Expect = 1.823e-79
Identity = 129/221 (58.37%), Postives = 164/221 (74.21%), Query Frame = -2
Query:    2 KEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNR-TGGLMMAIENLQG-LSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 658
            ++   +++ +   ++G+LA +L IF++  ++L HIESRPS+  K++Y F IN D++ T  L   I  L+  +   V  LSR  +  K  VPWFPR I+DLD+FANQILSYG+ELDADHPGFTDPVYR  RK+FADIA+ YKHGQPI  V YT +E  TW TVF +L TLYPTHAC E N+VFPLL+E CGYN +NIPQL+DVS+FL+ CTGF LRPVAGLL
Sbjct:   20 EDNRISLIFSLKEEVGALAKVLRIFEEKDISLTHIESRPSRLNKDEYQFFINLDDKSTHALDDIISCLRNDIGATVHELSR--NKRKDAVPWFPRTIQDLDKFANQILSYGAELDADHPGFTDPVYRALRKEFADIAYNYKHGQPIPHVTYTDQEKKTWGTVFRELKTLYPTHACYEHNHVFPLLEEYCGYNENNIPQLEDVSNFLQKCTGFRLRPVAGLL 238          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Xenopus
Match: hmgcr (3-hydroxy-3-methylglutaryl-CoA reductase [Source:Xenbase;Acc:XB-GENE-5840593])

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 266/420 (63.33%), Postives = 328/420 (78.10%), Query Frame = 2
Query:  818 KEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNR-TGGLMMAIENLQG-LSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            ++   +++ +   ++G+LA +L IF++  ++L HIESRPS+  K++Y F IN D++ T  L   I  L+  +   V  LSR  +  K  VPWFPR I+DLD+FANQILSYG+ELDADHPGFTDPVYR  RK+FADIA+ YKHGQPI  V YT +E  TW TVF +L TLYPTHAC E N+VFPLL+E CGYN +NIPQL+DVS+FL+ CTGF LRPVAGLLSSRDFLAGL+FRVFHSTQYIRH   P+YTPEPDVCHELLGH PLF +P FAQFSQEIGLASLGA DEYIE LAT YWFT+EFG+CK+  K+KAYGAGLLSSFGELQYCLTD+P+   F+P+ T LQKYPI E+QPIYF+AESF +AK ++R F+  + RPF+V+Y+PYTQ++EVLD   Q+K L  S+  +  +L  AL
Sbjct:   29 EDNRISLIFSLKEEVGALAKVLRIFEEKDISLTHIESRPSRLNKDEYQFFINLDDKSTHALDDIISCLRNDIGATVHELSR--NKRKDAVPWFPRTIQDLDKFANQILSYGAELDADHPGFTDPVYRALRKEFADIAYNYKHGQPIPHVTYTDQEKKTWGTVFRELKTLYPTHACYEHNHVFPLLEEYCGYNENNIPQLEDVSNFLQKCTGFRLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHWSKPMYTPEPDVCHELLGHAPLFADPGFAQFSQEIGLASLGAPDEYIEMLATVYWFTIEFGICKQDGKLKAYGAGLLSSFGELQYCLTDKPEFKPFEPEKTALQKYPITEFQPIYFIAESFEEAKEKIRKFATTIPRPFSVRYNPYTQSIEVLDNIQQLKNLAESINSEIGILCSAL 446          

HSP 2 Score: 262.307 bits (669), Expect = 1.900e-79
Identity = 129/221 (58.37%), Postives = 164/221 (74.21%), Query Frame = -2
Query:    2 KEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNR-TGGLMMAIENLQG-LSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 658
            ++   +++ +   ++G+LA +L IF++  ++L HIESRPS+  K++Y F IN D++ T  L   I  L+  +   V  LSR  +  K  VPWFPR I+DLD+FANQILSYG+ELDADHPGFTDPVYR  RK+FADIA+ YKHGQPI  V YT +E  TW TVF +L TLYPTHAC E N+VFPLL+E CGYN +NIPQL+DVS+FL+ CTGF LRPVAGLL
Sbjct:   29 EDNRISLIFSLKEEVGALAKVLRIFEEKDISLTHIESRPSRLNKDEYQFFINLDDKSTHALDDIISCLRNDIGATVHELSR--NKRKDAVPWFPRTIQDLDKFANQILSYGAELDADHPGFTDPVYRALRKEFADIAYNYKHGQPIPHVTYTDQEKKTWGTVFRELKTLYPTHACYEHNHVFPLLEEYCGYNENNIPQLEDVSNFLQKCTGFRLRPVAGLL 247          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Xenopus
Match: hmgcr (3-hydroxy-3-methylglutaryl-CoA reductase [Source:Xenbase;Acc:XB-GENE-5840593])

HSP 1 Score: 538.88 bits (1387), Expect = 0.000e+0
Identity = 260/392 (66.33%), Postives = 311/392 (79.34%), Query Frame = 2
Query:  902 HVNLLHIESRPSKNLKEQYDFLINADNR-TGGLMMAIENLQG-LSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            +++L HIESRPS+  K++Y F IN D++ T  L   I  L+  +   V  LSR  +  K  VPWFPR I+DLD+FANQILSYG+ELDADHPGFTDPVYR  RK+FADIA+ YKHGQPI  V YT +E  TW TVF +L TLYPTHAC E N+VFPLL+E CGYN +NIPQL+DVS+FL+ CTGF LRPVAGLLSSRDFLAGL+FRVFHSTQYIRH   P+YTPEPDVCHELLGH PLF +P FAQFSQEIGLASLGA DEYIE LAT YWFT+EFG+CK+  K+KAYGAGLLSSFGELQYCLTD+P+   F+P+ T LQKYPI E+QPIYF+AESF +AK ++R F+  + RPF+V+Y+PYTQ++EVLD   Q+K L  S+  +  +L  AL
Sbjct:   11 NISLTHIESRPSRLNKDEYQFFINLDDKSTHALDDIISCLRNDIGATVHELSR--NKRKDAVPWFPRTIQDLDKFANQILSYGAELDADHPGFTDPVYRALRKEFADIAYNYKHGQPIPHVTYTDQEKKTWGTVFRELKTLYPTHACYEHNHVFPLLEEYCGYNENNIPQLEDVSNFLQKCTGFRLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHWSKPMYTPEPDVCHELLGHAPLFADPGFAQFSQEIGLASLGAPDEYIEMLATVYWFTIEFGICKQDGKLKAYGAGLLSSFGELQYCLTDKPEFKPFEPEKTALQKYPITEFQPIYFIAESFEEAKEKIRKFATTIPRPFSVRYNPYTQSIEVLDNIQQLKNLAESINSEIGILCSAL 400          

HSP 2 Score: 246.128 bits (627), Expect = 7.478e-74
Identity = 123/192 (64.06%), Postives = 146/192 (76.04%), Query Frame = -2
Query:    2 VNLLHIESRPSKNLKEQYDFLINADNR-TGGLMMAIENLQG-LSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 571
            ++L HIESRPS+  K++Y F IN D++ T  L   I  L+  +   V  LSR  +  K  VPWFPR I+DLD+FANQILSYG+ELDADHPGFTDPVYR  RK+FADIA+ YKHGQPI  V YT +E  TW TVF +L TLYPTHAC E N+VFPLL+E CGYN +NIPQL+DVS+FL+ CTGF LRPVAGLL
Sbjct:   12 ISLTHIESRPSRLNKDEYQFFINLDDKSTHALDDIISCLRNDIGATVHELSR--NKRKDAVPWFPRTIQDLDKFANQILSYGAELDADHPGFTDPVYRALRKEFADIAYNYKHGQPIPHVTYTDQEKKTWGTVFRELKTLYPTHACYEHNHVFPLLEEYCGYNENNIPQLEDVSNFLQKCTGFRLRPVAGLL 201          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Xenopus
Match: hmgcr (3-hydroxy-3-methylglutaryl-CoA reductase [Source:Xenbase;Acc:XB-GENE-5840593])

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 260/389 (66.84%), Postives = 308/389 (79.18%), Query Frame = 2
Query:  911 LLHIESRPSKNLKEQYDFLINADNR-TGGLMMAIENLQG-LSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            L HIESRPS+  K++Y F IN D++ T  L   I  L+  +   V  LSR  +  K  VPWFPR I+DLD+FANQILSYG+ELDADHPGFTDPVYR  RK+FADIA+ YKHGQPI  V YT +E  TW TVF +L TLYPTHAC E N+VFPLL+E CGYN +NIPQL+DVS+FL+ CTGF LRPVAGLLSSRDFLAGL+FRVFHSTQYIRH   P+YTPEPDVCHELLGH PLF +P FAQFSQEIGLASLGA DEYIE LAT YWFT+EFG+CK+  K+KAYGAGLLSSFGELQYCLTD+P+   F+P+ T LQKYPI E+QPIYF+AESF +AK ++R F+  + RPF+V+Y+PYTQ++EVLD   Q+K L  S+  +  +L  AL
Sbjct:   27 LTHIESRPSRLNKDEYQFFINLDDKSTHALDDIISCLRNDIGATVHELSR--NKRKDAVPWFPRTIQDLDKFANQILSYGAELDADHPGFTDPVYRALRKEFADIAYNYKHGQPIPHVTYTDQEKKTWGTVFRELKTLYPTHACYEHNHVFPLLEEYCGYNENNIPQLEDVSNFLQKCTGFRLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHWSKPMYTPEPDVCHELLGHAPLFADPGFAQFSQEIGLASLGAPDEYIEMLATVYWFTIEFGICKQDGKLKAYGAGLLSSFGELQYCLTDKPEFKPFEPEKTALQKYPITEFQPIYFIAESFEEAKEKIRKFATTIPRPFSVRYNPYTQSIEVLDNIQQLKNLAESINSEIGILCSAL 413          

HSP 2 Score: 244.202 bits (622), Expect = 5.093e-73
Identity = 123/190 (64.74%), Postives = 144/190 (75.79%), Query Frame = -2
Query:    2 LLHIESRPSKNLKEQYDFLINADNR-TGGLMMAIENLQG-LSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 565
            L HIESRPS+  K++Y F IN D++ T  L   I  L+  +   V  LSR  +  K  VPWFPR I+DLD+FANQILSYG+ELDADHPGFTDPVYR  RK+FADIA+ YKHGQPI  V YT +E  TW TVF +L TLYPTHAC E N+VFPLL+E CGYN +NIPQL+DVS+FL+ CTGF LRPVAGLL
Sbjct:   27 LTHIESRPSRLNKDEYQFFINLDDKSTHALDDIISCLRNDIGATVHELSR--NKRKDAVPWFPRTIQDLDKFANQILSYGAELDADHPGFTDPVYRALRKEFADIAYNYKHGQPIPHVTYTDQEKKTWGTVFRELKTLYPTHACYEHNHVFPLLEEYCGYNENNIPQLEDVSNFLQKCTGFRLRPVAGLL 214          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Mouse
Match: Pah (phenylalanine hydroxylase [Source:MGI Symbol;Acc:MGI:97473])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 267/429 (62.24%), Postives = 328/429 (76.46%), Query Frame = 2
Query:  797 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRT----GGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            Y+ED  ++ G  +++ +   ++G+LA +L +F++N +NL HIESRPS+  K++Y+F    D R+    G ++ ++ N  G +  V  LSR  D  K  VPWFPR I++LDRFANQILSYG+ELDADHPGF DPVYR RRKQFADIA+ Y+HGQPI RVEYT+EE  TW TVF  L  LY THAC E N++FPLL++ CG+  DNIPQL+DVS FL+ CTGF LRPVAGLLSSRDFL GL+FRVFH TQYIRH   P+YTPEPD+CHELLGHVPLF +  FAQFSQEIGLASLGA DEYIEKLAT YWFTVEFGLCKE D IKAYGAGLLSSFGELQYCL+D+PK L  + + T  Q+Y + E+QP+Y+VAESF DAK ++R F+  + RPF+V+YDPYTQ VEVLD   Q+K L  S+  +  +L  AL
Sbjct:   24 YIEDNSNQNGAVSLIFSLKEEVGALAKVLRLFEENEINLTHIESRPSRLNKDEYEFFTYLDKRSKPVLGSIIKSLRNDIGAT--VHELSR--DKEKNTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYTEEERKTWGTVFRTLKALYKTHACYEHNHIFPLLEKYCGFREDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKEGDSIKAYGAGLLSSFGELQYCLSDKPKLLPLELEKTACQEYTVTEFQPLYYVAESFNDAKEKVRTFAATIPRPFSVRYDPYTQRVEVLDNTQQLKILADSINSEVGILCHAL 448          

HSP 2 Score: 273.478 bits (698), Expect = 9.915e-84
Identity = 131/230 (56.96%), Postives = 169/230 (73.48%), Query Frame = -2
Query:    2 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRT----GGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 679
            Y+ED  ++ G  +++ +   ++G+LA +L +F++N +NL HIESRPS+  K++Y+F    D R+    G ++ ++ N  G +  V  LSR  D  K  VPWFPR I++LDRFANQILSYG+ELDADHPGF DPVYR RRKQFADIA+ Y+HGQPI RVEYT+EE  TW TVF  L  LY THAC E N++FPLL++ CG+  DNIPQL+DVS FL+ CTGF LRPVAGLL
Sbjct:   24 YIEDNSNQNGAVSLIFSLKEEVGALAKVLRLFEENEINLTHIESRPSRLNKDEYEFFTYLDKRSKPVLGSIIKSLRNDIGAT--VHELSR--DKEKNTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYTEEERKTWGTVFRTLKALYKTHACYEHNHIFPLLEKYCGFREDNIPQLEDVSQFLQTCTGFRLRPVAGLL 249          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Mouse
Match: Tph1 (tryptophan hydroxylase 1 [Source:MGI Symbol;Acc:MGI:98796])

HSP 1 Score: 480.715 bits (1236), Expect = 4.926e-164
Identity = 231/427 (54.10%), Postives = 303/427 (70.96%), Query Frame = 2
Query:  803 EDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDV----PWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            +D   + G  T++ +  +++G L  +L+IF++NHV+LLHIESR SK    +++  ++ D     L      L+  +  + V S      K DV    PWFP+KI DLD  AN++L YGSELDADHPGF D VYR RRK FA++A  YKHG PI ++E+T+EEI TW T+F +L  LYPTHAC+E+    PLL + CGY  DNIPQL+DVS+FLK+ TGF++RPVAG LS RDFL+GL+FRVFH TQY+RHS  PLYTPEPD CHELLGHVPL   P FAQFSQEIGLASLGAS+E ++KLATCY+FTVEFGLCK+  +++ +GAGLLSS  EL++ L+   K   FDP++   Q+  I  +Q +YFV+ESF DAK ++R F+K V RPF +KY+PYTQ+V+VL     I   M  L+ D +V+ +AL
Sbjct:   12 KDHSSERGRVTLIFSLENEVGGLIKVLKIFQENHVSLLHIESRKSKQRNSEFEIFVDCDISREQLNDIFPLLKSHATVLSVDSPDQLTAKEDVMETVPWFPKKISDLDFCANRVLLYGSELDADHPGFKDNVYRRRRKYFAELAMNYKHGDPIPKIEFTEEEIKTWGTIFRELNKLYPTHACREYLRNLPLLSKYCGYREDNIPQLEDVSNFLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASEETVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSGHAKVKPFDPKIACKQECLITSFQDVYFVSESFEDAKEKMREFAKTVKRPFGLKYNPYTQSVQVLRDTKSITSAMNELRYDLDVISDAL 438          

HSP 2 Score: 231.491 bits (589), Expect = 5.697e-68
Identity = 113/228 (49.56%), Postives = 153/228 (67.11%), Query Frame = -2
Query:    2 EDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDV----PWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 673
            +D   + G  T++ +  +++G L  +L+IF++NHV+LLHIESR SK    +++  ++ D     L      L+  +  + V S      K DV    PWFP+KI DLD  AN++L YGSELDADHPGF D VYR RRK FA++A  YKHG PI ++E+T+EEI TW T+F +L  LYPTHAC+E+    PLL + CGY  DNIPQL+DVS+FLK+ TGF++RPVAG L
Sbjct:   12 KDHSSERGRVTLIFSLENEVGGLIKVLKIFQENHVSLLHIESRKSKQRNSEFEIFVDCDISREQLNDIFPLLKSHATVLSVDSPDQLTAKEDVMETVPWFPKKISDLDFCANRVLLYGSELDADHPGFKDNVYRRRRKYFAELAMNYKHGDPIPKIEFTEEEIKTWGTIFRELNKLYPTHACREYLRNLPLLSKYCGYREDNIPQLEDVSNFLKERTGFSIRPVAGYL 239          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Mouse
Match: Tph1 (tryptophan hydroxylase 1 [Source:MGI Symbol;Acc:MGI:98796])

HSP 1 Score: 480.715 bits (1236), Expect = 4.926e-164
Identity = 231/427 (54.10%), Postives = 303/427 (70.96%), Query Frame = 2
Query:  803 EDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDV----PWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            +D   + G  T++ +  +++G L  +L+IF++NHV+LLHIESR SK    +++  ++ D     L      L+  +  + V S      K DV    PWFP+KI DLD  AN++L YGSELDADHPGF D VYR RRK FA++A  YKHG PI ++E+T+EEI TW T+F +L  LYPTHAC+E+    PLL + CGY  DNIPQL+DVS+FLK+ TGF++RPVAG LS RDFL+GL+FRVFH TQY+RHS  PLYTPEPD CHELLGHVPL   P FAQFSQEIGLASLGAS+E ++KLATCY+FTVEFGLCK+  +++ +GAGLLSS  EL++ L+   K   FDP++   Q+  I  +Q +YFV+ESF DAK ++R F+K V RPF +KY+PYTQ+V+VL     I   M  L+ D +V+ +AL
Sbjct:   12 KDHSSERGRVTLIFSLENEVGGLIKVLKIFQENHVSLLHIESRKSKQRNSEFEIFVDCDISREQLNDIFPLLKSHATVLSVDSPDQLTAKEDVMETVPWFPKKISDLDFCANRVLLYGSELDADHPGFKDNVYRRRRKYFAELAMNYKHGDPIPKIEFTEEEIKTWGTIFRELNKLYPTHACREYLRNLPLLSKYCGYREDNIPQLEDVSNFLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASEETVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSGHAKVKPFDPKIACKQECLITSFQDVYFVSESFEDAKEKMREFAKTVKRPFGLKYNPYTQSVQVLRDTKSITSAMNELRYDLDVISDAL 438          

HSP 2 Score: 231.491 bits (589), Expect = 5.697e-68
Identity = 113/228 (49.56%), Postives = 153/228 (67.11%), Query Frame = -2
Query:    2 EDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDV----PWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 673
            +D   + G  T++ +  +++G L  +L+IF++NHV+LLHIESR SK    +++  ++ D     L      L+  +  + V S      K DV    PWFP+KI DLD  AN++L YGSELDADHPGF D VYR RRK FA++A  YKHG PI ++E+T+EEI TW T+F +L  LYPTHAC+E+    PLL + CGY  DNIPQL+DVS+FLK+ TGF++RPVAG L
Sbjct:   12 KDHSSERGRVTLIFSLENEVGGLIKVLKIFQENHVSLLHIESRKSKQRNSEFEIFVDCDISREQLNDIFPLLKSHATVLSVDSPDQLTAKEDVMETVPWFPKKISDLDFCANRVLLYGSELDADHPGFKDNVYRRRRKYFAELAMNYKHGDPIPKIEFTEEEIKTWGTIFRELNKLYPTHACREYLRNLPLLSKYCGYREDNIPQLEDVSNFLKERTGFSIRPVAGYL 239          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Mouse
Match: Tph2 (tryptophan hydroxylase 2 [Source:MGI Symbol;Acc:MGI:2651811])

HSP 1 Score: 467.618 bits (1202), Expect = 2.424e-158
Identity = 224/424 (52.83%), Postives = 309/424 (72.88%), Query Frame = 2
Query:  827 NTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLS--------RQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
             T ++ +  +++G L   L +F++ HVN+LHIESR S+    + +  ++ +    G     E +Q L  +  +++         + ++L+ DVPWFPRKI +LDR ++++L YG+ELDADHPGF D VYR+RRK F D+A  YK+GQPI RVEYT+EE  TW  VF +L+ LYPTHAC+E+    PLL + CGY  DN+PQL+DVS FLK+ +GFT+RPVAG LS RDFLAGL++RVFH TQY+RH   PLYTPEPD CHELLGHVPL  +P+FAQFSQEIGLASLGASDE ++KLATCY+FT+EFGLCK+  +++AYGAGLLSS GEL++ L+D+    SFDP+ T LQ+  I  +Q  YFV++SF +AK ++R+F+K + RPF+V ++PYTQ++E+L     I+ ++  L+ D N + +ALN
Sbjct:   61 KTAVVFSLKNEVGGLVKALRLFQEKHVNMLHIESRRSRRRSSEVEIFVDCE---CGKTEFNELIQLLKFQTTIVTLNPPESIWTEEEDLE-DVPWFPRKISELDRCSHRVLMYGTELDADHPGFKDNVYRQRRKYFVDVAMGYKYGQPIPRVEYTEEETKTWGVVFRELSKLYPTHACREYLKNLPLLTKYCGYREDNVPQLEDVSMFLKERSGFTVRPVAGYLSPRDFLAGLAYRVFHCTQYVRHGSDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDEDVQKLATCYFFTIEFGLCKQEGQLRAYGAGLLSSIGELKHALSDKACVKSFDPKTTCLQECLITTFQDAYFVSDSFEEAKEKMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALN 480          

HSP 2 Score: 213.386 bits (542), Expect = 6.404e-61
Identity = 106/227 (46.70%), Postives = 152/227 (66.96%), Query Frame = -2
Query:    2 KEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLS--------RQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 658
            +   T ++ +  +++G L   L +F++ HVN+LHIESR S+    + +  ++ +    G     E +Q L  +  +++         + ++L+ DVPWFPRKI +LDR ++++L YG+ELDADHPGF D VYR+RRK F D+A  YK+GQPI RVEYT+EE  TW  VF +L+ LYPTHAC+E+    PLL + CGY  DN+PQL+DVS FLK+ +GFT+RPVAG L
Sbjct:   58 ESSKTAVVFSLKNEVGGLVKALRLFQEKHVNMLHIESRRSRRRSSEVEIFVDCE---CGKTEFNELIQLLKFQTTIVTLNPPESIWTEEEDLE-DVPWFPRKISELDRCSHRVLMYGTELDADHPGFKDNVYRQRRKYFVDVAMGYKYGQPIPRVEYTEEETKTWGVVFRELSKLYPTHACREYLKNLPLLTKYCGYREDNVPQLEDVSMFLKERSGFTVRPVAGYL 280          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Mouse
Match: Th (tyrosine hydroxylase [Source:MGI Symbol;Acc:MGI:98735])

HSP 1 Score: 444.121 bits (1141), Expect = 6.017e-149
Identity = 214/428 (50.00%), Postives = 301/428 (70.33%), Query Frame = 2
Query:  809 FPDKEGNTTILITAS---SKIGSLASILEIFKKNHVNLLHIESRPSKNL---KEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            F +++GN  + +  S   +K  SL+  L++F+     + H+E+RP++         ++ +  +  +G L   + +++ +S +V+  S + D     VPWFPRK+ +LD+  + +  +  +LD DHPGF+D  YR+RRK  A+IAF YK G+PI  VEYTKEEI TW+ V+  L  LY THAC+E    F LL+  CGY  D+IPQL+DVS FLK+ TGF LRPVAGLLS+RDFLA L+FRVF  TQYIRH+  P+++PEPD CHELLGHVP+  +  FAQFSQ+IGLASLGASDE IEKL+T YWFTVEFGLCK++ ++KAYGAGLLSS+GEL + L++EP+  +FDP    +Q Y    YQP+YFV+ESF+DAK +LRN++  + RPF+VK+DPYT  ++VLD    I++ +  ++D+ + L +AL+
Sbjct:   74 FEERDGNAVLNLLFSLRGTKPSSLSRALKVFETFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVR--SAREDK----VPWFPRKVSELDKCHHLVTKFDPDLDLDHPGFSDQAYRQRRKLIAEIAFQYKQGEPIPHVEYTKEEIATWKEVYATLKGLYATHACREHLEAFQLLERYCGYREDSIPQLEDVSHFLKERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASSPMHSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTVYWFTVEFGLCKQNGELKAYGAGLLSSYGELLHSLSEEPEVRAFDPDTAAVQPYQDQTYQPVYFVSESFSDAKDKLRNYASRIQRPFSVKFDPYTLAIDVLDSPHTIRRSLEGVQDELHTLTQALS 495          

HSP 2 Score: 188.734 bits (478), Expect = 6.647e-52
Identity = 101/240 (42.08%), Postives = 147/240 (61.25%), Query Frame = -2
Query:    2 EGGGTLGYYVEDFPDKEGNTTILITAS---SKIGSLASILEIFKKNHVNLLHIESRPSKNL---KEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 703
            E G  L   V  F +++GN  + +  S   +K  SL+  L++F+     + H+E+RP++         ++ +  +  +G L   + +++ +S +V+  S + D     VPWFPRK+ +LD+  + +  +  +LD DHPGF+D  YR+RRK  A+IAF YK G+PI  VEYTKEEI TW+ V+  L  LY THAC+E    F LL+  CGY  D+IPQL+DVS FLK+ TGF LRPVAGLL
Sbjct:   64 EPGNPLEAVV--FEERDGNAVLNLLFSLRGTKPSSLSRALKVFETFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVR--SAREDK----VPWFPRKVSELDKCHHLVTKFDPDLDLDHPGFSDQAYRQRRKLIAEIAFQYKQGEPIPHVEYTKEEIATWKEVYATLKGLYATHACREHLEAFQLLERYCGYREDSIPQLEDVSHFLKERTGFQLRPVAGLL 295          
BLAST of Tryptophan 5-hydroxylase vs. UniProt/SwissProt
Match: sp|P17276|PH4H_DROME (Protein henna OS=Drosophila melanogaster OX=7227 GN=Hn PE=2 SV=3)

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 264/431 (61.25%), Postives = 336/431 (77.96%), Query Frame = 2
Query:  791 GYYVEDFPDKEGNTTILI----TASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
             Y VE    KE   T L+     +S   G+LA+IL IFKK+ +NL+HIESR S  +   Y+F + AD ++G L  AIE+++       ++SR + +    VPWFPR+I+DLDRFANQILSYGSELDADHPGFTDP YR+RRK FADIA+ YKHG+P+  V+YTKEEI TW  +F  LT LY THAC+E+N+VFPLL +NCG+  DNIPQL+DVS+FL+DCTGFTLRPVAGLLSSRDFLAGL+FRVFHSTQYIRH   P+YTPEPDVCHEL+GHVPLF +P FAQFSQEIGLASLGA D+YIEKL+T +WFTVE+G+C++  ++KAYGAGLLSS+GEL+YCLTD+P+   F+P+VTG+ KYPI ++QP+Y+VA+SF  AK +   F+  + RPF V+Y+ YTQ+VEVLD   QI  LM ++  +F +L+ A+
Sbjct:   18 AYIVEGVDIKEARNTCLLFSPKDSSLSSGALANILAIFKKHDINLVHIESRSSLRVP-GYEFFVEADGKSGALGKAIEDVKEQCSYFNIISRDYKDNATAVPWFPRRIRDLDRFANQILSYGSELDADHPGFTDPEYRKRRKYFADIAYNYKHGEPLPHVDYTKEEIETWGIIFRNLTKLYKTHACREYNHVFPLLVDNCGFREDNIPQLEDVSNFLRDCTGFTLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPMYTPEPDVCHELMGHVPLFADPAFAQFSQEIGLASLGAPDDYIEKLSTIFWFTVEYGVCRQEGELKAYGAGLLSSYGELEYCLTDKPQLKDFEPEVTGVTKYPITQFQPLYYVADSFETAKEKTIKFANSIPRPFGVRYNAYTQSVEVLDSKPQISNLMDNINSEFQILQNAV 447          

HSP 2 Score: 282.337 bits (721), Expect = 2.668e-86
Identity = 137/232 (59.05%), Postives = 172/232 (74.14%), Query Frame = -2
Query:    2 GYYVEDFPDKEGNTTILI----TASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 685
             Y VE    KE   T L+     +S   G+LA+IL IFKK+ +NL+HIESR S  +   Y+F + AD ++G L  AIE+++       ++SR + +    VPWFPR+I+DLDRFANQILSYGSELDADHPGFTDP YR+RRK FADIA+ YKHG+P+  V+YTKEEI TW  +F  LT LY THAC+E+N+VFPLL +NCG+  DNIPQL+DVS+FL+DCTGFTLRPVAGLL
Sbjct:   18 AYIVEGVDIKEARNTCLLFSPKDSSLSSGALANILAIFKKHDINLVHIESRSSLRVP-GYEFFVEADGKSGALGKAIEDVKEQCSYFNIISRDYKDNATAVPWFPRRIRDLDRFANQILSYGSELDADHPGFTDPEYRKRRKYFADIAYNYKHGEPLPHVDYTKEEIETWGIIFRNLTKLYKTHACREYNHVFPLLVDNCGFREDNIPQLEDVSNFLRDCTGFTLRPVAGLL 248          
BLAST of Tryptophan 5-hydroxylase vs. UniProt/SwissProt
Match: sp|P04176|PH4H_RAT (Phenylalanine-4-hydroxylase OS=Rattus norvegicus OX=10116 GN=Pah PE=1 SV=3)

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 268/429 (62.47%), Postives = 329/429 (76.69%), Query Frame = 2
Query:  797 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRT----GGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            Y+ED  ++ G  +++ +   ++G+LA +L +F++N +NL HIESRPS+  K++Y+F    D RT    G ++ ++ N  G +  V  LSR  D  K  VPWFPR I++LDRFANQILSYG+ELDADHPGF DPVYR RRKQFADIA+ Y+HGQPI RVEYT+EE  TW TVF  L  LY THAC E N++FPLL++ CG+  DNIPQL+DVS FL+ CTGF LRPVAGLLSSRDFL GL+FRVFH TQYIRH   P+YTPEPD+CHELLGHVPLF +  FAQFSQEIGLASLGA DEYIEKLAT YWFTVEFGLCKE D IKAYGAGLLSSFGELQYCL+D+PK L  + + T  Q+Y + E+QP+Y+VAESF+DAK ++R F+  + RPF+V+YDPYTQ VEVLD   Q+K L  S+  +  +L  AL
Sbjct:   24 YIEDNSNQNGAISLIFSLKEEVGALAKVLRLFEENDINLTHIESRPSRLNKDEYEFFTYLDKRTKPVLGSIIKSLRNDIGAT--VHELSR--DKEKNTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYTEEEKQTWGTVFRTLKALYKTHACYEHNHIFPLLEKYCGFREDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKEGDSIKAYGAGLLSSFGELQYCLSDKPKLLPLELEKTACQEYSVTEFQPLYYVAESFSDAKEKVRTFAATIPRPFSVRYDPYTQRVEVLDNTQQLKILADSINSEVGILCNAL 448          

HSP 2 Score: 273.863 bits (699), Expect = 4.057e-83
Identity = 132/230 (57.39%), Postives = 169/230 (73.48%), Query Frame = -2
Query:    2 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRT----GGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 679
            Y+ED  ++ G  +++ +   ++G+LA +L +F++N +NL HIESRPS+  K++Y+F    D RT    G ++ ++ N  G +  V  LSR  D  K  VPWFPR I++LDRFANQILSYG+ELDADHPGF DPVYR RRKQFADIA+ Y+HGQPI RVEYT+EE  TW TVF  L  LY THAC E N++FPLL++ CG+  DNIPQL+DVS FL+ CTGF LRPVAGLL
Sbjct:   24 YIEDNSNQNGAISLIFSLKEEVGALAKVLRLFEENDINLTHIESRPSRLNKDEYEFFTYLDKRTKPVLGSIIKSLRNDIGAT--VHELSR--DKEKNTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYTEEEKQTWGTVFRTLKALYKTHACYEHNHIFPLLEKYCGFREDNIPQLEDVSQFLQTCTGFRLRPVAGLL 249          
BLAST of Tryptophan 5-hydroxylase vs. UniProt/SwissProt
Match: sp|P16331|PH4H_MOUSE (Phenylalanine-4-hydroxylase OS=Mus musculus OX=10090 GN=Pah PE=1 SV=4)

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 267/429 (62.24%), Postives = 328/429 (76.46%), Query Frame = 2
Query:  797 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRT----GGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            Y+ED  ++ G  +++ +   ++G+LA +L +F++N +NL HIESRPS+  K++Y+F    D R+    G ++ ++ N  G +  V  LSR  D  K  VPWFPR I++LDRFANQILSYG+ELDADHPGF DPVYR RRKQFADIA+ Y+HGQPI RVEYT+EE  TW TVF  L  LY THAC E N++FPLL++ CG+  DNIPQL+DVS FL+ CTGF LRPVAGLLSSRDFL GL+FRVFH TQYIRH   P+YTPEPD+CHELLGHVPLF +  FAQFSQEIGLASLGA DEYIEKLAT YWFTVEFGLCKE D IKAYGAGLLSSFGELQYCL+D+PK L  + + T  Q+Y + E+QP+Y+VAESF DAK ++R F+  + RPF+V+YDPYTQ VEVLD   Q+K L  S+  +  +L  AL
Sbjct:   24 YIEDNSNQNGAVSLIFSLKEEVGALAKVLRLFEENEINLTHIESRPSRLNKDEYEFFTYLDKRSKPVLGSIIKSLRNDIGAT--VHELSR--DKEKNTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYTEEERKTWGTVFRTLKALYKTHACYEHNHIFPLLEKYCGFREDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKEGDSIKAYGAGLLSSFGELQYCLSDKPKLLPLELEKTACQEYTVTEFQPLYYVAESFNDAKEKVRTFAATIPRPFSVRYDPYTQRVEVLDNTQQLKILADSINSEVGILCHAL 448          

HSP 2 Score: 273.478 bits (698), Expect = 6.936e-83
Identity = 131/230 (56.96%), Postives = 169/230 (73.48%), Query Frame = -2
Query:    2 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRT----GGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 679
            Y+ED  ++ G  +++ +   ++G+LA +L +F++N +NL HIESRPS+  K++Y+F    D R+    G ++ ++ N  G +  V  LSR  D  K  VPWFPR I++LDRFANQILSYG+ELDADHPGF DPVYR RRKQFADIA+ Y+HGQPI RVEYT+EE  TW TVF  L  LY THAC E N++FPLL++ CG+  DNIPQL+DVS FL+ CTGF LRPVAGLL
Sbjct:   24 YIEDNSNQNGAVSLIFSLKEEVGALAKVLRLFEENEINLTHIESRPSRLNKDEYEFFTYLDKRSKPVLGSIIKSLRNDIGAT--VHELSR--DKEKNTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYTEEERKTWGTVFRTLKALYKTHACYEHNHIFPLLEKYCGFREDNIPQLEDVSQFLQTCTGFRLRPVAGLL 249          
BLAST of Tryptophan 5-hydroxylase vs. UniProt/SwissProt
Match: sp|P00439|PH4H_HUMAN (Phenylalanine-4-hydroxylase OS=Homo sapiens OX=9606 GN=PAH PE=1 SV=1)

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 260/425 (61.18%), Postives = 325/425 (76.47%), Query Frame = 2
Query:  797 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            Y+ED  ++ G  +++ +   ++G+LA +L +F++N VNL HIESRPS+  K++Y+F  + D R+   +  I  +    +   V     D  K  VPWFPR I++LDRFANQILSYG+ELDADHPGF DPVYR RRKQFADIA+ Y+HGQPI RVEY +EE  TW TVF  L +LY THAC E+N++FPLL++ CG++ DNIPQL+DVS FL+ CTGF LRPVAGLLSSRDFL GL+FRVFH TQYIRH   P+YTPEPD+CHELLGHVPLF +  FAQFSQEIGLASLGA DEYIEKLAT YWFTVEFGLCK+ D IKAYGAGLLSSFGELQYCL+++PK L  + + T +Q Y + E+QP+Y+VAESF DAK ++RNF+  + RPF+V+YDPYTQ +EVLD   Q+K L  S+  +  +L  AL
Sbjct:   24 YIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSAL 448          

HSP 2 Score: 272.322 bits (695), Expect = 1.701e-82
Identity = 126/226 (55.75%), Postives = 165/226 (73.01%), Query Frame = -2
Query:    2 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 679
            Y+ED  ++ G  +++ +   ++G+LA +L +F++N VNL HIESRPS+  K++Y+F  + D R+   +  I  +    +   V     D  K  VPWFPR I++LDRFANQILSYG+ELDADHPGF DPVYR RRKQFADIA+ Y+HGQPI RVEY +EE  TW TVF  L +LY THAC E+N++FPLL++ CG++ DNIPQL+DVS FL+ CTGF LRPVAGLL
Sbjct:   24 YIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLL 249          
BLAST of Tryptophan 5-hydroxylase vs. UniProt/SwissProt
Match: sp|Q2KIH7|PH4H_BOVIN (Phenylalanine-4-hydroxylase OS=Bos taurus OX=9913 GN=PAH PE=2 SV=1)

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 263/439 (59.91%), Postives = 326/439 (74.26%), Query Frame = 2
Query:  785 TLGYYVEDFPDK----EGNT-----TILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
             LG  + DF  +    EGN+     +++ +   ++G+LA +L +F++N +NL HIESRPS+  K++Y+F  N D R+   +  I  +    +   V     D  K  VPWFPR I++LD FANQ+LSYG+ELDADHPGF DPVYR RRKQFADIA+ Y+HGQPI RVEYT+EE  TW TVF  L +LY THAC E N++FPLL++ CG+  DNIPQL++VS FL+ CTGF LRPVAGLLSSRDFL GL+FRVFH TQYIRH   P+YTPEPD+CHELLGHVPLF +  FAQFSQEIGLASLGA DEYIEKLAT YWFTVEFGLCK+ D IKAYGAGLLSSFGELQYCL+D+PK L  + + T +Q+Y I E+QP+Y+VAESF DAK ++RNF+  + RPF+V YDPYTQ +EVLD   Q+K L  S+  +  +L  AL 
Sbjct:   10 ALGRKLSDFGQETSYIEGNSDQNAVSLIFSLKEEVGALARVLRLFEENDINLTHIESRPSRLRKDEYEFFTNLDQRSVPALANIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDNFANQVLSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYTEEEKKTWGTVFRTLKSLYKTHACYEHNHIFPLLEKYCGFREDNIPQLEEVSQFLQSCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSDKPKLLPLELEKTAVQEYTITEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVHYDPYTQRIEVLDNTQQLKILADSISSEVEILCSALQ 448          

HSP 2 Score: 263.848 bits (673), Expect = 2.463e-79
Identity = 127/239 (53.14%), Postives = 166/239 (69.46%), Query Frame = -2
Query:    2 TLGYYVEDFPDK----EGNT-----TILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 691
             LG  + DF  +    EGN+     +++ +   ++G+LA +L +F++N +NL HIESRPS+  K++Y+F  N D R+   +  I  +    +   V     D  K  VPWFPR I++LD FANQ+LSYG+ELDADHPGF DPVYR RRKQFADIA+ Y+HGQPI RVEYT+EE  TW TVF  L +LY THAC E N++FPLL++ CG+  DNIPQL++VS FL+ CTGF LRPVAGLL
Sbjct:   10 ALGRKLSDFGQETSYIEGNSDQNAVSLIFSLKEEVGALARVLRLFEENDINLTHIESRPSRLRKDEYEFFTNLDQRSVPALANIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDNFANQVLSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYTEEEKKTWGTVFRTLKSLYKTHACYEHNHIFPLLEKYCGFREDNIPQLEEVSQFLQSCTGFRLRPVAGLL 248          
BLAST of Tryptophan 5-hydroxylase vs. TrEMBL
Match: A0A1S3ID41 (protein henna OS=Lingula unguis OX=7574 GN=LOC106163209 PE=4 SV=1)

HSP 1 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 284/428 (66.36%), Postives = 351/428 (82.01%), Query Frame = 2
Query:  797 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKN--LKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            Y  D+ D EG+T+++ +   ++G+LA  L+IF+ + VNL+H+ESRP K+     +Y+F + ADN  GGL  AI +L+  +   QVLSR   + K ++PWFPRKI DLDRFA+QILSYGSELD+DHPGFTDPVYR RRK+FADIAF YKHGQPI RVEYTK+E  TW T+F +LT LYPTHAC EFNYVFPLL ENCGY++DNIPQL+D+S+FLKDCTGF LRPVAGLLSSRDFLAGL+FRVFHSTQYIRH   P+YTPEPD+CHE+LGHVPLF +P FAQFSQEIGLASLGA D+YI+KLATCYWFTVEFGLC++  K+KAYGAGLLSSFGELQYCLTD+P+K SFDP+ TG+Q+YPI  YQP+Y+VA+SF  AK ++  F+  + RPFAV+Y+PYTQ+VEVL+   Q+  L  S++ D  +LE+AL+
Sbjct:   27 YKPDYDDTEGSTSLVFSVKEEVGALAKALKIFEVHGVNLIHLESRPKKSDVHCHEYEFFVAADNLKGGLKEAISDLEKSTKSFQVLSRGLKHEKNEMPWFPRKISDLDRFAHQILSYGSELDSDHPGFTDPVYRARRKEFADIAFNYKHGQPIPRVEYTKQERETWGTIFSELTKLYPTHACHEFNYVFPLLAENCGYSKDNIPQLEDISNFLKDCTGFRLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHHSRPMYTPEPDLCHEILGHVPLFADPAFAQFSQEIGLASLGAPDDYIKKLATCYWFTVEFGLCRQEGKVKAYGAGLLSSFGELQYCLTDKPEKRSFDPEKTGIQEYPITNYQPVYYVADSFISAKEKMAKFASSIPRPFAVRYNPYTQSVEVLENKHQVANLTRSIRGDLGILEDALS 454          

HSP 2 Score: 313.153 bits (801), Expect = 1.365e-95
Identity = 146/228 (64.04%), Postives = 181/228 (79.39%), Query Frame = -2
Query:    2 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKN--LKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 679
            Y  D+ D EG+T+++ +   ++G+LA  L+IF+ + VNL+H+ESRP K+     +Y+F + ADN  GGL  AI +L+  +   QVLSR   + K ++PWFPRKI DLDRFA+QILSYGSELD+DHPGFTDPVYR RRK+FADIAF YKHGQPI RVEYTK+E  TW T+F +LT LYPTHAC EFNYVFPLL ENCGY++DNIPQL+D+S+FLKDCTGF LRPVAGLL
Sbjct:   27 YKPDYDDTEGSTSLVFSVKEEVGALAKALKIFEVHGVNLIHLESRPKKSDVHCHEYEFFVAADNLKGGLKEAISDLEKSTKSFQVLSRGLKHEKNEMPWFPRKISDLDRFAHQILSYGSELDSDHPGFTDPVYRARRKEFADIAFNYKHGQPIPRVEYTKQERETWGTIFSELTKLYPTHACHEFNYVFPLLAENCGYSKDNIPQLEDISNFLKDCTGFRLRPVAGLL 254          
BLAST of Tryptophan 5-hydroxylase vs. TrEMBL
Match: A0A2T7P521 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_11084 PE=4 SV=1)

HSP 1 Score: 613.224 bits (1580), Expect = 0.000e+0
Identity = 285/425 (67.06%), Postives = 349/425 (82.12%), Query Frame = 2
Query:  797 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            YV+D+ D EG+T+I+ +   K+G+LA  L++F+ N+VNL HIESRPS   K+ Y+F ++ DN  GGL  AI+ L+G +  +QVLSR  +N K +VPWFPRKI+DLDRFANQILSYGSELDADHPGF DPVYR RRK+FADIAF YKHG+PI RV+YT EE+ TW T+F +LT LYPTHAC+EFN+VFPLL +NCG+  +NIPQLQD+SDFLKDCTGF LRPVAGLLSSRDFLAGL+FRVFHSTQYIRH   P+YTPEPDVCHE+LGHVPLF +P FAQFSQEIGLASLGA DEYI+KLAT YWFTVEFGLC++   +KAYGAGLLSSFGELQY LTD+P+   FDPQ T  Q+YPI  +QP+YFVA+SF DAK +L+ +S  + RPF+V+Y+ YTQ+VEV++   QI  L  ++K D ++LE+AL
Sbjct:   29 YVQDYVDHEGSTSIIFSLPEKVGALAEALKVFETNNVNLHHIESRPSLEDKDCYEFFVSCDNVRGGLYEAIDILKGRTKNLQVLSRNPENKKDEVPWFPRKIRDLDRFANQILSYGSELDADHPGFKDPVYRTRRKEFADIAFNYKHGEPIPRVQYTDEEVKTWGTIFQELTKLYPTHACREFNHVFPLLIDNCGFRENNIPQLQDISDFLKDCTGFQLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHGSKPMYTPEPDVCHEVLGHVPLFADPSFAQFSQEIGLASLGAPDEYIQKLATLYWFTVEFGLCRQEGHLKAYGAGLLSSFGELQYALTDKPEVRPFDPQKTSTQEYPITSFQPVYFVADSFDDAKEKLKAYSLTIPRPFSVRYNAYTQSVEVINNKEQIINLTRTIKGDLSLLEDAL 453          

HSP 2 Score: 325.479 bits (833), Expect = 3.436e-100
Identity = 150/226 (66.37%), Postives = 185/226 (81.86%), Query Frame = -2
Query:    2 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 679
            YV+D+ D EG+T+I+ +   K+G+LA  L++F+ N+VNL HIESRPS   K+ Y+F ++ DN  GGL  AI+ L+G +  +QVLSR  +N K +VPWFPRKI+DLDRFANQILSYGSELDADHPGF DPVYR RRK+FADIAF YKHG+PI RV+YT EE+ TW T+F +LT LYPTHAC+EFN+VFPLL +NCG+  +NIPQLQD+SDFLKDCTGF LRPVAGLL
Sbjct:   29 YVQDYVDHEGSTSIIFSLPEKVGALAEALKVFETNNVNLHHIESRPSLEDKDCYEFFVSCDNVRGGLYEAIDILKGRTKNLQVLSRNPENKKDEVPWFPRKIRDLDRFANQILSYGSELDADHPGFKDPVYRTRRKEFADIAFNYKHGEPIPRVQYTDEEVKTWGTIFQELTKLYPTHACREFNHVFPLLIDNCGFRENNIPQLQDISDFLKDCTGFQLRPVAGLL 254          
BLAST of Tryptophan 5-hydroxylase vs. TrEMBL
Match: V4A8Y6 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_161773 PE=4 SV=1)

HSP 1 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 285/437 (65.22%), Postives = 349/437 (79.86%), Query Frame = 2
Query:  761 MNKEEGGGTLGYYVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            + K+ G G    Y+E+  D EG+TT+L +   K+G+LA  L IF  + VNL HIESRPS    E Y F +  DN+ GGL  AI  L+    ++ +LSR    LK +VPWFPRKI DLDRFANQILSYGSELD+DHPGFTD VYR RRK+FADIAF YKHGQPI RVEYT++EI TW T+F++LT LYPTHAC+E+N+VFPLL +NCG+  DNIPQL+D+S+FLKDCTGF+LRPVAGLLSSRDFLAGL+FRVFHSTQYIRH   P+YTPEPDVCHELLGHVPLF +P FAQFSQEIGLASLGA ++YI+KLAT YWFTVEFGLC++  ++KAYGAGLLSSFGELQYC++D+P+K  FDP +T  QKYPI EYQP+YFVA+SF  AK++LRN++  + R F+V+Y+PYTQ V+V++   QI  L   +K D ++LEEAL
Sbjct:   17 LTKDIGSGA-PVYLEEVQDTEGSTTLLFSLKEKVGALAEALSIFDTHRVNLHHIESRPSVEDSEDYQFFVACDNQRGGLKEAIVALKQKCKDLTILSRNPGELKNEVPWFPRKIADLDRFANQILSYGSELDSDHPGFTDSVYRARRKEFADIAFHYKHGQPIPRVEYTQDEIKTWGTIFNELTKLYPTHACREYNHVFPLLVDNCGFREDNIPQLEDISEFLKDCTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHGSKPMYTPEPDVCHELLGHVPLFADPAFAQFSQEIGLASLGAPEDYIQKLATLYWFTVEFGLCRQEGQLKAYGAGLLSSFGELQYCISDKPEKREFDPTITAEQKYPITEYQPVYFVADSFESAKVKLRNYACTIPRAFSVRYNPYTQNVDVINNKQQIVNLTKVIKGDIDLLEEAL 452          

HSP 2 Score: 315.079 bits (806), Expect = 3.476e-96
Identity = 147/232 (63.36%), Postives = 178/232 (76.72%), Query Frame = -2
Query:    2 GGTLGYYVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 697
            G     Y+E+  D EG+TT+L +   K+G+LA  L IF  + VNL HIESRPS    E Y F +  DN+ GGL  AI  L+    ++ +LSR    LK +VPWFPRKI DLDRFANQILSYGSELD+DHPGFTD VYR RRK+FADIAF YKHGQPI RVEYT++EI TW T+F++LT LYPTHAC+E+N+VFPLL +NCG+  DNIPQL+D+S+FLKDCTGF+LRPVAGLL
Sbjct:   22 GSGAPVYLEEVQDTEGSTTLLFSLKEKVGALAEALSIFDTHRVNLHHIESRPSVEDSEDYQFFVACDNQRGGLKEAIVALKQKCKDLTILSRNPGELKNEVPWFPRKIADLDRFANQILSYGSELDSDHPGFTDSVYRARRKEFADIAFHYKHGQPIPRVEYTQDEIKTWGTIFNELTKLYPTHACREYNHVFPLLVDNCGFREDNIPQLEDISEFLKDCTGFSLRPVAGLL 253          
BLAST of Tryptophan 5-hydroxylase vs. TrEMBL
Match: R7TJT0 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_157066 PE=4 SV=1)

HSP 1 Score: 602.053 bits (1551), Expect = 0.000e+0
Identity = 282/436 (64.68%), Postives = 347/436 (79.59%), Query Frame = 2
Query:  779 GGTLGYYVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKG-----DVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            G   GY  ED  D+ G T+++    S++G+LA  L IF+ ++VNL HIESRPSK +   YDF ++ DN  GGL  AI++L+ +S  + +L+R   +  G      VPWFPRKI +LDRFANQILSYGSELD+DHPGF D VYR RRK+FADIAF YKHG PI RV YT EEI TW T+F +LTTLYPTHAC+EFN+VFPLL +NCG+  DNIPQLQD+S+FLKDCTGFTLRPVAGLLSSRDFLAGL+FRVFHSTQYIRHS  PLYTPEPDVCHE+LGHVPLF +P FAQFSQEIG+ASLGA DEYIEKLATCYWFTVEFGLC+++ ++KA+GAGLLSSFGELQYCL+D+P+  SFDP  TG+QKYPI EYQP+Y+VA+SF  A+ ++R F+  + R F V+Y+PYTQ+V+VLD  +Q+ +    +K +   LE+A+
Sbjct:   22 GDHPGYRHED-ADETGETSLMFAVKSQVGALAKALRIFETHNVNLQHIESRPSKQIVGDYDFFVSCDNSHGGLKEAIDDLREMSETLTILTRGPPDAPGAPTDDTVPWFPRKISELDRFANQILSYGSELDSDHPGFVDKVYRARRKEFADIAFHYKHGTPIPRVTYTTEEIKTWGTIFKQLTTLYPTHACQEFNHVFPLLVDNCGFREDNIPQLQDISNFLKDCTGFTLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHSSKPLYTPEPDVCHEVLGHVPLFADPNFAQFSQEIGIASLGAPDEYIEKLATCYWFTVEFGLCRQNGELKAFGAGLLSSFGELQYCLSDKPEVRSFDPPQTGIQKYPITEYQPVYYVADSFQSAQEKMRAFASTIPRKFGVRYNPYTQSVDVLDNPTQMTRYTSDIKGEMTRLEDAM 456          

HSP 2 Score: 306.605 bits (784), Expect = 5.789e-93
Identity = 147/237 (62.03%), Postives = 179/237 (75.53%), Query Frame = -2
Query:    2 GGTLGYYVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKG-----DVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 697
            G   GY  ED  D+ G T+++    S++G+LA  L IF+ ++VNL HIESRPSK +   YDF ++ DN  GGL  AI++L+ +S  + +L+R   +  G      VPWFPRKI +LDRFANQILSYGSELD+DHPGF D VYR RRK+FADIAF YKHG PI RV YT EEI TW T+F +LTTLYPTHAC+EFN+VFPLL +NCG+  DNIPQLQD+S+FLKDCTGFTLRPVAGLL
Sbjct:   22 GDHPGYRHED-ADETGETSLMFAVKSQVGALAKALRIFETHNVNLQHIESRPSKQIVGDYDFFVSCDNSHGGLKEAIDDLREMSETLTILTRGPPDAPGAPTDDTVPWFPRKISELDRFANQILSYGSELDSDHPGFVDKVYRARRKEFADIAFHYKHGTPIPRVTYTTEEIKTWGTIFKQLTTLYPTHACQEFNHVFPLLVDNCGFREDNIPQLQDISNFLKDCTGFTLRPVAGLL 257          
BLAST of Tryptophan 5-hydroxylase vs. TrEMBL
Match: K1QHH0 (Protein henna OS=Crassostrea gigas OX=29159 GN=CGI_10016307 PE=4 SV=1)

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 275/428 (64.25%), Postives = 352/428 (82.24%), Query Frame = 2
Query:  797 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQ--HDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            Y++   D E + ++L +   K+G+LA +L+IF+ + VNL HIESRPSK    +++F ++ DN+TGGL  A++ L+ ++   ++LSR+       G VPWFP+KI +LDRFANQILSYG+EL++DHPGFTD VYR RRK+ ADIAFFYKHGQ I RV+YT++EI+TWRT++++LT LYPTHACK+FN+VFPLLQ+NCGYN DNIPQL+DVS FL+DCTGF +RPVAGLLSSRDFL+GL+FR FHSTQYIRHS  P+YTPEPDVCHELLGHVPLF +P FAQFSQEIGLASLGA DEYI+KLATCYWFTVEFG+CK+ + +KAYGAGLLSSFGELQYCLTD  +K +FDP VT  Q+YPI  +QPIYFVA+SF  AK ++R ++K + RPF+V+Y+PYTQ+VEV++  +QI  L  ++K D  +LE+AL+
Sbjct:   28 YLKTQKDPENSVSLLFSLPEKVGALAQVLKIFESHQVNLHHIESRPSKQSSTEFEFFVSCDNKTGGLQEALDALKKIAKSFRLLSRKTGESPADGTVPWFPKKICELDRFANQILSYGNELESDHPGFTDAVYRARRKELADIAFFYKHGQEIPRVKYTEDEISTWRTIYNELTKLYPTHACKQFNHVFPLLQDNCGYNPDNIPQLEDVSRFLQDCTGFRIRPVAGLLSSRDFLSGLAFRTFHSTQYIRHSSRPMYTPEPDVCHELLGHVPLFADPAFAQFSQEIGLASLGAPDEYIKKLATCYWFTVEFGMCKQENDLKAYGAGLLSSFGELQYCLTDASEKKTFDPAVTCDQEYPITSFQPIYFVADSFEKAKEKMREYAKTIPRPFSVRYNPYTQSVEVIENKNQIINLTHAIKGDLTLLEDALS 455          

HSP 2 Score: 303.138 bits (775), Expect = 1.359e-91
Identity = 137/228 (60.09%), Postives = 183/228 (80.26%), Query Frame = -2
Query:    2 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQ--HDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 679
            Y++   D E + ++L +   K+G+LA +L+IF+ + VNL HIESRPSK    +++F ++ DN+TGGL  A++ L+ ++   ++LSR+       G VPWFP+KI +LDRFANQILSYG+EL++DHPGFTD VYR RRK+ ADIAFFYKHGQ I RV+YT++EI+TWRT++++LT LYPTHACK+FN+VFPLLQ+NCGYN DNIPQL+DVS FL+DCTGF +RPVAGLL
Sbjct:   28 YLKTQKDPENSVSLLFSLPEKVGALAQVLKIFESHQVNLHHIESRPSKQSSTEFEFFVSCDNKTGGLQEALDALKKIAKSFRLLSRKTGESPADGTVPWFPKKICELDRFANQILSYGNELESDHPGFTDAVYRARRKELADIAFFYKHGQEIPRVKYTEDEISTWRTIYNELTKLYPTHACKQFNHVFPLLQDNCGYNPDNIPQLEDVSRFLQDCTGFRIRPVAGLL 255          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Cavefish
Match: pah (phenylalanine hydroxylase [Source:ZFIN;Acc:ZDB-GENE-031006-2])

HSP 1 Score: 532.717 bits (1371), Expect = 0.000e+0
Identity = 260/420 (61.90%), Postives = 313/420 (74.52%), Query Frame = 2
Query:  797 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPS--KNLKEQYDFLINADNRTGGLMMAIENLQGLSLEV--QVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKD 2044
            Y+E+  +K G  + + + + ++GSLA  L +F++  +NL HIES  S  K L E  D                    GL  E+  QV     + +K  VPWFP  I+DLDRFANQILSYGSELDADHPGFTDPVYR RRK+FADIA+ Y+HGQ I  VEYT+ E  TW TVF +L TLYPTHAC E N VFPLL+E CGY  DNIPQL+D+S +L+ CTGF LRPVAGLLSSRDFLAGL+FRVFHSTQYIRH   P+YTPEPD+CHELLGHVPLF +P FAQFSQEIGLASL A DEYIEKLAT YWFTVEFGLCK+ + I+AYGAGLLSSFGELQY LTD+PK L F+P+ T LQKYPI E+QPIYFVAESF D+K ++R ++  + RPF+V+Y+ YTQ++EVLD   Q++ L  S+ +
Sbjct:    2 YLEEQTNKSGVLSCIFSLNEEVGSLAKALRLFEEKGINLTHIESHVSCSKALDEVID--------------------GLRAEITGQVHEMSRNKIKDTVPWFPSNIQDLDRFANQILSYGSELDADHPGFTDPVYRARRKEFADIAYNYRHGQSIPYVEYTEAEKATWGTVFRELKTLYPTHACHEHNRVFPLLEEYCGYREDNIPQLEDISRYLQSCTGFRLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHGSNPMYTPEPDICHELLGHVPLFADPSFAQFSQEIGLASLAAPDEYIEKLATVYWFTVEFGLCKQGNDIRAYGAGLLSSFGELQYALTDKPKLLPFEPEKTILQKYPITEFQPIYFVAESFEDSKEKVRKYAATIPRPFSVRYNAYTQSIEVLDNTQQLRNLANSISE 401          

HSP 2 Score: 244.973 bits (624), Expect = 1.320e-73
Identity = 126/230 (54.78%), Postives = 153/230 (66.52%), Query Frame = -2
Query:    2 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESR--PSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEV--QVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 679
            Y+E+  +K G  + + + + ++GSLA  L +F++  +NL HIES    SK L E  D                    GL  E+  QV     + +K  VPWFP  I+DLDRFANQILSYGSELDADHPGFTDPVYR RRK+FADIA+ Y+HGQ I  VEYT+ E  TW TVF +L TLYPTHAC E N VFPLL+E CGY  DNIPQL+D+S +L+ CTGF LRPVAGLL
Sbjct:    2 YLEEQTNKSGVLSCIFSLNEEVGSLAKALRLFEEKGINLTHIESHVSCSKALDEVID--------------------GLRAEITGQVHEMSRNKIKDTVPWFPSNIQDLDRFANQILSYGSELDADHPGFTDPVYRARRKEFADIAYNYRHGQSIPYVEYTEAEKATWGTVFRELKTLYPTHACHEHNRVFPLLEEYCGYREDNIPQLEDISRYLQSCTGFRLRPVAGLL 211          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Cavefish
Match: tph1a (tryptophan hydroxylase 1 [Source:NCBI gene;Acc:103043966])

HSP 1 Score: 493.812 bits (1270), Expect = 1.062e-168
Identity = 229/423 (54.14%), Postives = 310/423 (73.29%), Query Frame = 2
Query:  818 KEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQG----LSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            ++G   I+ +  +++G L   L++F++NHVNL+HIESR S+    +++ L++ D+    L   I+ L+     L  E  + S   ++   +VPWFP+KI DLD+ AN++L YGS+LDADHPGF D VYR+RRK FAD+A  YKHG PI R+E+T+EE+ TW  VF +L  LYPTHAC+E     PLL + CGY  DNIPQL+DVS FL++ TGF +RPVAG LS RDFLAGL+FRVFH TQY+RHS  PLYTPEPD CHELLGHVPL   P FAQFSQEIGLASLGASDE ++KLATCY+FTVEFGLCK+  K++AYGAGLLSS  EL++ L+   + + FDP+VT  Q+  I  +Q +YFV++SF +AK+++R F+K + RPF V+Y+PYTQ+V+VL   + I  ++  L+ + +++ +ALN
Sbjct:   53 EKGRAAIVFSLKNEVGGLVKALKLFQENHVNLVHIESRKSRRRNSEFEILVDCDSNHEQLNEIIQLLRKHVNVLDTETSIKSLPEEDEMDNVPWFPKKIADLDKCANRVLMYGSDLDADHPGFKDNVYRKRRKYFADLAMSYKHGDPIPRIEFTEEEVKTWGVVFRELNKLYPTHACREHLKNLPLLTKYCGYREDNIPQLEDVSRFLRERTGFNIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDEAVQKLATCYFFTVEFGLCKQEGKLRAYGAGLLSSISELRHALSGNARIMPFDPKVTCKQECIITTFQDVYFVSDSFEEAKVKMREFAKTIKRPFTVRYNPYTQSVDVLKDTTSINSVVEELRHELDIVGDALN 475          

HSP 2 Score: 233.417 bits (594), Expect = 1.969e-68
Identity = 110/223 (49.33%), Postives = 153/223 (68.61%), Query Frame = -2
Query:    2 KEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQG----LSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 658
            ++G   I+ +  +++G L   L++F++NHVNL+HIESR S+    +++ L++ D+    L   I+ L+     L  E  + S   ++   +VPWFP+KI DLD+ AN++L YGS+LDADHPGF D VYR+RRK FAD+A  YKHG PI R+E+T+EE+ TW  VF +L  LYPTHAC+E     PLL + CGY  DNIPQL+DVS FL++ TGF +RPVAG L
Sbjct:   53 EKGRAAIVFSLKNEVGGLVKALKLFQENHVNLVHIESRKSRRRNSEFEILVDCDSNHEQLNEIIQLLRKHVNVLDTETSIKSLPEEDEMDNVPWFPKKIADLDKCANRVLMYGSDLDADHPGFKDNVYRKRRKYFADLAMSYKHGDPIPRIEFTEEEVKTWGVVFRELNKLYPTHACREHLKNLPLLTKYCGYREDNIPQLEDVSRFLRERTGFNIRPVAGYL 275          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Cavefish
Match: tph1b (tryptophan 5-hydroxylase 1-like [Source:NCBI gene;Acc:103025693])

HSP 1 Score: 476.478 bits (1225), Expect = 5.205e-162
Identity = 231/442 (52.26%), Postives = 309/442 (69.91%), Query Frame = 2
Query:  764 NKEEGGGTLGYYVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQH-----DNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            N EE  G +         K  +  I+ +  +++G+L   L++F++N V LLHIESR S+    + + L++ D+    L   I+ L+  +  V +   +      D    + PWFPRKI DLD+ AN++L YGS LDADHPGF D VYR+RRK FAD+A  YKHG+ I RVE+T+EE+ TW  VF +L  LYP HAC+E+    PLL ++CGY  +NIPQL+DVS FL++ TGFT+RPVAG LS RDFLAGL+FRVFH TQY+RHS  PLYTPEPD CHELLGHVPL   P FAQFSQE+GLASLGASD+ ++KLATCY+FTVEFGLCK+  K++AYGAGLLSS  ELQ+ L+   K L F+P+VT  Q+  I  +Q +YF++ESF +AKIR+R F+K + RPF V+Y+PYTQ+V VL     I  ++  L+ + +++ +AL+
Sbjct:   38 NIEENQGRI------LSSKREHAAIIFSLKNEVGNLVKALKLFQENQVKLLHIESRKSRRNNSELEVLVDCDSERDTLKEIIQLLKKQTNTVTMDPPERPLPDPDTDFPEEPWFPRKISDLDKCANRVLMYGSALDADHPGFKDNVYRKRRKYFADLAMNYKHGEAIPRVEFTEEEVRTWGVVFRELNKLYPCHACREYLLNLPLLSQHCGYRENNIPQLEDVSRFLRERTGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSAPLYTPEPDTCHELLGHVPLLAEPSFAQFSQELGLASLGASDDAVQKLATCYFFTVEFGLCKQEGKLRAYGAGLLSSISELQHALSGNAKILPFEPKVTCKQECLITTFQDVYFMSESFEEAKIRMREFAKTIRRPFTVRYNPYTQSVSVLKDMPSINSVVEELRHELDIVGDALH 473          

HSP 2 Score: 218.394 bits (555), Expect = 6.990e-63
Identity = 107/224 (47.77%), Postives = 149/224 (66.52%), Query Frame = -2
Query:    2 KEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQH-----DNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 658
            K  +  I+ +  +++G+L   L++F++N V LLHIESR S+    + + L++ D+    L   I+ L+  +  V +   +      D    + PWFPRKI DLD+ AN++L YGS LDADHPGF D VYR+RRK FAD+A  YKHG+ I RVE+T+EE+ TW  VF +L  LYP HAC+E+    PLL ++CGY  +NIPQL+DVS FL++ TGFT+RPVAG L
Sbjct:   50 KREHAAIIFSLKNEVGNLVKALKLFQENQVKLLHIESRKSRRNNSELEVLVDCDSERDTLKEIIQLLKKQTNTVTMDPPERPLPDPDTDFPEEPWFPRKISDLDKCANRVLMYGSALDADHPGFKDNVYRKRRKYFADLAMNYKHGEAIPRVEFTEEEVRTWGVVFRELNKLYPCHACREYLLNLPLLSQHCGYRENNIPQLEDVSRFLRERTGFTIRPVAGYL 273          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Cavefish
Match: tph2 (tryptophan hydroxylase 2 (tryptophan 5-monooxygenase) [Source:ZFIN;Acc:ZDB-GENE-040624-4])

HSP 1 Score: 457.988 bits (1177), Expect = 3.138e-155
Identity = 220/436 (50.46%), Postives = 307/436 (70.41%), Query Frame = 2
Query:  800 VEDFPDKE-------GNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQH---DNLKGD-VPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            +++ PDKE       G T ++ +  +++G L   L +F++ HVNL HIESR SK +  + +     +         +++L+     +   + QH       G+ VPWFP+KI +LD+ ++++L YGSELDADHPGF D VYR+RRK F ++A  YK GQPI R++YT EE+ TW  VF +LT LYPTHAC+E+    PLL ++CGY  DNIPQL+DVS FL++ +GF +RPVAG LS RDFLAGL++RVF+ TQY+RHS  PLYTPEPD CHELLGHVPL  +P+FAQFSQEIGLASLGASDE ++KLATCY+FT+EFGLCK+  +++AYGAGLLSS GEL++ L+D+     FDP+ T  Q+  I  +Q +YFV++SF +AK ++R F+K + RPF+V Y+PYTQ++++L     I+ ++  L+ D   + +AL 
Sbjct:    3 IDEKPDKEWVSTMDSGKTAVIFSLKNEVGCLVKALRLFQEKHVNLAHIESRKSKRVTTEVEIYAECNCTKKEFNELVQHLKDHVNIISYNTPQHVWSSETDGEGVPWFPQKISELDQCSHRVLMYGSELDADHPGFKDNVYRQRRKYFVEVAMNYKFGQPIPRIDYTLEEVKTWGVVFRELTKLYPTHACREYLKNLPLLTKHCGYREDNIPQLEDVSLFLRERSGFIVRPVAGYLSPRDFLAGLAYRVFNCTQYVRHSTDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDEDVQKLATCYFFTIEFGLCKQDGQLRAYGAGLLSSIGELRHALSDKAVVKPFDPRTTCYQECLITTFQDVYFVSDSFEEAKEKMREFAKSIKRPFSVYYNPYTQSIDLLKDTRSIENVVQDLRSDLTTVCDALG 438          

HSP 2 Score: 213.772 bits (543), Expect = 1.654e-61
Identity = 106/236 (44.92%), Postives = 152/236 (64.41%), Query Frame = -2
Query:    2 VEDFPDKE-------GNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQH---DNLKGD-VPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 676
            +++ PDKE       G T ++ +  +++G L   L +F++ HVNL HIESR SK +  + +     +         +++L+     +   + QH       G+ VPWFP+KI +LD+ ++++L YGSELDADHPGF D VYR+RRK F ++A  YK GQPI R++YT EE+ TW  VF +LT LYPTHAC+E+    PLL ++CGY  DNIPQL+DVS FL++ +GF +RPVAG L
Sbjct:    3 IDEKPDKEWVSTMDSGKTAVIFSLKNEVGCLVKALRLFQEKHVNLAHIESRKSKRVTTEVEIYAECNCTKKEFNELVQHLKDHVNIISYNTPQHVWSSETDGEGVPWFPQKISELDQCSHRVLMYGSELDADHPGFKDNVYRQRRKYFVEVAMNYKFGQPIPRIDYTLEEVKTWGVVFRELTKLYPTHACREYLKNLPLLTKHCGYREDNIPQLEDVSLFLRERSGFIVRPVAGYL 238          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Cavefish
Match: tph1a (tryptophan hydroxylase 1 [Source:NCBI gene;Acc:103043966])

HSP 1 Score: 449.514 bits (1155), Expect = 4.810e-152
Identity = 210/374 (56.15%), Postives = 276/374 (73.80%), Query Frame = 2
Query:  818 KEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQG----LSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLR 1927
            ++G   I+ +  +++G L   L++F++NHVNL+HIESR S+    +++ L++ D+    L   I+ L+     L  E  + S   ++   +VPWFP+KI DLD+ AN++L YGS+LDADHPGF D VYR+RRK FAD+A  YKHG PI R+E+T+EE+ TW  VF +L  LYPTHAC+E     PLL + CGY  DNIPQL+DVS FL++ TGF +RPVAG LS RDFLAGL+FRVFH TQY+RHS  PLYTPEPD CHELLGHVPL   P FAQFSQEIGLASLGASDE ++KLATCY+FTVEFGLCK+  K++AYGAGLLSS  EL++ L+   + + FDP+VT  Q+  I  +Q +YFV++SF +AK+++R
Sbjct:   53 EKGRAAIVFSLKNEVGGLVKALKLFQENHVNLVHIESRKSRRRNSEFEILVDCDSNHEQLNEIIQLLRKHVNVLDTETSIKSLPEEDEMDNVPWFPKKIADLDKCANRVLMYGSDLDADHPGFKDNVYRKRRKYFADLAMSYKHGDPIPRIEFTEEEVKTWGVVFRELNKLYPTHACREHLKNLPLLTKYCGYREDNIPQLEDVSRFLRERTGFNIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDEAVQKLATCYFFTVEFGLCKQEGKLRAYGAGLLSSISELRHALSGNARIMPFDPKVTCKQECIITTFQDVYFVSDSFEEAKVKMR 426          

HSP 2 Score: 233.032 bits (593), Expect = 7.115e-69
Identity = 110/223 (49.33%), Postives = 153/223 (68.61%), Query Frame = -2
Query:    2 KEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQG----LSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 658
            ++G   I+ +  +++G L   L++F++NHVNL+HIESR S+    +++ L++ D+    L   I+ L+     L  E  + S   ++   +VPWFP+KI DLD+ AN++L YGS+LDADHPGF D VYR+RRK FAD+A  YKHG PI R+E+T+EE+ TW  VF +L  LYPTHAC+E     PLL + CGY  DNIPQL+DVS FL++ TGF +RPVAG L
Sbjct:   53 EKGRAAIVFSLKNEVGGLVKALKLFQENHVNLVHIESRKSRRRNSEFEILVDCDSNHEQLNEIIQLLRKHVNVLDTETSIKSLPEEDEMDNVPWFPKKIADLDKCANRVLMYGSDLDADHPGFKDNVYRKRRKYFADLAMSYKHGDPIPRIEFTEEEVKTWGVVFRELNKLYPTHACREHLKNLPLLTKYCGYREDNIPQLEDVSRFLRERTGFNIRPVAGYL 275          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Sea Lamprey
Match: tph1a (tryptophan hydroxylase 1 (tryptophan 5-monooxygenase) a [Source:ZFIN;Acc:ZDB-GENE-030317-1])

HSP 1 Score: 487.649 bits (1254), Expect = 5.742e-167
Identity = 232/426 (54.46%), Postives = 308/426 (72.30%), Query Frame = 2
Query:  818 KEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADN---RTGGLMMAIE----NLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            + G   ++ +  + IG L   L++F++ HVNL+HIESR SK    +++  ++ D+   + G LM  +     N+  +S           +L G VPWFP+KI DLD  +N++L YG++LDADHPGF D VYR+RRK FADIA  YKHG+PI R+EYT+EE+ TW TVF +LT LYPTHAC+E+    PLL ++CGY  DNIPQL+DVS FLK+ +GFT+RPVAG LS RDFLAGL+FRVFH TQY+RHS  PLYTPEPD CHELLGHVPL   P FAQFSQEIGLASLGASDE ++KLATCY+FTVEFGLCK+  +++AYGAGLLSS  EL++ L++  K   FDP+VT  Q+  I  +Q IYFV+ESF +AK ++R F+K + R F V+Y+PYTQ++EVL     I +++  L+ + + + +AL+
Sbjct:   53 ERGRAAVVFSLKNDIGGLVKALKLFQEKHVNLMHIESRKSKRRNSEFEIYVDCDSNREQLGELMQLLRSHACNIVSMSGPASHCDVGPQDLDG-VPWFPKKISDLDHSSNKVLMYGADLDADHPGFKDNVYRKRRKHFADIALNYKHGEPIPRIEYTEEEVRTWATVFRELTKLYPTHACREYLKNLPLLTKHCGYRDDNIPQLEDVSRFLKERSGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDEAVQKLATCYFFTVEFGLCKQDGQLRAYGAGLLSSISELKHALSENAKVKGFDPKVTCKQECLITTFQDIYFVSESFEEAKEKMREFAKTIKRNFTVRYNPYTQSIEVLKDTRMIAEMVKELRAELDTVSDALH 477          

HSP 2 Score: 234.187 bits (596), Expect = 1.997e-69
Identity = 113/224 (50.45%), Postives = 153/224 (68.30%), Query Frame = -2
Query:    2 GNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADN---RTGGLMMAIE----NLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 652
            G   ++ +  + IG L   L++F++ HVNL+HIESR SK    +++  ++ D+   + G LM  +     N+  +S           +L G VPWFP+KI DLD  +N++L YG++LDADHPGF D VYR+RRK FADIA  YKHG+PI R+EYT+EE+ TW TVF +LT LYPTHAC+E+    PLL ++CGY  DNIPQL+DVS FLK+ +GFT+RPVAG L
Sbjct:   55 GRAAVVFSLKNDIGGLVKALKLFQEKHVNLMHIESRKSKRRNSEFEIYVDCDSNREQLGELMQLLRSHACNIVSMSGPASHCDVGPQDLDG-VPWFPKKISDLDHSSNKVLMYGADLDADHPGFKDNVYRKRRKHFADIALNYKHGEPIPRIEYTEEEVRTWATVFRELTKLYPTHACREYLKNLPLLTKHCGYRDDNIPQLEDVSRFLKERSGFTIRPVAGYL 277          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000676.1 (pep scaffold:Pmarinus_7.0:GL477040:200355:204568:-1 gene:ENSPMAG00000000617.1 transcript:ENSPMAT00000000676.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 313.153 bits (801), Expect = 5.061e-102
Identity = 146/279 (52.33%), Postives = 195/279 (69.89%), Query Frame = 2
Query: 1238 GQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            G+ I RV YT+EEI TW  V+ KL  LYPTHACKE    F LL+++CGY+ D IPQL+DVS FL + TGF LRP AGLLS+RDFLA L+FRVF  TQYIRH+  P+++PEPD CHELLGHVP+  +  FAQFSQ  G++ +         L   YWFTVEFGLCK+   +KAYGAGLLSSFGEL + L+ EP+  +F+ +   LQ Y    YQP+YFV++S  DAK +LR +++ + RP A+++DP T++V  LD    ++  + +L++  +VL  AL+
Sbjct:    1 GELIPRVHYTQEEIATWGEVYRKLAGLYPTHACKEHVDAFRLLEQHCGYSEDAIPQLEDVSTFLLERTGFQLRPAAGLLSARDFLASLAFRVFQCTQYIRHASSPMHSPEPDCCHELLGHVPMLADSTFAQFSQVSGVSEVSVRTHPCAPLPQLYWFTVEFGLCKQEGHVKAYGAGLLSSFGELMFALSGEPEYRAFEAEAAALQPYQDQTYQPVYFVSDSLEDAKDKLRQYAQGLRRPVALRFDPITRSVHALDSTRSLRTAVDALQEQVSVLSCALS 279          

HSP 2 Score: 104.375 bits (259), Expect = 4.408e-25
Identity = 49/79 (62.03%), Postives = 58/79 (73.42%), Query Frame = -2
Query:    2 GQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 238
            G+ I RV YT+EEI TW  V+ KL  LYPTHACKE    F LL+++CGY+ D IPQL+DVS FL + TGF LRP AGLL
Sbjct:    1 GELIPRVHYTQEEIATWGEVYRKLAGLYPTHACKEHVDAFRLLEQHCGYSEDAIPQLEDVSTFLLERTGFQLRPAAGLL 79          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006904.1 (pep scaffold:Pmarinus_7.0:GL491535:768:2811:-1 gene:ENSPMAG00000006244.1 transcript:ENSPMAT00000006904.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.9593 bits (206), Expect = 6.078e-20
Identity = 44/89 (49.44%), Postives = 58/89 (65.17%), Query Frame = -2
Query:  308 VNLLHIESRPSKNLKEQYDFLIN-ADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHP 571
            +NL HIESRP ++  +Q++F  + +  R G L   +  L+  S    VL    +  K  VPWFPR I+DLDRFANQILSYG+ELD+DHP
Sbjct:    5 LNLRHIESRPCRHAPDQWEFYASVSGERPGALDALLLELRSQSAG-SVLQLSRNKRKDAVPWFPRTIRDLDRFANQILSYGAELDSDHP 92          

HSP 2 Score: 83.1889 bits (204), Expect = 9.983e-20
Identity = 44/89 (49.44%), Postives = 58/89 (65.17%), Query Frame = 2
Query:  905 VNLLHIESRPSKNLKEQYDFLIN-ADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHP 1168
            +NL HIESRP ++  +Q++F  + +  R G L   +  L+  S    VL    +  K  VPWFPR I+DLDRFANQILSYG+ELD+DHP
Sbjct:    5 LNLRHIESRPCRHAPDQWEFYASVSGERPGALDALLLELRSQSAG-SVLQLSRNKRKDAVPWFPRTIRDLDRFANQILSYGAELDSDHP 92          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001726.1 (pep scaffold:Pmarinus_7.0:GL477470:183489:194417:1 gene:ENSPMAG00000001558.1 transcript:ENSPMAT00000001726.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.4925 bits (197), Expect = 1.367e-17
Identity = 67/199 (33.67%), Postives = 94/199 (47.24%), Query Frame = 2
Query: 1154 DADHP--GFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQY-----IRHSKVPLYT-PEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGL 1726
            D DHP   F   +   RR  F+++A  YK  +P   ++Y+  E   WR+  +      P  A  EF      L     Y+   IPQ   VS  L   TGF+L PV G   +R  L+ L+FRV   + +     + H     Y  P  DVC  LLG VPL      A+  Q++GLASLG+S+  ++ LA  ++   EF L
Sbjct:    1 DEDHPYSDFCSELDESRRAYFSELALQYKFREPAPVLQYSARESAAWRSALEAAVRGAPG-AEPEFRAALEELTVT-AYSASAIPQASHVSQLLHGHTGFSLWPVPGTPPARVLLSALAFRVLPCSLHACPGSVAHPAHRTYGGPLTDVCGLLLGLVPLLTMGPVARAVQDMGLASLGSSNTDVQLLAESFYSVCEFAL 197          

HSP 2 Score: 53.9138 bits (128), Expect = 1.899e-8
Identity = 35/107 (32.71%), Postives = 47/107 (43.93%), Query Frame = -2
Query:    8 DADHP--GFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAG 322
            D DHP   F   +   RR  F+++A  YK  +P   ++Y+  E   WR+  +      P  A  EF      L     Y+   IPQ   VS  L   TGF+L PV G
Sbjct:    1 DEDHPYSDFCSELDESRRAYFSELALQYKFREPAPVLQYSARESAAWRSALEAAVRGAPG-AEPEFRAALEELTVT-AYSASAIPQASHVSQLLHGHTGFSLWPVPG 105          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Nematostella
Match: EDO31745 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX22])

HSP 1 Score: 509.22 bits (1310), Expect = 2.124e-176
Identity = 238/368 (64.67%), Postives = 297/368 (80.71%), Query Frame = 2
Query:  830 TTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGG-LMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRN 1930
            TT++ + + ++G+LA  L++F+ +HVN+ HIESRPSK  K +YDF  + +   G  L   ++ L+  ++ + VLS    + KG VPWFPRKI DLD+FA+++LSYG+ELD+DHPGFTD VYR RRK+FADIAF +KHG+ I +V YT  EI TW  VF +LT LYPTHAC+E N+V+PLL +NCGY   NIPQLQDVS FLK+CTGFTLRPVAGLLSSRDFLAGL+FRVFHSTQYIRH   P+YTPEPDV HEL+GHVPLF +P+FAQFSQEIGLASLGA DE++EKLAT YWFTVEFGLC++  ++KAYGAGLLSSFGELQYCLTDEPKK   +P+ T +QKYPI +YQP+YF+A+SF  A+ ++R 
Sbjct:   31 TTVVFSLNEEVGALARALKLFEDHHVNMTHIESRPSKACKTRYDFFADCEGLHGASLNHFVDALKKRAVNITVLS----DDKGSVPWFPRKISDLDKFADRVLSYGAELDSDHPGFTDQVYRARRKEFADIAFKHKHGEIIPQVTYTDIEIATWDKVFTELTKLYPTHACREHNFVWPLLVQNCGYRLGNIPQLQDVSMFLKECTGFTLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPTKPMYTPEPDVVHELIGHVPLFADPDFAQFSQEIGLASLGAPDEWVEKLATLYWFTVEFGLCRQEGEVKAYGAGLLSSFGELQYCLTDEPKKYPLEPEKTSVQKYPITQYQPVYFIADSFLSARNKVRK 394          

HSP 2 Score: 263.848 bits (673), Expect = 3.015e-81
Identity = 126/216 (58.33%), Postives = 164/216 (75.93%), Query Frame = -2
Query:    2 TTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGG-LMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 646
            TT++ + + ++G+LA  L++F+ +HVN+ HIESRPSK  K +YDF  + +   G  L   ++ L+  ++ + VLS    + KG VPWFPRKI DLD+FA+++LSYG+ELD+DHPGFTD VYR RRK+FADIAF +KHG+ I +V YT  EI TW  VF +LT LYPTHAC+E N+V+PLL +NCGY   NIPQLQDVS FLK+CTGFTLRPVAGLL
Sbjct:   31 TTVVFSLNEEVGALARALKLFEDHHVNMTHIESRPSKACKTRYDFFADCEGLHGASLNHFVDALKKRAVNITVLS----DDKGSVPWFPRKISDLDKFADRVLSYGAELDSDHPGFTDQVYRARRKEFADIAFKHKHGEIIPQVTYTDIEIATWDKVFTELTKLYPTHACREHNFVWPLLVQNCGYRLGNIPQLQDVSMFLKECTGFTLRPVAGLL 242          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Medaka
Match: pah (phenylalanine hydroxylase [Source:NCBI gene;Acc:101163702])

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 272/427 (63.70%), Postives = 328/427 (76.81%), Query Frame = 2
Query:  797 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNR-TGGLMMAIENLQG-LSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            Y+E+  +K G  + + +   ++G+LA  L +F+ N +NL HIESRPS+   E+Y+F I+ ++  +  L   I+ L+  +S  V  LSR  +  K  VPWFP  I+DLDRFANQILSYGSELDADHPGFTD VYR RRK+FADIA+ Y+HGQPI RVEYT+ E  TW  VF +L TLYPTHAC+E N VFPLL+  CGY +DNIPQL+DVS FL+ CTGF LRPVAGLLSSRDFLAGL+FRVFHSTQYIRH   P YTPEPDVCHELLGHVPL  +P FAQFSQEIGLASLGA DE+IEKLAT YWFTVE+GLCK+  +IKAYGAGLLSSFGELQY LTDEP  L FDP+ T LQKYPI EYQP+YFVAESF DAK ++R F+  + RPF+V+Y+PYTQ++EVL+   Q++ L   +  +   L EAL
Sbjct:   78 YLEEETNKSGVISCIFSLKEEVGALAKALRLFEDNGINLTHIESRPSRMNGEEYEFFISVESSCSQALDDVIDGLRKEISGHVHGLSR--NKQKDTVPWFPNDIQDLDRFANQILSYGSELDADHPGFTDQVYRARRKEFADIAYNYRHGQPIPRVEYTEAEKETWGIVFKELKTLYPTHACREHNRVFPLLERYCGYRQDNIPQLEDVSRFLQSCTGFRLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHGSKPTYTPEPDVCHELLGHVPLLADPSFAQFSQEIGLASLGAPDEFIEKLATVYWFTVEYGLCKQGSEIKAYGAGLLSSFGELQYSLTDEPNMLPFDPEKTSLQKYPITEYQPVYFVAESFEDAKEKVRKFAGTIPRPFSVRYNPYTQSIEVLNNTQQLRNLADCINCEVGKLCEAL 502          

HSP 2 Score: 266.159 bits (679), Expect = 1.993e-80
Identity = 132/228 (57.89%), Postives = 165/228 (72.37%), Query Frame = -2
Query:    2 YVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTG-GLMMAIENLQG-LSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 679
            Y+E+  +K G  + + +   ++G+LA  L +F+ N +NL HIESRPS+   E+Y+F I+ ++     L   I+ L+  +S  V  LSR  +  K  VPWFP  I+DLDRFANQILSYGSELDADHPGFTD VYR RRK+FADIA+ Y+HGQPI RVEYT+ E  TW  VF +L TLYPTHAC+E N VFPLL+  CGY +DNIPQL+DVS FL+ CTGF LRPVAGLL
Sbjct:   78 YLEEETNKSGVISCIFSLKEEVGALAKALRLFEDNGINLTHIESRPSRMNGEEYEFFISVESSCSQALDDVIDGLRKEISGHVHGLSR--NKQKDTVPWFPNDIQDLDRFANQILSYGSELDADHPGFTDQVYRARRKEFADIAYNYRHGQPIPRVEYTEAEKETWGIVFKELKTLYPTHACREHNRVFPLLERYCGYRQDNIPQLEDVSRFLQSCTGFRLRPVAGLL 303          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Medaka
Match: tph1 (tryptophan hydroxylase 1 [Source:NCBI gene;Acc:101175562])

HSP 1 Score: 480.33 bits (1235), Expect = 3.536e-164
Identity = 225/423 (53.19%), Postives = 306/423 (72.34%), Query Frame = 2
Query:  818 KEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQG----LSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            ++G  TI+ +  +++G L   L++F++NHVNL+HIESR SK    +++  ++ D+    L   I  L+     + +     S  H+    DVPWFP++I DLD+ AN++L YGSELDADHPGF D VYR+RRK FAD+A  YKHG PI R+E+T+EE+ TW  V+ +L  LYPTHAC+E+    PLL + C    DNIPQL+DVS FL++ TGFT+RPVAG LS RDFLAGL+FRVFH TQY+RHS  PLYTPEPD CHELLGHVPL   P FAQFSQEIGLASLGASD+ ++KLATCY+FTVEFGLCK+   ++AYGAGLLSS  EL++ L+   + + FDP+VT  Q+  I  +Q +YFV++SF +AK+++R F+K + RPF V+Y+PYTQ+V+VL     I  ++  L+ + +++ +AL+
Sbjct:    8 EKGRATIIFSLKNEVGGLVKALKLFQENHVNLVHIESRKSKRRNSEFEIFVDCDSNHEQLSEIIHLLRKHVNIVDMNPPDNSCLHEEDMYDVPWFPKRISDLDKCANRVLMYGSELDADHPGFKDNVYRKRRKYFADLAMAYKHGDPIPRIEFTEEEVKTWGVVYRELNKLYPTHACREYLKNLPLLSKYCECREDNIPQLEDVSRFLRERTGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDDSVQKLATCYFFTVEFGLCKQEGHLRAYGAGLLSSISELKHALSGNARIMPFDPKVTSKQECIITTFQDVYFVSDSFEEAKVKMREFAKTIKRPFTVRYNPYTQSVDVLKDTLSINSVVEELRHELDIVGDALS 430          

HSP 2 Score: 227.639 bits (579), Expect = 8.476e-67
Identity = 109/223 (48.88%), Postives = 151/223 (67.71%), Query Frame = -2
Query:    2 KEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQG----LSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 658
            ++G  TI+ +  +++G L   L++F++NHVNL+HIESR SK    +++  ++ D+    L   I  L+     + +     S  H+    DVPWFP++I DLD+ AN++L YGSELDADHPGF D VYR+RRK FAD+A  YKHG PI R+E+T+EE+ TW  V+ +L  LYPTHAC+E+    PLL + C    DNIPQL+DVS FL++ TGFT+RPVAG L
Sbjct:    8 EKGRATIIFSLKNEVGGLVKALKLFQENHVNLVHIESRKSKRRNSEFEIFVDCDSNHEQLSEIIHLLRKHVNIVDMNPPDNSCLHEEDMYDVPWFPKRISDLDKCANRVLMYGSELDADHPGFKDNVYRKRRKYFADLAMAYKHGDPIPRIEFTEEEVKTWGVVYRELNKLYPTHACREYLKNLPLLSKYCECREDNIPQLEDVSRFLRERTGFTIRPVAGYL 230          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Medaka
Match: tph1 (tryptophan hydroxylase 1 [Source:NCBI gene;Acc:101175562])

HSP 1 Score: 479.945 bits (1234), Expect = 2.206e-162
Identity = 225/423 (53.19%), Postives = 306/423 (72.34%), Query Frame = 2
Query:  818 KEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQG----LSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            ++G  TI+ +  +++G L   L++F++NHVNL+HIESR SK    +++  ++ D+    L   I  L+     + +     S  H+    DVPWFP++I DLD+ AN++L YGSELDADHPGF D VYR+RRK FAD+A  YKHG PI R+E+T+EE+ TW  V+ +L  LYPTHAC+E+    PLL + C    DNIPQL+DVS FL++ TGFT+RPVAG LS RDFLAGL+FRVFH TQY+RHS  PLYTPEPD CHELLGHVPL   P FAQFSQEIGLASLGASD+ ++KLATCY+FTVEFGLCK+   ++AYGAGLLSS  EL++ L+   + + FDP+VT  Q+  I  +Q +YFV++SF +AK+++R F+K + RPF V+Y+PYTQ+V+VL     I  ++  L+ + +++ +AL+
Sbjct:  119 EKGRATIIFSLKNEVGGLVKALKLFQENHVNLVHIESRKSKRRNSEFEIFVDCDSNHEQLSEIIHLLRKHVNIVDMNPPDNSCLHEEDMYDVPWFPKRISDLDKCANRVLMYGSELDADHPGFKDNVYRKRRKYFADLAMAYKHGDPIPRIEFTEEEVKTWGVVYRELNKLYPTHACREYLKNLPLLSKYCECREDNIPQLEDVSRFLRERTGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDDSVQKLATCYFFTVEFGLCKQEGHLRAYGAGLLSSISELKHALSGNARIMPFDPKVTSKQECIITTFQDVYFVSDSFEEAKVKMREFAKTIKRPFTVRYNPYTQSVDVLKDTLSINSVVEELRHELDIVGDALS 541          

HSP 2 Score: 227.639 bits (579), Expect = 1.309e-65
Identity = 109/223 (48.88%), Postives = 151/223 (67.71%), Query Frame = -2
Query:    2 KEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQG----LSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 658
            ++G  TI+ +  +++G L   L++F++NHVNL+HIESR SK    +++  ++ D+    L   I  L+     + +     S  H+    DVPWFP++I DLD+ AN++L YGSELDADHPGF D VYR+RRK FAD+A  YKHG PI R+E+T+EE+ TW  V+ +L  LYPTHAC+E+    PLL + C    DNIPQL+DVS FL++ TGFT+RPVAG L
Sbjct:  119 EKGRATIIFSLKNEVGGLVKALKLFQENHVNLVHIESRKSKRRNSEFEIFVDCDSNHEQLSEIIHLLRKHVNIVDMNPPDNSCLHEEDMYDVPWFPKRISDLDKCANRVLMYGSELDADHPGFKDNVYRKRRKYFADLAMAYKHGDPIPRIEFTEEEVKTWGVVYRELNKLYPTHACREYLKNLPLLSKYCECREDNIPQLEDVSRFLRERTGFTIRPVAGYL 341          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Medaka
Match: tph1b (tryptophan 5-hydroxylase 1 [Source:NCBI gene;Acc:101170994])

HSP 1 Score: 466.463 bits (1199), Expect = 1.891e-158
Identity = 227/430 (52.79%), Postives = 300/430 (69.77%), Query Frame = 2
Query:  827 NTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLS-------------RQHDNLKGD-VPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
              TI+ T  +++G L   L++F++ HV+L+HIESR S+     ++  ++ D+    +    E  Q LS   Q++               + D  + D VPWFP+KI DLD+ AN++L YGS+LDADHPGF D VYR+RR+ FAD+A  +KHG PI ++ YT EE+ TW  VF +L  LYP+HACKE+    PLL  +C Y+ DNIPQL+DVS FLK  +GFT+RPVAG LS RDFLAGL+FRVFH TQY+RHS  PLYTPEPD CHELLGHVPL   P FAQFSQEIGLASLGASD+ ++KLATCY+FTVEFGLCK+  K++AYGAGLLSS  EL++ L+ +   L FDP +T  Q+  I  +Q  YFVAESF +AK ++R F+K + RPF V Y+PYTQ+V+VL     I  ++  ++ + +++EEALN
Sbjct:   12 TATIIFTLKNEVGGLIKALKLFQEKHVHLVHIESRKSRRRDSDFEVFVDCDSEHEQMK---ELTQLLSTHAQIVEITPFGGCSPLAEDDRADAPEADGVPWFPKKISDLDQCANRVLMYGSDLDADHPGFKDSVYRKRRQYFADVAMTFKHGNPIPKIHYTAEEVCTWGVVFRELHKLYPSHACKEYLKNLPLLTRDCCYSEDNIPQLEDVSKFLKGQSGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSEPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDDAVKKLATCYFFTVEFGLCKQDGKLRAYGAGLLSSASELKHSLSGKANILPFDPILTCNQECMITTFQEAYFVAESFEEAKNKMREFAKTLHRPFTVHYNPYTQSVDVLTNTHNINSMVKDIRHELDIVEEALN 438          

HSP 2 Score: 213.772 bits (543), Expect = 1.381e-61
Identity = 106/230 (46.09%), Postives = 147/230 (63.91%), Query Frame = -2
Query:    2 NTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLS-------------RQHDNLKGD-VPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 649
              TI+ T  +++G L   L++F++ HV+L+HIESR S+     ++  ++ D+    +    E  Q LS   Q++               + D  + D VPWFP+KI DLD+ AN++L YGS+LDADHPGF D VYR+RR+ FAD+A  +KHG PI ++ YT EE+ TW  VF +L  LYP+HACKE+    PLL  +C Y+ DNIPQL+DVS FLK  +GFT+RPVAG L
Sbjct:   12 TATIIFTLKNEVGGLIKALKLFQEKHVHLVHIESRKSRRRDSDFEVFVDCDSEHEQMK---ELTQLLSTHAQIVEITPFGGCSPLAEDDRADAPEADGVPWFPKKISDLDQCANRVLMYGSDLDADHPGFKDSVYRKRRQYFADVAMTFKHGNPIPKIHYTAEEVCTWGVVFRELHKLYPSHACKEYLKNLPLLTRDCCYSEDNIPQLEDVSKFLKGQSGFTIRPVAGYL 238          
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Medaka
Match: tph1b (tryptophan 5-hydroxylase 1 [Source:NCBI gene;Acc:101170994])

HSP 1 Score: 467.233 bits (1201), Expect = 2.864e-158
Identity = 227/433 (52.42%), Postives = 302/433 (69.75%), Query Frame = 2
Query:  818 KEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLS-------------RQHDNLKGD-VPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            ++   TI+ T  +++G L   L++F++ HV+L+HIESR S+     ++  ++ D+    +    E  Q LS   Q++               + D  + D VPWFP+KI DLD+ AN++L YGS+LDADHPGF D VYR+RR+ FAD+A  +KHG PI ++ YT EE+ TW  VF +L  LYP+HACKE+    PLL  +C Y+ DNIPQL+DVS FLK  +GFT+RPVAG LS RDFLAGL+FRVFH TQY+RHS  PLYTPEPD CHELLGHVPL   P FAQFSQEIGLASLGASD+ ++KLATCY+FTVEFGLCK+  K++AYGAGLLSS  EL++ L+ +   L FDP +T  Q+  I  +Q  YFVAESF +AK ++R F+K + RPF V Y+PYTQ+V+VL     I  ++  ++ + +++EEALN
Sbjct:   45 RKRTATIIFTLKNEVGGLIKALKLFQEKHVHLVHIESRKSRRRDSDFEVFVDCDSEHEQMK---ELTQLLSTHAQIVEITPFGGCSPLAEDDRADAPEADGVPWFPKKISDLDQCANRVLMYGSDLDADHPGFKDSVYRKRRQYFADVAMTFKHGNPIPKIHYTAEEVCTWGVVFRELHKLYPSHACKEYLKNLPLLTRDCCYSEDNIPQLEDVSKFLKGQSGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSEPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDDAVKKLATCYFFTVEFGLCKQDGKLRAYGAGLLSSASELKHSLSGKANILPFDPILTCNQECMITTFQEAYFVAESFEEAKNKMREFAKTLHRPFTVHYNPYTQSVDVLTNTHNINSMVKDIRHELDIVEEALN 474          

HSP 2 Score: 214.157 bits (544), Expect = 2.220e-61
Identity = 106/230 (46.09%), Postives = 147/230 (63.91%), Query Frame = -2
Query:    2 NTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLS-------------RQHDNLKGD-VPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 649
              TI+ T  +++G L   L++F++ HV+L+HIESR S+     ++  ++ D+    +    E  Q LS   Q++               + D  + D VPWFP+KI DLD+ AN++L YGS+LDADHPGF D VYR+RR+ FAD+A  +KHG PI ++ YT EE+ TW  VF +L  LYP+HACKE+    PLL  +C Y+ DNIPQL+DVS FLK  +GFT+RPVAG L
Sbjct:   48 TATIIFTLKNEVGGLIKALKLFQEKHVHLVHIESRKSRRRDSDFEVFVDCDSEHEQMK---ELTQLLSTHAQIVEITPFGGCSPLAEDDRADAPEADGVPWFPKKISDLDQCANRVLMYGSDLDADHPGFKDSVYRKRRQYFADVAMTFKHGNPIPKIHYTAEEVCTWGVVFRELHKLYPSHACKEYLKNLPLLTRDCCYSEDNIPQLEDVSKFLKGQSGFTIRPVAGYL 274          
BLAST of Tryptophan 5-hydroxylase vs. Planmine SMEST
Match: SMESG000077798.1 (SMESG000077798.1)

HSP 1 Score: 912.138 bits (2356), Expect = 0.000e+0
Identity = 438/438 (100.00%), Postives = 438/438 (100.00%), Query Frame = 2
Query:  761 MNKEEGGGTLGYYVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            MNKEEGGGTLGYYVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN
Sbjct:    1 MNKEEGGGTLGYYVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 438          

HSP 2 Score: 496.123 bits (1276), Expect = 2.113e-170
Identity = 237/237 (100.00%), Postives = 237/237 (100.00%), Query Frame = -2
Query:    2 NKEEGGGTLGYYVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 712
            NKEEGGGTLGYYVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL
Sbjct:    2 NKEEGGGTLGYYVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 238          
BLAST of Tryptophan 5-hydroxylase vs. Planmine SMEST
Match: SMESG000000522.1 (SMESG000000522.1)

HSP 1 Score: 450.669 bits (1158), Expect = 4.729e-152
Identity = 216/448 (48.21%), Postives = 296/448 (66.07%), Query Frame = 2
Query:  827 NTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIE--------------------NLQGLSLE-------------VQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            +T+ +   +  +  L  +LEIF+K  V+++HIE+R S   K +++  I+ D R   +   IE                    N+ G+ ++             +Q+ +++      ++PWFP+ IKDLD+ +N+++ YGSELDADHPGF D VYR RR QF++IA+ YKHG PI ++EYT EEI TW  V+ +LT LYPTHAC+EF    PLLQ+ CGY  DNIPQL+DVS FLK  +GFTLRPVAG LSSRDFLAGL+FRVFH TQYIRH   P YTPEPD CHEL+GHVPL  +  FAQFSQEIGLASLGAS++ +++LATCY+FT+EFGLC +  +++AYGAGLLSS GEL++ L++E     FDP+    Q+  +  +Q  YF   SF DAK ++R F+K + +PF V Y+PYTQ +E LD    +  ++ ++K +   +  AL
Sbjct:   12 STSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNAL 459          

HSP 2 Score: 218.779 bits (556), Expect = 3.341e-63
Identity = 112/249 (44.98%), Postives = 149/249 (59.84%), Query Frame = -2
Query:    2 NTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQ-------------------------GLSLEVQVLSRQHDNLKG--------DVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 649
            +T+ +   +  +  L  +LEIF+K  V+++HIE+R S   K +++  I+ D R   +   IE LQ                            L    +  Q+  LK         ++PWFP+ IKDLD+ +N+++ YGSELDADHPGF D VYR RR QF++IA+ YKHG PI ++EYT EEI TW  V+ +LT LYPTHAC+EF    PLLQ+ CGY  DNIPQL+DVS FLK  +GFTLRPVAG L
Sbjct:   12 STSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYL 260          
BLAST of Tryptophan 5-hydroxylase vs. Planmine SMEST
Match: SMESG000000522.1 (SMESG000000522.1)

HSP 1 Score: 452.595 bits (1163), Expect = 8.707e-152
Identity = 216/448 (48.21%), Postives = 296/448 (66.07%), Query Frame = 2
Query:  827 NTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIE--------------------NLQGLSLE-------------VQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEAL 2071
            +T+ +   +  +  L  +LEIF+K  V+++HIE+R S   K +++  I+ D R   +   IE                    N+ G+ ++             +Q+ +++      ++PWFP+ IKDLD+ +N+++ YGSELDADHPGF D VYR RR QF++IA+ YKHG PI ++EYT EEI TW  V+ +LT LYPTHAC+EF    PLLQ+ CGY  DNIPQL+DVS FLK  +GFTLRPVAG LSSRDFLAGL+FRVFH TQYIRH   P YTPEPD CHEL+GHVPL  +  FAQFSQEIGLASLGAS++ +++LATCY+FT+EFGLC +  +++AYGAGLLSS GEL++ L++E     FDP+    Q+  +  +Q  YF   SF DAK ++R F+K + +PF V Y+PYTQ +E LD    +  ++ ++K +   +  AL
Sbjct:   79 STSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNAL 526          

HSP 2 Score: 219.935 bits (559), Expect = 6.275e-63
Identity = 112/249 (44.98%), Postives = 149/249 (59.84%), Query Frame = -2
Query:    2 NTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQ-------------------------GLSLEVQVLSRQHDNLKG--------DVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 649
            +T+ +   +  +  L  +LEIF+K  V+++HIE+R S   K +++  I+ D R   +   IE LQ                            L    +  Q+  LK         ++PWFP+ IKDLD+ +N+++ YGSELDADHPGF D VYR RR QF++IA+ YKHG PI ++EYT EEI TW  V+ +LT LYPTHAC+EF    PLLQ+ CGY  DNIPQL+DVS FLK  +GFTLRPVAG L
Sbjct:   79 STSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYL 327          
BLAST of Tryptophan 5-hydroxylase vs. Planmine SMEST
Match: SMESG000034472.1 (SMESG000034472.1)

HSP 1 Score: 381.719 bits (979), Expect = 4.783e-125
Identity = 205/445 (46.07%), Postives = 279/445 (62.70%), Query Frame = 2
Query:  806 DFPDKEG----NTTILITASSKIGSLASILEIFKKNHVNLLHIESRP--SKNLKE-----------QYDFLINADNRT-----GGLMMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALN 2074
            +FPD+E     N TI +  S     L  ++   K  ++ L+HIESR   SKN  +           +  F+ N   R+       L+   +N Q L+ E ++     D +  D+ W P+ I DLD   + +L +  E+ +DHPGF D  Y++RR + A+IAF +KHG+ I RVEY + E NTW+  +  LT+LY  +ACKE       L+E C Y  DNIPQL+DVS++LK  +GF LRPVAGLLS+RDFLA L FRVF  TQY RH   PL+TPEPD  HELLGHVP+  + EFA+FSQEIGL SLGASDE IE+LAT YWFTVEFGLC E  K+KA+GAGLLSS GELQ+ ++D P+   F+PQ   +  Y   EYQP+Y+V +S  D K ++R F+K + R   ++YDPYT+T+EVL+    +  L   +K + + +E +L+
Sbjct:   49 EFPDEEETEKFNHTIKMLFSQDYKMLEIVISNLKNANIELIHIESRQVNSKNYSDASMNGLIYNSLEILFVFNCTRRSYKEIIAKLIDEDKNYQKLT-EFKI----KDEIVDDI-WIPKHISDLDNCNHLVLKFQPEMASDHPGFHDKEYQKRRMEIAEIAFNFKHGEKIPRVEYLESEKNTWKEAYIALTSLYKDYACKEQLIGIKRLEEECEYGPDNIPQLEDVSNYLKKKSGFQLRPVAGLLSARDFLASLGFRVFQCTQYTRHHSKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKMKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLS 487          

HSP 2 Score: 152.525 bits (384), Expect = 2.131e-39
Identity = 95/245 (38.78%), Postives = 137/245 (55.92%), Query Frame = -2
Query:    2 DFPDKEG----NTTILITASSKIGSLASILEIFKKNHVNLLHIESRP--SKNLKE-----------QYDFLINADNRTGGLMMAI-----ENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLL 670
            +FPD+E     N TI +  S     L  ++   K  ++ L+HIESR   SKN  +           +  F+ N   R+   ++A      +N Q L+ E ++     D +  D+ W P+ I DLD   + +L +  E+ +DHPGF D  Y++RR + A+IAF +KHG+ I RVEY + E NTW+  +  LT+LY  +ACKE       L+E C Y  DNIPQL+DVS++LK  +GF LRPVAGLL
Sbjct:   49 EFPDEEETEKFNHTIKMLFSQDYKMLEIVISNLKNANIELIHIESRQVNSKNYSDASMNGLIYNSLEILFVFNCTRRSYKEIIAKLIDEDKNYQKLT-EFKI----KDEIVDDI-WIPKHISDLDNCNHLVLKFQPEMASDHPGFHDKEYQKRRMEIAEIAFNFKHGEKIPRVEYLESEKNTWKEAYIALTSLYKDYACKEQLIGIKRLEEECEYGPDNIPQLEDVSNYLKKKSGFQLRPVAGLL 287          
The following BLAST results are available for this feature:
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAH3.541e-8361.18phenylalanine hydroxylase [Source:HGNC Symbol;Acc:... [more]
PAH2.709e-8361.03phenylalanine hydroxylase [Source:HGNC Symbol;Acc:... [more]
TPH11.523e-16353.86tryptophan hydroxylase 1 [Source:HGNC Symbol;Acc:H... [more]
TPH22.146e-15951.12tryptophan hydroxylase 2 [Source:HGNC Symbol;Acc:H... [more]
TH2.217e-14849.30tyrosine hydroxylase [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pah-13.804e-7960.09Phenylalanine-4-hydroxylase [Source:UniProtKB/Swi... [more]
pah-15.074e-7960.09Phenylalanine-4-hydroxylase [Source:UniProtKB/Swi... [more]
tph-14.449e-12143.78TryPtophan Hydroxylase [Source:UniProtKB/TrEMBL;A... [more]
tph-11.353e-12045.00TryPtophan Hydroxylase [Source:UniProtKB/TrEMBL;A... [more]
cat-21.490e-11442.86Tyrosine 3-monooxygenase [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hn2.661e-8761.25gene:FBgn0001208 transcript:FBtr0334645[more]
Hn2.661e-8761.25gene:FBgn0001208 transcript:FBtr0076811[more]
Hn2.186e-8761.25gene:FBgn0001208 transcript:FBtr0100225[more]
Trh5.048e-14452.22gene:FBgn0035187 transcript:FBtr0072638[more]
ple3.987e-13747.84gene:FBgn0005626 transcript:FBtr0076956[more]
back to top
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pah8.827e-8361.29phenylalanine hydroxylase [Source:ZFIN;Acc:ZDB-GEN... [more]
tph1a6.586e-16453.30tryptophan hydroxylase 1 (tryptophan 5-monooxygena... [more]
tph1a8.091e-16453.30tryptophan hydroxylase 1 (tryptophan 5-monooxygena... [more]
tph1b5.708e-16153.41tryptophan hydroxylase 1b [Source:ZFIN;Acc:ZDB-GEN... [more]
tph1b5.708e-16153.41tryptophan hydroxylase 1b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmgcr2.287e-7961.313-hydroxy-3-methylglutaryl-CoA reductase [Source:X... [more]
hmgcr1.823e-7963.333-hydroxy-3-methylglutaryl-CoA reductase [Source:X... [more]
hmgcr1.900e-7963.333-hydroxy-3-methylglutaryl-CoA reductase [Source:X... [more]
hmgcr7.478e-7466.333-hydroxy-3-methylglutaryl-CoA reductase [Source:X... [more]
hmgcr5.093e-7366.843-hydroxy-3-methylglutaryl-CoA reductase [Source:X... [more]
back to top
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pah9.915e-8462.24phenylalanine hydroxylase [Source:MGI Symbol;Acc:M... [more]
Tph14.926e-16454.10tryptophan hydroxylase 1 [Source:MGI Symbol;Acc:MG... [more]
Tph14.926e-16454.10tryptophan hydroxylase 1 [Source:MGI Symbol;Acc:MG... [more]
Tph22.424e-15852.83tryptophan hydroxylase 2 [Source:MGI Symbol;Acc:MG... [more]
Th6.017e-14950.00tyrosine hydroxylase [Source:MGI Symbol;Acc:MGI:98... [more]
back to top
BLAST of Tryptophan 5-hydroxylase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P17276|PH4H_DROME2.668e-8661.25Protein henna OS=Drosophila melanogaster OX=7227 G... [more]
sp|P04176|PH4H_RAT4.057e-8362.47Phenylalanine-4-hydroxylase OS=Rattus norvegicus O... [more]
sp|P16331|PH4H_MOUSE6.936e-8362.24Phenylalanine-4-hydroxylase OS=Mus musculus OX=100... [more]
sp|P00439|PH4H_HUMAN1.701e-8261.18Phenylalanine-4-hydroxylase OS=Homo sapiens OX=960... [more]
sp|Q2KIH7|PH4H_BOVIN2.463e-7959.91Phenylalanine-4-hydroxylase OS=Bos taurus OX=9913 ... [more]
back to top
BLAST of Tryptophan 5-hydroxylase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3ID411.365e-9566.36protein henna OS=Lingula unguis OX=7574 GN=LOC1061... [more]
A0A2T7P5213.436e-10067.06Uncharacterized protein OS=Pomacea canaliculata OX... [more]
V4A8Y63.476e-9665.22Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
R7TJT05.789e-9364.68Uncharacterized protein OS=Capitella teleta OX=283... [more]
K1QHH01.359e-9164.25Protein henna OS=Crassostrea gigas OX=29159 GN=CGI... [more]
back to top
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pah1.320e-7361.90phenylalanine hydroxylase [Source:ZFIN;Acc:ZDB-GEN... [more]
tph1a1.062e-16854.14tryptophan hydroxylase 1 [Source:NCBI gene;Acc:103... [more]
tph1b5.205e-16252.26tryptophan 5-hydroxylase 1-like [Source:NCBI gene;... [more]
tph23.138e-15550.46tryptophan hydroxylase 2 (tryptophan 5-monooxygena... [more]
tph1a4.810e-15256.15tryptophan hydroxylase 1 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tph1a5.742e-16754.46tryptophan hydroxylase 1 (tryptophan 5-monooxygena... [more]
ENSPMAT00000000676.15.061e-10252.33pep scaffold:Pmarinus_7.0:GL477040:200355:204568:-... [more]
ENSPMAT00000006904.16.078e-2049.44pep scaffold:Pmarinus_7.0:GL491535:768:2811:-1 gen... [more]
ENSPMAT00000001726.11.367e-1733.67pep scaffold:Pmarinus_7.0:GL477470:183489:194417:1... [more]
back to top
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO317452.124e-17664.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tryptophan 5-hydroxylase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pah1.993e-8063.70phenylalanine hydroxylase [Source:NCBI gene;Acc:10... [more]
tph13.536e-16453.19tryptophan hydroxylase 1 [Source:NCBI gene;Acc:101... [more]
tph12.206e-16253.19tryptophan hydroxylase 1 [Source:NCBI gene;Acc:101... [more]
tph1b1.891e-15852.79tryptophan 5-hydroxylase 1 [Source:NCBI gene;Acc:1... [more]
tph1b2.864e-15852.42tryptophan 5-hydroxylase 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Tryptophan 5-hydroxylase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000077798.12.113e-170100.00SMESG000077798.1[more]
SMESG000000522.14.729e-15248.21SMESG000000522.1[more]
SMESG000000522.18.707e-15248.21SMESG000000522.1[more]
SMESG000034472.14.783e-12546.07SMESG000034472.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004098 ID=SMED30004098|Name=Tryptophan 5-hydroxylase|organism=Schmidtea mediterranea sexual|type=transcript|length=2144bp
ATAATAATCCAGCAACGGGTCTCAGTGTGAATCCAGTGCAATCTTTCAAA
AAATCTGAAACGTCTTGAAGTTGAGGAATATTATCACGATTATAACCACA
ATTTTCTTGTAATAAAGGAAAAACGTAATTGAATTCTTTACAAGCGTGAG
TTGGGTAAAGTGTTGTTAATTTGTCAAAAACTGTTCTCCAAGTATTGATT
TCTTCCTTTGTATACTCAACTCTCTGAATAGGTTGACCATGCTTGTAAAA
AAATGCTATGTCTGCAAATTGTTTTCTTCTTTCTCGATATACTGGATCTG
TAAACCCAGGGTGATCTGCATCTAGCTCTGAACCATATGATAGAATTTGA
TTGGCAAAGCGATCAAGATCTTTTATTTTTCTTGGAAACCAAGGAACGTC
TCCTTTTAAATTGTCATGTTGTCTTGATAAAACTTGGACTTCTAACGAGA
GACCTTGTAAATTTTCAATGGCCATCATAAGTCCACCCGTTCGATTGTCC
GCATTAATCAAAAAATCGTATTGTTCTTTCAAATTCTTTGACGGCCGAGA
TTCAATATGTAAAAGATTTACATGATTTTTCTTAAAGATTTCTAAAATCG
AGGCCAAAGATCCGATTTTTGAAGAAGCCGTGATCAGAATTGTCGTATTA
CCTTCTTTGTCGGGAAAATCTTCAACGTAATAACCAAGAGTGCCTCCACC
TTCTTCTTTATTTCAAGCCGCTGTCGCCATTCGTTTGCTTTTGTAAATTA
AAATCCTGTCATGAATAAAGAAGAAGGTGGAGGCACTCTTGGTTATTACG
TTGAAGATTTTCCCGACAAAGAAGGTAATACGACAATTCTGATCACGGCT
TCTTCAAAAATCGGATCTTTGGCCTCGATTTTAGAAATCTTTAAGAAAAA
TCATGTAAATCTTTTACATATTGAATCTCGGCCGTCAAAGAATTTGAAAG
AACAATACGATTTTTTGATTAATGCGGACAATCGAACGGGTGGACTTATG
ATGGCCATTGAAAATTTACAAGGTCTCTCGTTAGAAGTCCAAGTTTTATC
AAGACAACATGACAATTTAAAAGGAGACGTTCCTTGGTTTCCAAGAAAAA
TAAAAGATCTTGATCGCTTTGCCAATCAAATTCTATCATATGGTTCAGAG
CTAGATGCAGATCACCCTGGGTTTACAGATCCAGTATATCGAGAAAGAAG
AAAACAATTTGCAGACATAGCATTTTTTTACAAGCATGGTCAACCTATTC
AGAGAGTTGAGTATACAAAGGAAGAAATCAATACTTGGAGAACAGTTTTT
GACAAATTAACAACACTTTACCCAACTCACGCTTGTAAAGAATTCAATTA
CGTTTTTCCTTTATTACAAGAAAATTGTGGTTATAATCGTGATAATATTC
CTCAACTTCAAGACGTTTCAGATTTTTTGAAAGATTGCACTGGATTCACA
CTGAGACCCGTTGCTGGATTATTATCTTCAAGGGATTTTCTTGCTGGTTT
GTCTTTTCGAGTTTTTCATTCAACTCAGTATATCAGACACTCGAAAGTTC
CTCTTTACACGCCTGAACCGGATGTCTGCCATGAACTTCTTGGTCATGTA
CCATTGTTTTGTAATCCAGAATTTGCGCAATTTTCTCAAGAAATCGGTTT
AGCTTCACTTGGTGCGTCTGATGAATACATCGAAAAGCTGGCTACCTGCT
ACTGGTTCACAGTTGAATTTGGTTTGTGTAAAGAGCATGACAAAATTAAA
GCCTACGGGGCTGGTCTTTTAAGTTCGTTTGGTGAATTACAGTATTGCCT
TACGGATGAGCCGAAAAAATTGTCGTTTGATCCACAAGTAACCGGACTAC
AGAAATATCCAATTGTAGAATATCAGCCAATTTATTTTGTAGCTGAAAGT
TTTGCCGATGCCAAAATTCGTTTGAGGAATTTTTCAAAAATGGTAGACAG
GCCGTTTGCAGTCAAATATGACCCATATACTCAAACGGTTGAAGTATTGG
ATAAAAACTCTCAAATTAAACAATTAATGATTTCGTTAAAGGATGACTTC
AACGTTCTTGAAGAAGCATTAAATAAATTAATTTAATAAAAGAAATTAAA
AATCTAATTACAACATTTATTTAGGAATATATATTTTGGTTAAT
back to top

protein sequence of SMED30004098-orf-1

>SMED30004098-orf-1 ID=SMED30004098-orf-1|Name=SMED30004098-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=442bp
MNKEEGGGTLGYYVEDFPDKEGNTTILITASSKIGSLASILEIFKKNHVN
LLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQGLSLEVQVLSRQH
DNLKGDVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQF
ADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFP
LLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFR
VFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASL
GASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDE
PKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFA
VKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALNKLI*
back to top

protein sequence of SMED30004098-orf-2

>SMED30004098-orf-2 ID=SMED30004098-orf-2|Name=SMED30004098-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=159bp
MMAIENLQGLSLEVQVLSRQHDNLKGDVPWFPRKIKDLDRFANQILSYGS
ELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTV
FDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGF
TLRPVAGLL
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000421tail
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036951ArAA_hydroxylase_sf
IPR005961Phe-4-hydroxylase_tetra
IPR041912Euk_PheOH_cat
IPR036329Aro-AA_hydroxylase_C_sf
IPR019774Aromatic-AA_hydroxylase_C
IPR019773Tyrosine_3-monooxygenase-like
IPR001273ArAA_hydroxylase
IPR018301ArAA_hydroxylase_Fe/CU_BS
IPR002912ACT_dom
Vocabulary: biological process
TermDefinition
GO:0006559L-phenylalanine catabolic process
GO:0055114oxidation-reduction process
GO:0009072aromatic amino acid family metabolic process
GO:0008152metabolic process
GO:0042427serotonin biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0004505phenylalanine 4-monooxygenase activity
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0004497monooxygenase activity
GO:0005506iron ion binding
GO:0016597amino acid binding
GO:0004510tryptophan 5-monooxygenase activity
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 86..106
NoneNo IPR availablePANTHERPTHR11473:SF24PHENYLALANINE-4-HYDROXYLASEcoord: 13..440
NoneNo IPR availableSUPERFAMILYSSF55021ACT-likecoord: 19..113
IPR019774Aromatic amino acid hydroxylase, C-terminalPRINTSPR00372FYWHYDRXLASEcoord: 291..310
score: 87.17
coord: 362..381
score: 52.39
coord: 397..415
score: 63.16
coord: 136..155
score: 70.87
coord: 227..249
score: 81.66
coord: 331..349
score: 71.62
IPR019774Aromatic amino acid hydroxylase, C-terminalPFAMPF00351Biopterin_Hcoord: 108..437
e-value: 1.6E-173
score: 576.4
IPR019774Aromatic amino acid hydroxylase, C-terminalPROSITEPS51410BH4_AAA_HYDROXYL_2coord: 95..441
score: 141.367
IPR036951Aromatic amino acid hydroxylase superfamilyGENE3DG3DSA:1.10.800.10coord: 10..418
e-value: 6.6E-188
score: 626.3
IPR005961Phenylalanine-4-hydroxylase, tetrameric formTIGRFAMTIGR01268TIGR01268coord: 13..440
e-value: 1.5E-217
score: 720.5
IPR019773Tyrosine 3-monooxygenase-likePIRSFPIRSF000336THcoord: 10..441
e-value: 5.2E-205
score: 679.3
IPR001273Aromatic amino acid hydroxylasePANTHERPTHR11473AROMATIC AMINO ACID HYDROXYLASEcoord: 13..440
IPR018301Aromatic amino acid hydroxylase, iron/copper binding sitePROSITEPS00367BH4_AAA_HYDROXYL_1coord: 270..281
IPR002912ACT domainPROSITEPS51671ACTcoord: 25..98
score: 13.354
IPR041912Eukaryotic phenylalanine-4-hydroxylase, catalytic domainCDDcd03347eu_PheOHcoord: 108..413
e-value: 0.0
score: 616.765
IPR036329Aromatic amino acid monoxygenase, C-terminal domain superfamilySUPERFAMILYSSF56534Aromatic aminoacid monoxygenases, catalytic and oligomerization domainscoord: 106..440