NIPSNAP domain-containing protein

Overview
NameNIPSNAP domain-containing protein
Smed IDSMED30004082
Length (bp)950
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NIPSNAP domain-containing protein (SMED30004082) t-SNE clustered cells

Violin plots show distribution of expression levels for NIPSNAP domain-containing protein (SMED30004082) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NIPSNAP domain-containing protein (SMED30004082) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NIPSNAP domain-containing protein (SMED30004082) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004082

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30004082SMESG000043687.1 dd_Smed_v4_2078_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004082SMESG000043687.1 dd_Smed_v4_2078_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004082SMESG000043687.1 dd_Smed_v4_2078_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004082SMESG000043687.1 dd_Smed_v4_2078_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004082SMESG000043687.1 Contig44461newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004082SMESG000043687.1 Contig44461uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004082SMESG000043687.1 Contig47137newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004082SMESG000043687.1 Contig47137uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30004082SMESG000043687.1 OX_Smed_1.0.23423ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NIPSNAP domain-containing protein vs. Ensembl Human
Match: NIPSNAP1 (nipsnap homolog 1 [Source:HGNC Symbol;Acc:HGNC:7827])

HSP 1 Score: 233.417 bits (594), Expect = 5.179e-75
Identity = 118/256 (46.09%), Postives = 165/256 (64.45%), Query Frame = 2
Query:   77 RCFSTGNDNKWFGNLFVRKLDSVHESQSDLLAK--SSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTK-----QSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            R +S  N+  WF +LFV K+D   ++ S LL+K  +S LY+   HNVKP    EYL  Y    E +  K          L+G+W T  GEQD A HLWRF   +P L       +++ ++ EFR+ R++ML  R+NQ+L  FS+W E QPR   + I+ELR+Y LKPGTMIEWGN+WAR I+ R+++ E + G F+ +G++++VHH+WAYKDL+ R++ RN AWR  GWDE V +TVPL+RHM S I+   K SP+
Sbjct:   33 RFYSKDNEGSWFRSLFVHKVDPRKDAHSTLLSKKETSNLYKIQFHNVKP----EYLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLKNNKEYLEFRRERSQMLLSRRNQLLLEFSFWNEPQPRMGPN-IYELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGELYVVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKISPL 283          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Human
Match: NIPSNAP2 (nipsnap homolog 2 [Source:HGNC Symbol;Acc:HGNC:4179])

HSP 1 Score: 223.787 bits (569), Expect = 3.385e-71
Identity = 114/245 (46.53%), Postives = 158/245 (64.49%), Query Frame = 2
Query:   98 DNKWFGNLFVRKLDSVHESQSDLLAK--SSTLYEFHIHNVKPAYMSEYLADYARYNEMI-KTKQSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            ++ W  +LFVRK+D   ++ S+LLAK  +S LY+   HNVKP  +  Y          I + K     L+G+W T  GEQD A HLWR++  +P L +     R + +F EFRK R++ML  RKNQ+L  FS+W E  PR S  +I+ELRSY L+PGTMIEWGN+WAR IR R+  +E + G F+ +G ++MVHH+WAY+DL+ R+ +RN AW   GW+E V +TVPLI+ M S I+   K SP+
Sbjct:   42 EDSWLKSLFVRKVDPRKDAHSNLLAKKETSNLYKLQFHNVKPECLEAYNKICQEVLPKIHEDKHYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEVMNKLRENKEFLEFRKARSDMLLSRKNQLLLEFSFWNEPVPR-SGPNIYELRSYQLRPGTMIEWGNYWARAIRFRQDGNEAVGGFFSQIGQLYMVHHLWAYRDLQTREDIRNAAWHKHGWEELVYYTVPLIQEMESRIMIPLKTSPL 285          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Human
Match: NIPSNAP2 (nipsnap homolog 2 [Source:HGNC Symbol;Acc:HGNC:4179])

HSP 1 Score: 172.17 bits (435), Expect = 1.206e-51
Identity = 97/243 (39.92%), Postives = 139/243 (57.20%), Query Frame = 2
Query:   98 DNKWFGNLFVRKLDSVHESQSDLLAK--SSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTKQSGAELMGSWTTEIGEQDTAYHLWRFKDFPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            ++ W  +LFVRK+D   ++ S+LLAK  +S LY+                   R+ ++  T      L+  W   +G +  A                   R+  +F EFRK R++ML  RKNQ+L  FS+W E  PR S  +I+ELRSY L+PGTMIEWGN+WAR IR R+  +E + G F+ +G ++MVHH+WAY+DL+ R+ +RN AW   GW+E V +TVPLI+ M S I+   K SP+
Sbjct:   42 EDSWLKSLFVRKVDPRKDAHSNLLAKKETSNLYKLQFKRC-----------CQRFTKINTT------LVLWWG--LGTRGMAS------------------RTKLEFLEFRKARSDMLLSRKNQLLLEFSFWNEPVPR-SGPNIYELRSYQLRPGTMIEWGNYWARAIRFRQDGNEAVGGFFSQIGQLYMVHHLWAYRDLQTREDIRNAAWHKHGWEELVYYTVPLIQEMESRIMIPLKTSPL 246          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Human
Match: NIPSNAP1 (nipsnap homolog 1 [Source:HGNC Symbol;Acc:HGNC:7827])

HSP 1 Score: 137.887 bits (346), Expect = 9.940e-39
Identity = 77/175 (44.00%), Postives = 105/175 (60.00%), Query Frame = 2
Query:   83 FSTGNDNKWFGNLFVRKLDSVHESQSDLLAK--SSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTK-----QSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHW 583
            +S  N+  WF +LFV K+D   ++ S LL+K  +S LY+   HNVKP    EYL  Y    E +  K          L+G+W T  GEQD A HLWRF   +P L       +++ ++ EFR+ R++ML  R+NQ+L  FS+W E QPR   + I+ELR+Y LKPGTMIEWGN+W
Sbjct:   52 YSKDNEGSWFRSLFVHKVDPRKDAHSTLLSKKETSNLYKIQFHNVKP----EYLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLKNNKEYLEFRRERSQMLLSRRNQLLLEFSFWNEPQPRMGPN-IYELRTYKLKPGTMIEWGNNW 221          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Human
Match: NIPSNAP2 (nipsnap homolog 2 [Source:HGNC Symbol;Acc:HGNC:4179])

HSP 1 Score: 105.531 bits (262), Expect = 1.194e-27
Identity = 54/104 (51.92%), Postives = 70/104 (67.31%), Query Frame = 2
Query:  275 KQSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHW 583
            K     L+G+W T  GEQD A HLWR++  +P L +     R + +F EFRK R++ML  RKNQ+L  FS+W E  PR S  +I+ELRSY L+PGTMIEWGN+W
Sbjct:   12 KHYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEVMNKLRENKEFLEFRKARSDMLLSRKNQLLLEFSFWNEPVPR-SGPNIYELRSYQLRPGTMIEWGNYW 114          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Celegans
Match: K02D10.1 (Putative NipSnap protein K02D10.1 [Source:UniProtKB/Swiss-Prot;Acc:P34492])

HSP 1 Score: 175.252 bits (443), Expect = 9.997e-53
Identity = 87/226 (38.50%), Postives = 129/226 (57.08%), Query Frame = 2
Query:  149 ESQSDLLAKSSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTKQSGAELMGSWTTEIGE-QDTAYHLWRF-KDFPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            +S S LL+ S  +YEF  HN +P     YL  + +Y   +  K    EL+GSWT   G  +D A HLWR  K +  +D    L+  D+          ++   RKN I+  FSYW E + R   + +++LRSY L+PGTMI+W + WA+GI+ R++ ++ + G F  VG +++V+H+WAY  +  R   R+  W  PGWD  V +TVPLI+ M S IL  TK+S +
Sbjct:   64 QSHSSLLSNSELMYEFMTHNYRPGEQDAYLDAFGKYKNEMNQKNPSIELVGSWTCAYGRTRDQAIHLWRHNKGYEDVDSSISLHGKDSGIRAADNDVAKLCGRRKNLIVKSFSYWREPEQR-PPNHVYDLRSYVLQPGTMIDWASAWAKGIQYRREANQDVGGFFAQVGQLYVVYHIWAYPSMSGRNDTRHATWAKPGWDATVANTVPLIKKMQSKILTPTKYSQL 288          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Celegans
Match: K02D10.1 (Putative NipSnap protein K02D10.1 [Source:UniProtKB/Swiss-Prot;Acc:P34492])

HSP 1 Score: 175.252 bits (443), Expect = 9.997e-53
Identity = 87/226 (38.50%), Postives = 129/226 (57.08%), Query Frame = 2
Query:  149 ESQSDLLAKSSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTKQSGAELMGSWTTEIGE-QDTAYHLWRF-KDFPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            +S S LL+ S  +YEF  HN +P     YL  + +Y   +  K    EL+GSWT   G  +D A HLWR  K +  +D    L+  D+          ++   RKN I+  FSYW E + R   + +++LRSY L+PGTMI+W + WA+GI+ R++ ++ + G F  VG +++V+H+WAY  +  R   R+  W  PGWD  V +TVPLI+ M S IL  TK+S +
Sbjct:   64 QSHSSLLSNSELMYEFMTHNYRPGEQDAYLDAFGKYKNEMNQKNPSIELVGSWTCAYGRTRDQAIHLWRHNKGYEDVDSSISLHGKDSGIRAADNDVAKLCGRRKNLIVKSFSYWREPEQR-PPNHVYDLRSYVLQPGTMIDWASAWAKGIQYRREANQDVGGFFAQVGQLYVVYHIWAYPSMSGRNDTRHATWAKPGWDATVANTVPLIKKMQSKILTPTKYSQL 288          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Celegans
Match: K02D10.1 (Putative NipSnap protein K02D10.1 [Source:UniProtKB/Swiss-Prot;Acc:P34492])

HSP 1 Score: 175.252 bits (443), Expect = 1.831e-50
Identity = 87/224 (38.84%), Postives = 128/224 (57.14%), Query Frame = 2
Query:  149 ESQSDLLAKSSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTKQSGAELMGSWTTEIGE-QDTAYHLWRF-KDFPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFS 814
            +S S LL+ S  +YEF  HN +P     YL  + +Y   +  K    EL+GSWT   G  +D A HLWR  K +  +D    L+  D+          ++   RKN I+  FSYW E + R  +  +++LRSY L+PGTMI+W + WA+GI+ R++ ++ + G F  VG +++V+H+WAY  +  R   R+  W  PGWD  V +TVPLI+ M S IL  TK+S
Sbjct:  301 QSHSSLLSNSELMYEFMTHNYRPGEQDAYLDAFGKYKNEMNQKNPSIELVGSWTCAYGRTRDQAIHLWRHNKGYEDVDSSISLHGKDSGIRAADNDVAKLCGRRKNLIVKSFSYWREPEQRPPN-HVYDLRSYVLQPGTMIDWASAWAKGIQYRREANQDVGGFFAQVGQLYVVYHIWAYPSMSGRNDTRHATWAKPGWDATVANTVPLIKKMQSKILTPTKYS 523          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Fly
Match: Nipsnap (gene:FBgn0030724 transcript:FBtr0074259)

HSP 1 Score: 224.942 bits (572), Expect = 3.517e-72
Identity = 113/269 (42.01%), Postives = 162/269 (60.22%), Query Frame = 2
Query:   32 LR*MFKFIRLRNHFNRCFSTG---NDNK-WFGNLFVRKLDSVHESQSDLLAKSSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTKQS--GAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSP 817
            LR +    +  N+  R  ST    ND++ WF  L VRK++   ES S +L+    +Y  H HNV+P  M  YL +Y     +I  K++    EL+ SWT ++G+ D   HLW++   F  +D+      +D ++    + R++ L  R  Q L  FSYWP+I  R +  +I+E+RSY L PGTMIEWGN+WAR I  RK ++E  AG F+ +G ++ VHH+W YK L+ RK+ R  AWR+PGWDECV +TVPLIR M+  +L  T+FSP
Sbjct:    4 LRNLLAVGKSNNNAVRSLSTTPSRNDSESWFSKLLVRKIEPTKESHSRMLSDKEIIYALHTHNVRPDSMGSYLNNYKTTVALINEKKANLSCELVASWTVQVGDMDQCLHLWKYTGGFEKIDQAKEDLWNDPEYLSLMQERSKFLRSRHLQYLLAFSYWPQIASR-TGKNIYEMRSYRLTPGTMIEWGNNWARAINYRKHNNEAFAGFFSQIGRLYNVHHIWCYKSLQDRKETREAAWRSPGWDECVAYTVPLIREMHCRVLAPTEFSP 271          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Fly
Match: Nipsnap (gene:FBgn0030724 transcript:FBtr0343595)

HSP 1 Score: 224.942 bits (572), Expect = 3.517e-72
Identity = 113/269 (42.01%), Postives = 162/269 (60.22%), Query Frame = 2
Query:   32 LR*MFKFIRLRNHFNRCFSTG---NDNK-WFGNLFVRKLDSVHESQSDLLAKSSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTKQS--GAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSP 817
            LR +    +  N+  R  ST    ND++ WF  L VRK++   ES S +L+    +Y  H HNV+P  M  YL +Y     +I  K++    EL+ SWT ++G+ D   HLW++   F  +D+      +D ++    + R++ L  R  Q L  FSYWP+I  R +  +I+E+RSY L PGTMIEWGN+WAR I  RK ++E  AG F+ +G ++ VHH+W YK L+ RK+ R  AWR+PGWDECV +TVPLIR M+  +L  T+FSP
Sbjct:    4 LRNLLAVGKSNNNAVRSLSTTPSRNDSESWFSKLLVRKIEPTKESHSRMLSDKEIIYALHTHNVRPDSMGSYLNNYKTTVALINEKKANLSCELVASWTVQVGDMDQCLHLWKYTGGFEKIDQAKEDLWNDPEYLSLMQERSKFLRSRHLQYLLAFSYWPQIASR-TGKNIYEMRSYRLTPGTMIEWGNNWARAINYRKHNNEAFAGFFSQIGRLYNVHHIWCYKSLQDRKETREAAWRSPGWDECVAYTVPLIREMHCRVLAPTEFSP 271          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Fly
Match: Nipsnap (gene:FBgn0030724 transcript:FBtr0074257)

HSP 1 Score: 224.942 bits (572), Expect = 3.517e-72
Identity = 113/269 (42.01%), Postives = 162/269 (60.22%), Query Frame = 2
Query:   32 LR*MFKFIRLRNHFNRCFSTG---NDNK-WFGNLFVRKLDSVHESQSDLLAKSSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTKQS--GAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSP 817
            LR +    +  N+  R  ST    ND++ WF  L VRK++   ES S +L+    +Y  H HNV+P  M  YL +Y     +I  K++    EL+ SWT ++G+ D   HLW++   F  +D+      +D ++    + R++ L  R  Q L  FSYWP+I  R +  +I+E+RSY L PGTMIEWGN+WAR I  RK ++E  AG F+ +G ++ VHH+W YK L+ RK+ R  AWR+PGWDECV +TVPLIR M+  +L  T+FSP
Sbjct:    4 LRNLLAVGKSNNNAVRSLSTTPSRNDSESWFSKLLVRKIEPTKESHSRMLSDKEIIYALHTHNVRPDSMGSYLNNYKTTVALINEKKANLSCELVASWTVQVGDMDQCLHLWKYTGGFEKIDQAKEDLWNDPEYLSLMQERSKFLRSRHLQYLLAFSYWPQIASR-TGKNIYEMRSYRLTPGTMIEWGNNWARAINYRKHNNEAFAGFFSQIGRLYNVHHIWCYKSLQDRKETREAAWRSPGWDECVAYTVPLIREMHCRVLAPTEFSP 271          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Fly
Match: Nipsnap (gene:FBgn0030724 transcript:FBtr0074258)

HSP 1 Score: 224.942 bits (572), Expect = 3.517e-72
Identity = 113/269 (42.01%), Postives = 162/269 (60.22%), Query Frame = 2
Query:   32 LR*MFKFIRLRNHFNRCFSTG---NDNK-WFGNLFVRKLDSVHESQSDLLAKSSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTKQS--GAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSP 817
            LR +    +  N+  R  ST    ND++ WF  L VRK++   ES S +L+    +Y  H HNV+P  M  YL +Y     +I  K++    EL+ SWT ++G+ D   HLW++   F  +D+      +D ++    + R++ L  R  Q L  FSYWP+I  R +  +I+E+RSY L PGTMIEWGN+WAR I  RK ++E  AG F+ +G ++ VHH+W YK L+ RK+ R  AWR+PGWDECV +TVPLIR M+  +L  T+FSP
Sbjct:    4 LRNLLAVGKSNNNAVRSLSTTPSRNDSESWFSKLLVRKIEPTKESHSRMLSDKEIIYALHTHNVRPDSMGSYLNNYKTTVALINEKKANLSCELVASWTVQVGDMDQCLHLWKYTGGFEKIDQAKEDLWNDPEYLSLMQERSKFLRSRHLQYLLAFSYWPQIASR-TGKNIYEMRSYRLTPGTMIEWGNNWARAINYRKHNNEAFAGFFSQIGRLYNVHHIWCYKSLQDRKETREAAWRSPGWDECVAYTVPLIREMHCRVLAPTEFSP 271          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Zebrafish
Match: nipsnap1 (nipsnap homolog 1 (C. elegans) [Source:NCBI gene;Acc:30231])

HSP 1 Score: 225.328 bits (573), Expect = 3.531e-72
Identity = 114/253 (45.06%), Postives = 162/253 (64.03%), Query Frame = 2
Query:   77 RCFSTGNDNKWFGNLFVRKLDSVHESQSDLLAK--SSTLYEFHIHNVKPAYMSEY--LADYARYNEMIKTKQSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            R F+  +D  W  ++F  K+D+  ++ S+LL+K  +S LY+   HNVKP YM EY  L+D  +  E+        E++GSW T  GEQD A HLWR+   +P L +  R    +  +  FRK R++ML  R+NQ+L  FS+W E  PR S  +I+ELRSY L PGTMIEWGNHWAR I+ R++++E + G FT +GD+++VHH+WAYKDL+ R++ R  AW   GWD  V +T+PLI+ M S I+     SP+
Sbjct:   28 RGFANKSDEGWLSSMFAHKVDARKDAHSNLLSKKETSNLYKIQFHNVKPEYMEEYNKLSDEVQ-KELHHDTDYPCEVVGSWNTWYGEQDQAVHLWRYSGGYPALTECLRKLNLNTAYLAFRKERSKMLLSRRNQLLLEFSFWNEPVPR-SGSNIYELRSYQLLPGTMIEWGNHWARAIKYRQENNEAVGGFFTQIGDLYVVHHLWAYKDLQSREETRKAAWEKEGWDVSVHYTMPLIQKMESRIMIPMVHSPL 278          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Zebrafish
Match: nipsnap2 (pep chromosome:GRCz11:15:404891:413541:1 gene:ENSDARG00000007264.11 transcript:ENSDART00000155682.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:nipsnap2)

HSP 1 Score: 164.851 bits (416), Expect = 1.302e-48
Identity = 92/219 (42.01%), Postives = 129/219 (58.90%), Query Frame = 2
Query:  191 EFHIHNVKPAYMSEYLADYARYNEMIKT-----KQSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYF---RKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            +  IHNVKP    E L  Y +  E + T     K    EL+G+W T  GEQD A HLWR++  +P L +     +++   + +      ML+    R+N +    SY   I  R  +  +F L S+ LKPGTMIEWGN+WAR I  R+ + E + G F+ +GD++MVHH+WAYKDL+ R+  RN AW++ GWDE V +TVPLI+HM S I+   K SP+
Sbjct:   72 QLQIHNVKP----ECLEAYNKLCEDVLTNIHTDKAYPCELVGTWNTWYGEQDQAVHLWRYRGGYPALTEVMSKLKNNKVIQHYYN--PNMLFLLSDRQNMLKHESSYITYIITR-DETELFILISFQLKPGTMIEWGNYWARAIGYRQHNREAVGGFFSQIGDLYMVHHLWAYKDLQSREDTRNAAWQHEGWDEVVYYTVPLIQHMESRIMIPLKNSPL 283          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Zebrafish
Match: nipsnap3a (nipsnap homolog 3A (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-040426-1037])

HSP 1 Score: 72.4034 bits (176), Expect = 3.147e-14
Identity = 47/216 (21.76%), Postives = 96/216 (44.44%), Query Frame = 2
Query:  182 TLYEFHIHNVKPAYMSEYLADYARYNEMIKTKQSGAELMGSWTTEIGEQDTAYHLWRFKDFPILDKHYRLYRSDADF-EEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHW--ARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            T YEF  + ++P   + +L      NE I+ + + +EL+G WT E G  +  +H+W++  +            D  + E++  +   ML  + N++ +    W +IQ    +  +FEL ++ +K G    WG  +  A G      ++  +    +  G ++ VH +W Y+  + R  +R+ +  +      V  +   +    + ++    FSPI
Sbjct:   60 TFYEFRTYYIQPHLNAAFLK---LTNEKIQLRTAHSELIGYWTVEYGGLNQVFHIWKYDSYAQRASVRAALAQDPSWNEQYISKAMPMLSSQDNEVTY-LVPWSKIQKPPKEGGVFELATFQMKSGGPAVWGKAFQAAVGTHTGSGYAHSVGVFHSEFGQLNQVHVLWWYESADQRAAVRHTSHEDARVVAAVRESALYLVAQKNKLMFPCSFSPI 271          

HSP 2 Score: 52.373 bits (124), Expect = 2.086e-7
Identity = 31/132 (23.48%), Postives = 58/132 (43.94%), Query Frame = 2
Query:  428 RRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDE-CVLHTVPLIRHMNSNILRATKFSPI 820
            R  E     KN++  P + W    P+Q   + +E R+Y ++P     +       I++R  HSE I       G ++ V H+W Y     R  +R    ++P W+E  +   +P++   ++ +     +S I
Sbjct:   30 RHAERCLTVKNRLTQPSAAWITTGPQQQHGTFYEFRTYYIQPHLNAAFLKLTNEKIQLRTAHSELIGYWTVEYGGLNQVFHIWKYDSYAQRASVRAALAQDPSWNEQYISKAMPMLSSQDNEVTYLVPWSKI 161          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Xenopus
Match: nipsnap2 (nipsnap homolog 2 [Source:NCBI gene;Acc:733910])

HSP 1 Score: 234.187 bits (596), Expect = 1.864e-75
Identity = 121/254 (47.64%), Postives = 160/254 (62.99%), Query Frame = 2
Query:   83 FSTGNDNKWFGNLFVRKLDSVHESQSDLLAKS--STLYEFHIHNVKPAYMSEYLADYARYNEMIKTKQSGAE-----LMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            +S   ++ W  +LFVRK+D   ++ S+LLAK   S LY+   HNVKP    E L  Y +  E +  K    E     L+G+W T  GEQD A HLW+++  +P L +     R + +F EFRK R  ML  RKNQ+L  FS+W E  PR   + I+ELRSY L+PGTMIEWGNHWAR IR R+   E +AG F+ +G ++MVHH+WAYKDL+ R  +RN AW+  GWDECV +TVPLI+ M S I+   K SP+
Sbjct:   28 YSKAREDSWLRSLFVRKVDPRKDAHSNLLAKKEISNLYKIQFHNVKP----ECLESYNKLCEEVLPKIHADEDYPCTLVGTWNTWYGEQDQAVHLWKYEGGYPALTEVMSKLRKNKEFTEFRKARGNMLLSRKNQLLLEFSFWNEPVPRNGPN-IYELRSYQLRPGTMIEWGNHWARAIRYRQDGDEAVAGFFSQIGHLYMVHHLWAYKDLQTRDDIRNSAWQKDGWDECVYYTVPLIQEMESRIMIPLKSSPL 276          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Xenopus
Match: nipsnap2 (nipsnap homolog 2 [Source:NCBI gene;Acc:733910])

HSP 1 Score: 232.646 bits (592), Expect = 9.221e-75
Identity = 120/251 (47.81%), Postives = 158/251 (62.95%), Query Frame = 2
Query:   92 GNDNKWFGNLFVRKLDSVHESQSDLLAKS--STLYEFHIHNVKPAYMSEYLADYARYNEMIKTKQSGAE-----LMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
              ++ W  +LFVRK+D   ++ S+LLAK   S LY+   HNVKP    E L  Y +  E +  K    E     L+G+W T  GEQD A HLW+++  +P L +     R + +F EFRK R  ML  RKNQ+L  FS+W E  PR   + I+ELRSY L+PGTMIEWGNHWAR IR R+   E +AG F+ +G ++MVHH+WAYKDL+ R  +RN AW+  GWDECV +TVPLI+ M S I+   K SP+
Sbjct:   36 AREDSWLRSLFVRKVDPRKDAHSNLLAKKEISNLYKIQFHNVKP----ECLESYNKLCEEVLPKIHADEDYPCTLVGTWNTWYGEQDQAVHLWKYEGGYPALTEVMSKLRKNKEFTEFRKARGNMLLSRKNQLLLEFSFWNEPVPRNGPN-IYELRSYQLRPGTMIEWGNHWARAIRYRQDGDEAVAGFFSQIGHLYMVHHLWAYKDLQTRDDIRNSAWQKDGWDECVYYTVPLIQEMESRIMIPLKSSPL 281          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Xenopus
Match: mgat2 (mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [Source:Xenbase;Acc:XB-GENE-978789])

HSP 1 Score: 222.631 bits (566), Expect = 5.104e-71
Identity = 116/258 (44.96%), Postives = 166/258 (64.34%), Query Frame = 2
Query:   80 CFSTGNDNK---WFGNLFVRKLDSVHESQSDLLAK--SSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTK-----QSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            CF  G+D++   W  +LFVRK+D   ++ S LL+K  +S LY+   HNVKP    E L +Y R  E +  K         +L+G+W T  GEQD A HLWRF   +P L       R++ ++  FR+ R++ML  R+NQ+L  FS+W E  PR+  + I+ELR+Y LKPGTMIEWGN+WAR I+ R+++ E + G F+ +G++++VHH+WAYKDLE R++ R  AW   GWDE V +TVPL+R+M S I+   K SP+
Sbjct:   20 CFRYGSDSRDSSWLRSLFVRKVDPRKDAHSTLLSKKETSGLYKMQFHNVKP----ECLEEYNRLTEEVLPKLHHDPDYHCDLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLRNNKEYLAFREERSKMLLSRRNQLLLEFSFWNEPAPRKGPN-IYELRTYRLKPGTMIEWGNNWARAIKHRQENQEAVGGFFSQIGELYVVHHLWAYKDLESREETRKAAWTKRGWDENVYYTVPLVRNMESRIMIPLKISPL 272          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Xenopus
Match: mgat2 (mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [Source:Xenbase;Acc:XB-GENE-978789])

HSP 1 Score: 221.861 bits (564), Expect = 3.332e-70
Identity = 114/253 (45.06%), Postives = 162/253 (64.03%), Query Frame = 2
Query:   86 STGNDNKWFGNLFVRKLDSVHESQSDLLAK--SSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTK-----QSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            S   D+ W  +LFVRK+D   ++ S LL+K  +S LY+   HNVKP    E L +Y R  E +  K         +L+G+W T  GEQD A HLWRF   +P L       R++ ++  FR+ R++ML  R+NQ+L  FS+W E  PR+  + I+ELR+Y LKPGTMIEWGN+WAR I+ R+++ E + G F+ +G++++VHH+WAYKDLE R++ R  AW   GWDE V +TVPL+R+M S I+   K SP+
Sbjct:   65 SDSRDSSWLRSLFVRKVDPRKDAHSTLLSKKETSGLYKMQFHNVKP----ECLEEYNRLTEEVLPKLHHDPDYHCDLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLRNNKEYLAFREERSKMLLSRRNQLLLEFSFWNEPAPRKGPN-IYELRTYRLKPGTMIEWGNNWARAIKHRQENQEAVGGFFSQIGELYVVHHLWAYKDLESREETRKAAWTKRGWDENVYYTVPLVRNMESRIMIPLKISPL 312          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Xenopus
Match: mgat2 (mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [Source:Xenbase;Acc:XB-GENE-978789])

HSP 1 Score: 220.32 bits (560), Expect = 3.377e-70
Identity = 115/256 (44.92%), Postives = 163/256 (63.67%), Query Frame = 2
Query:   77 RCFSTGNDNKWFGNLFVRKLDSVHESQSDLLAK--SSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTK-----QSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            R  S   D+ W  +LFVRK+D   ++ S LL+K  +S LY+   HNVKP    E L +Y R  E +  K         +L+G+W T  GEQD A HLWRF   +P L       R++ ++  FR+ R++ML  R+NQ+L  FS+W E  PR+  + I+ELR+Y LKPGTMIEWGN+WAR I+ R+++ E + G F+ +G++++VHH+WAYKDLE R++ R  AW   GWDE V +TVPL+R+M S I+   K SP+
Sbjct:   19 RYGSDSRDSSWLRSLFVRKVDPRKDAHSTLLSKKETSGLYKMQFHNVKP----ECLEEYNRLTEEVLPKLHHDPDYHCDLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLRNNKEYLAFREERSKMLLSRRNQLLLEFSFWNEPAPRKGPN-IYELRTYRLKPGTMIEWGNNWARAIKHRQENQEAVGGFFSQIGELYVVHHLWAYKDLESREETRKAAWTKRGWDENVYYTVPLVRNMESRIMIPLKISPL 269          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Mouse
Match: Nipsnap1 (nipsnap homolog 1 [Source:MGI Symbol;Acc:MGI:1278344])

HSP 1 Score: 229.565 bits (584), Expect = 1.105e-73
Identity = 117/256 (45.70%), Postives = 165/256 (64.45%), Query Frame = 2
Query:   77 RCFSTGNDNKWFGNLFVRKLDSVHESQSDLLAK--SSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTK-----QSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            R +S  ++  WF +LFV K+D   ++ S LL+K  +S LY+   HNVKP    E L  Y    E +  K          L+G+W T  GEQD A HLWRF   +P L       +++ ++ EFRK R++ML  R+NQ+L  FS+W E QPR +  +I+ELR+Y LKPGTMIEWGN+WAR I+ R+++ E + G F+ +G++++VHH+WAYKDL+ R++ RN AWR  GWDE V +TVPL+RHM S I+   K SP+
Sbjct:   33 RFYSKDSEGSWFRSLFVHKVDPRKDAHSTLLSKKETSNLYKIQFHNVKP----ECLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLKNNKEYLEFRKERSKMLLSRRNQLLLEFSFWNEPQPR-AGPNIYELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGELYVVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKISPL 283          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Mouse
Match: Nipsnap2 (nipsnap homolog 2 [Source:MGI Symbol;Acc:MGI:1278343])

HSP 1 Score: 223.402 bits (568), Expect = 2.173e-71
Identity = 113/245 (46.12%), Postives = 158/245 (64.49%), Query Frame = 2
Query:   98 DNKWFGNLFVRKLDSVHESQSDLLAK--SSTLYEFHIHNVKPAYMSEYLADYARYNEMI-KTKQSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            ++ W  +LFVRK+D   ++ S+LLAK  +S+LY+   HNVKP  +  Y          I + KQ    L+G+W T  GEQD A HLWR++  +P L +     + + +F  FRK R++ML  RKNQ+L  FS+W E  PR   + I+ELRSY L+PGTMIEWGN+WAR IR R+  +E + G F+ +G ++MVHH+WAYKDL+ R+ +RN AW   GW+E V +TVPLI+ M S I+   K SP+
Sbjct:   37 EDSWLKSLFVRKVDPRKDAHSNLLAKKETSSLYKLQFHNVKPECLDAYNKICQEVLPKIHEGKQYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEVMNKLKENQEFVNFRKARSDMLLSRKNQLLLEFSFWNEPVPRPGPN-IYELRSYQLRPGTMIEWGNYWARAIRFRQDSNEAVGGFFSQIGQLYMVHHLWAYKDLQTREDIRNAAWHKHGWEELVYYTVPLIQEMESRIMIPLKTSPL 280          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Mouse
Match: Nipsnap2 (nipsnap homolog 2 [Source:MGI Symbol;Acc:MGI:1278343])

HSP 1 Score: 223.402 bits (568), Expect = 2.173e-71
Identity = 113/245 (46.12%), Postives = 158/245 (64.49%), Query Frame = 2
Query:   98 DNKWFGNLFVRKLDSVHESQSDLLAK--SSTLYEFHIHNVKPAYMSEYLADYARYNEMI-KTKQSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            ++ W  +LFVRK+D   ++ S+LLAK  +S+LY+   HNVKP  +  Y          I + KQ    L+G+W T  GEQD A HLWR++  +P L +     + + +F  FRK R++ML  RKNQ+L  FS+W E  PR   + I+ELRSY L+PGTMIEWGN+WAR IR R+  +E + G F+ +G ++MVHH+WAYKDL+ R+ +RN AW   GW+E V +TVPLI+ M S I+   K SP+
Sbjct:   37 EDSWLKSLFVRKVDPRKDAHSNLLAKKETSSLYKLQFHNVKPECLDAYNKICQEVLPKIHEGKQYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEVMNKLKENQEFVNFRKARSDMLLSRKNQLLLEFSFWNEPVPRPGPN-IYELRSYQLRPGTMIEWGNYWARAIRFRQDSNEAVGGFFSQIGQLYMVHHLWAYKDLQTREDIRNAAWHKHGWEELVYYTVPLIQEMESRIMIPLKTSPL 280          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Mouse
Match: Nipsnap2 (nipsnap homolog 2 [Source:MGI Symbol;Acc:MGI:1278343])

HSP 1 Score: 223.402 bits (568), Expect = 2.173e-71
Identity = 113/245 (46.12%), Postives = 158/245 (64.49%), Query Frame = 2
Query:   98 DNKWFGNLFVRKLDSVHESQSDLLAK--SSTLYEFHIHNVKPAYMSEYLADYARYNEMI-KTKQSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            ++ W  +LFVRK+D   ++ S+LLAK  +S+LY+   HNVKP  +  Y          I + KQ    L+G+W T  GEQD A HLWR++  +P L +     + + +F  FRK R++ML  RKNQ+L  FS+W E  PR   + I+ELRSY L+PGTMIEWGN+WAR IR R+  +E + G F+ +G ++MVHH+WAYKDL+ R+ +RN AW   GW+E V +TVPLI+ M S I+   K SP+
Sbjct:   37 EDSWLKSLFVRKVDPRKDAHSNLLAKKETSSLYKLQFHNVKPECLDAYNKICQEVLPKIHEGKQYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEVMNKLKENQEFVNFRKARSDMLLSRKNQLLLEFSFWNEPVPRPGPN-IYELRSYQLRPGTMIEWGNYWARAIRFRQDSNEAVGGFFSQIGQLYMVHHLWAYKDLQTREDIRNAAWHKHGWEELVYYTVPLIQEMESRIMIPLKTSPL 280          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Mouse
Match: Nipsnap1 (nipsnap homolog 1 [Source:MGI Symbol;Acc:MGI:1278344])

HSP 1 Score: 71.633 bits (174), Expect = 5.186e-15
Identity = 46/127 (36.22%), Postives = 67/127 (52.76%), Query Frame = 2
Query:   83 FSTGNDNKWFGNLFVRKLDSVHESQSDLLAK--SSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTK-----QSGAELMGSWTTEIGEQDTAYHLWRFK-DFPILDKHYRLYRSDADFEEFRKRRNE 439
            +S  ++  WF +LFV K+D   ++ S LL+K  +S LY+   HNVKP    E L  Y    E +  K          L+G+W T  GEQD A HLWRF   +P L       +++ ++ EFRK R++
Sbjct:   14 YSKDSEGSWFRSLFVHKVDPRKDAHSTLLSKKETSNLYKIQFHNVKP----ECLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLKNNKEYLEFRKERSK 136          
BLAST of NIPSNAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9BPW8|NIPS1_HUMAN (Protein NipSnap homolog 1 OS=Homo sapiens OX=9606 GN=NIPSNAP1 PE=1 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 2.487e-74
Identity = 118/256 (46.09%), Postives = 165/256 (64.45%), Query Frame = 2
Query:   77 RCFSTGNDNKWFGNLFVRKLDSVHESQSDLLAK--SSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTK-----QSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            R +S  N+  WF +LFV K+D   ++ S LL+K  +S LY+   HNVKP    EYL  Y    E +  K          L+G+W T  GEQD A HLWRF   +P L       +++ ++ EFR+ R++ML  R+NQ+L  FS+W E QPR   + I+ELR+Y LKPGTMIEWGN+WAR I+ R+++ E + G F+ +G++++VHH+WAYKDL+ R++ RN AWR  GWDE V +TVPL+RHM S I+   K SP+
Sbjct:   33 RFYSKDNEGSWFRSLFVHKVDPRKDAHSTLLSKKETSNLYKIQFHNVKP----EYLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLKNNKEYLEFRRERSQMLLSRRNQLLLEFSFWNEPQPRMGPN-IYELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGELYVVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKISPL 283          
BLAST of NIPSNAP domain-containing protein vs. UniProt/SwissProt
Match: sp|O55125|NIPS1_MOUSE (Protein NipSnap homolog 1 OS=Mus musculus OX=10090 GN=Nipsnap1 PE=1 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 7.730e-73
Identity = 117/256 (45.70%), Postives = 165/256 (64.45%), Query Frame = 2
Query:   77 RCFSTGNDNKWFGNLFVRKLDSVHESQSDLLAK--SSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTK-----QSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            R +S  ++  WF +LFV K+D   ++ S LL+K  +S LY+   HNVKP    E L  Y    E +  K          L+G+W T  GEQD A HLWRF   +P L       +++ ++ EFRK R++ML  R+NQ+L  FS+W E QPR +  +I+ELR+Y LKPGTMIEWGN+WAR I+ R+++ E + G F+ +G++++VHH+WAYKDL+ R++ RN AWR  GWDE V +TVPL+RHM S I+   K SP+
Sbjct:   33 RFYSKDSEGSWFRSLFVHKVDPRKDAHSTLLSKKETSNLYKIQFHNVKP----ECLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLKNNKEYLEFRKERSKMLLSRRNQLLLEFSFWNEPQPR-AGPNIYELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGELYVVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKISPL 283          
BLAST of NIPSNAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VXK0|NIPSN_DROME (Protein NipSnap OS=Drosophila melanogaster OX=7227 GN=Nipsnap PE=2 SV=2)

HSP 1 Score: 224.942 bits (572), Expect = 3.526e-71
Identity = 113/269 (42.01%), Postives = 162/269 (60.22%), Query Frame = 2
Query:   32 LR*MFKFIRLRNHFNRCFSTG---NDNK-WFGNLFVRKLDSVHESQSDLLAKSSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTKQS--GAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSP 817
            LR +    +  N+  R  ST    ND++ WF  L VRK++   ES S +L+    +Y  H HNV+P  M  YL +Y     +I  K++    EL+ SWT ++G+ D   HLW++   F  +D+      +D ++    + R++ L  R  Q L  FSYWP+I  R +  +I+E+RSY L PGTMIEWGN+WAR I  RK ++E  AG F+ +G ++ VHH+W YK L+ RK+ R  AWR+PGWDECV +TVPLIR M+  +L  T+FSP
Sbjct:    4 LRNLLAVGKSNNNAVRSLSTTPSRNDSESWFSKLLVRKIEPTKESHSRMLSDKEIIYALHTHNVRPDSMGSYLNNYKTTVALINEKKANLSCELVASWTVQVGDMDQCLHLWKYTGGFEKIDQAKEDLWNDPEYLSLMQERSKFLRSRHLQYLLAFSYWPQIASR-TGKNIYEMRSYRLTPGTMIEWGNNWARAINYRKHNNEAFAGFFSQIGRLYNVHHIWCYKSLQDRKETREAAWRSPGWDECVAYTVPLIREMHCRVLAPTEFSP 271          
BLAST of NIPSNAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9PU58|NIPS2_DANRE (Protein NipSnap homolog 2 OS=Danio rerio OX=7955 GN=nipsnap2 PE=2 SV=2)

HSP 1 Score: 225.328 bits (573), Expect = 3.977e-71
Identity = 116/249 (46.59%), Postives = 161/249 (64.66%), Query Frame = 2
Query:   98 DNKWFGNLFVRKLDSVHESQSDLLAKS--STLYEFHIHNVKPAYMSEYLADYARYNEMIKT-----KQSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            ++ WF +LFVRK+D   ++ S LLAK   + LY+   HNVKP    E L  Y +  E + T     K    EL+G+W T  GEQD A HLWR++  +P L +     +++ +F E+R  R +ML  R+NQ+L  FS+W E  PR   + I+ELRSY L+PGTMIEWGN+WAR I  R+ + E + G F+ +GD++MVHH+WAYKDL+ R+  RN AW++ GWDE V +TVPLI+HM S I+   K SP+
Sbjct:   42 EDSWFKSLFVRKVDPRKDAHSHLLAKKEDNNLYKIQFHNVKP----ECLEAYNKLCEDVLTNIHTDKAYPCELVGTWNTWYGEQDQAVHLWRYRGGYPALTEVMSKLKNNKEFLEYRSERGKMLLSRRNQLLLEFSFWNEPVPRDGPN-IYELRSYQLRPGTMIEWGNYWARAIGYRQHNREAVGGFFSQIGDLYMVHHLWAYKDLQSREDTRNAAWQHEGWDEVVYYTVPLIQHMESRIMIPLKNSPL 285          
BLAST of NIPSNAP domain-containing protein vs. UniProt/SwissProt
Match: sp|O75323|NIPS2_HUMAN (Protein NipSnap homolog 2 OS=Homo sapiens OX=9606 GN=NIPSNAP2 PE=1 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 1.625e-70
Identity = 114/245 (46.53%), Postives = 158/245 (64.49%), Query Frame = 2
Query:   98 DNKWFGNLFVRKLDSVHESQSDLLAK--SSTLYEFHIHNVKPAYMSEYLADYARYNEMI-KTKQSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            ++ W  +LFVRK+D   ++ S+LLAK  +S LY+   HNVKP  +  Y          I + K     L+G+W T  GEQD A HLWR++  +P L +     R + +F EFRK R++ML  RKNQ+L  FS+W E  PR S  +I+ELRSY L+PGTMIEWGN+WAR IR R+  +E + G F+ +G ++MVHH+WAY+DL+ R+ +RN AW   GW+E V +TVPLI+ M S I+   K SP+
Sbjct:   42 EDSWLKSLFVRKVDPRKDAHSNLLAKKETSNLYKLQFHNVKPECLEAYNKICQEVLPKIHEDKHYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEVMNKLRENKEFLEFRKARSDMLLSRKNQLLLEFSFWNEPVPR-SGPNIYELRSYQLRPGTMIEWGNYWARAIRFRQDGNEAVGGFFSQIGQLYMVHHLWAYRDLQTREDIRNAAWHKHGWEELVYYTVPLIQEMESRIMIPLKTSPL 285          
BLAST of NIPSNAP domain-containing protein vs. TrEMBL
Match: A0A4S2LSE9 (NIPSNAP domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006414 PE=4 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 2.189e-90
Identity = 132/254 (51.97%), Postives = 178/254 (70.08%), Query Frame = 2
Query:   62 RNHFNRCFSTGND--NKWFGNLFVRKLDSVHESQSDLLAKSSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTKQSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFS 814
            ++ F R  ST +D  + W  ++  R  DS  ESQS LL+ + T++E   H VKP +M EYL +   +  ++    S +EL+GSWT EIG QDTAYHLWR+   +P L +H  +YRS  +  E R RRN ML+ RKN+I   FS+WP+  PR  +++I+ELRSY LKPGTMIEWGNHWARG+R+R +  EP+AGLF+H+G++H VHH+WAY  LE R+K R++ W++P W +CV+HTVPLIR M SNILR T FS
Sbjct:   26 KSCFRRWASTKHDRGDSWLASMLGRS-DS-KESQSGLLSNTVTIFELQTHVVKPQFMCEYLKEMEHFVNVLSKTDSNSELLGSWTCEIGFQDTAYHLWRYSSGYPGLSQHTEIYRSHKELTESRHRRNVMLHTRKNEICLTFSFWPDPTPRPDENNIYELRSYALKPGTMIEWGNHWARGLRLRSKQREPVAGLFSHIGELHQVHHLWAYNSLEARQKSRDDTWQDPDWSKCVMHTVPLIRRMTSNILRPTPFS 277          
BLAST of NIPSNAP domain-containing protein vs. TrEMBL
Match: A0A074YZ70 (NIPSNAP domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_11374 PE=4 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 2.362e-90
Identity = 131/254 (51.57%), Postives = 178/254 (70.08%), Query Frame = 2
Query:   62 RNHFNRCFSTGND--NKWFGNLFVRKLDSVHESQSDLLAKSSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTKQSGAELMGSWTTEIGEQDTAYHLWRFK-DFPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFS 814
            ++ F R  ST +D  + W  ++  R  DS  ESQS LL+ + T++E   H VKP +M EYL +   +  ++    S +EL+GSWT EIG QDTAYHLW++   +P L +H  +YRS  +  E R RRN ML+ RKN+I   FS+WP+  PR  +++I+ELRSY LKPGTMIEWGNHWARG+R+R +  EP+AGLF+H+G++H VHH+WAY  LE R+K R++ W++P W +CV+HTVPLIR M SNILR T FS
Sbjct:   26 KSFFKRWASTKHDRGDSWLASMLSRS-DS-KESQSGLLSNTVTIFELQTHVVKPQFMCEYLKEMEHFVNVLSKTDSNSELLGSWTCEIGFQDTAYHLWKYSAGYPGLSQHTEIYRSHKELTESRHRRNVMLHTRKNEICLTFSFWPDPTPRPDENNIYELRSYALKPGTMIEWGNHWARGLRLRSKQREPVAGLFSHIGELHQVHHLWAYSSLEARQKSRDDTWQDPDWSKCVMHTVPLIRRMTSNILRPTPFS 277          
BLAST of NIPSNAP domain-containing protein vs. TrEMBL
Match: R7TLM6 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_179650 PE=4 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 3.530e-88
Identity = 126/240 (52.50%), Postives = 169/240 (70.42%), Query Frame = 2
Query:  107 WFGNLF-VRKLDSVHESQSDLLAKSSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTKQSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            WF  L  +RK+D   ES S LLA   T+YE  IH+VKP +M +YL +Y  +   +  K++GA+L GSWT EIG+QD A HLW++   +P+L++  R  R++ +F +FR  RN+ML  R+NQIL  FS+W + Q R   + I+ELRSY LKPGTMIEWGN+WARGI+ R++ +E +AG F+ +GD++ VHH+WAY+ LE RK  R  AWR PGWD CV HTVPLIRHM + IL  T FSP+
Sbjct:   31 WFQRLLPIRKIDPGTESHSSLLADKDTVYELQIHSVKPEFMEKYLGEYETFVNRVHNKETGAQLAGSWTVEIGDQDEAIHLWKYSGGYPVLNRSKRTLRTEKEFVDFRISRNKMLRSRRNQILLAFSFWGDPQVRDGSN-IYELRSYVLKPGTMIEWGNNWARGIKTRREKNEAVAGFFSQIGDLYNVHHLWAYESLESRKDTRTSAWRRPGWDACVAHTVPLIRHMTARILVPTPFSPL 269          
BLAST of NIPSNAP domain-containing protein vs. TrEMBL
Match: A0A1S3H692 (protein NipSnap-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106152561 PE=4 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 1.050e-87
Identity = 130/264 (49.24%), Postives = 181/264 (68.56%), Query Frame = 2
Query:   68 HFNRCFST--------GNDNK---WFGNLFVRKLDSVHESQSDLLAKSSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTKQSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSD-DSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
              +RC ST        G D K    F +LFVRK+++ H +QS LL++   +Y+   H+VKP  M  YL  +  + +++K+K +GA L+GSWT EIG+QD A H+W+++  +P+L+    +YR+D DF +FR +RN+ML  R+NQI+  FS+WPE  P Q D  +I+E+R+YTLKPGTMIEWGN W RGI+ R   +E IAG F+H+GD+H VHH W+YK L+ RK++R  AW NPGWDE V +TVPLIR + S IL  T FSP+
Sbjct:   29 QLSRCLSTTFPAFQADGEDGKKQGLFSSLFVRKIEATHVTQSKLLSEPGDVYQIQFHSVKPECMEAYLKQFGTFVDLMKSKDTGASLVGSWTVEIGDQDEAIHVWKYEGGYPVLNDATYIYRTDKDFIDFRLQRNKMLRARRNQIVLRFSFWPE--PVQKDPGNIYEMRTYTLKPGTMIEWGNIWQRGIKHRMSGNEAIAGYFSHIGDLHQVHHFWSYKSLQERKEIRESAWVNPGWDETVAYTVPLIRTLQSRILVPTPFSPL 290          
BLAST of NIPSNAP domain-containing protein vs. TrEMBL
Match: A0A1S3JJF0 (protein NipSnap-like OS=Lingula unguis OX=7574 GN=LOC106173808 PE=4 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 1.134e-87
Identity = 130/264 (49.24%), Postives = 181/264 (68.56%), Query Frame = 2
Query:   68 HFNRCFST--------GNDNK---WFGNLFVRKLDSVHESQSDLLAKSSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTKQSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSD-DSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
              +RC ST        G D K    F +LFVRK+++ H +QS LL++   +Y+   H+VKP  M  YL  +  + +++K+K +GA L+GSWT EIG+QD A H+W+++  +P+L+    +YR+D DF +FR +RN+ML  R+NQI+  FS+WPE  P Q D  +I+E+R+YTLKPGTMIEWGN W RGI+ R   +E IAG F+H+GD+H VHH W+YK L+ RK++R  AW NPGWDE V +TVPLIR + S IL  T FSP+
Sbjct:   29 QLSRCLSTTFPAFQADGEDGKKQGLFSSLFVRKIEATHVTQSKLLSEPGDVYQIQFHSVKPECMEAYLKQFGTFVDLMKSKDTGASLVGSWTVEIGDQDEAIHVWKYEGGYPVLNDATYIYRTDKDFIDFRLQRNKMLRARRNQIVLRFSFWPE--PVQKDPGNIYEMRTYTLKPGTMIEWGNIWQRGIKHRMSGNEAIAGYFSHIGDLHQVHHFWSYKSLQERKEIRESAWVNPGWDETVAYTVPLIRTLQSRILVPTPFSPL 290          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000034199.1 (protein NipSnap homolog 2 [Source:NCBI gene;Acc:103034276])

HSP 1 Score: 234.572 bits (597), Expect = 9.833e-76
Identity = 118/249 (47.39%), Postives = 165/249 (66.27%), Query Frame = 2
Query:   98 DNKWFGNLFVRKLDSVHESQSDLLAKS--STLYEFHIHNVKPAYMSEYLADYARYNEMI-----KTKQSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            ++ WF +LFVRK+D   ++ S LLAK   + LY+   HNVKP    E L DY +  E +        Q   EL+G+W T  GEQD A HLWR++  +P L +     R + +F E+R+ R +ML  R+NQ+L  FS+W E  PR S  +I+ELRSY L+PGTMIEWGN+WAR I +R+Q++E + G F+ +G ++MVHH+WAYKDL+ R++ RN AW++ GWDE V +TVPLI+HM S I+   K SP+
Sbjct:   42 EDSWFKSLFVRKVDPRKDAHSHLLAKKEDNNLYKIQFHNVKP----ECLDDYNKLCEAVLPNIHSDPQYPCELVGTWNTWYGEQDQAVHLWRYRGGYPALTEVMNKLRKNKEFMEYREERGKMLLSRRNQLLLEFSFWNEPVPR-SGPNIYELRSYQLRPGTMIEWGNYWARAIELRQQNNEAVGGFFSQIGSLYMVHHLWAYKDLQSREETRNAAWQHEGWDEAVYYTVPLIQHMESRIMIPMKTSPL 285          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Cavefish
Match: nipsnap2 (nipsnap homolog 2 [Source:HGNC Symbol;Acc:HGNC:4179])

HSP 1 Score: 225.328 bits (573), Expect = 3.907e-72
Identity = 116/249 (46.59%), Postives = 158/249 (63.45%), Query Frame = 2
Query:   98 DNKWFGNLFVRKLDSVHESQSDLLAKS--STLYEFHIHNVKPAYMSEYLADYARYNEMIKTKQSG-----AELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            +  WF +LFVRK+D   ++ S LLAK   S LY+   HNVKP    E L  Y +  E +            EL+G+W T  GEQD A HLWR++  +P L +     R++ +F E+RK R +ML  R+NQ+L  FS+W E  PR   + I+ELRSY L+PGTMIEWGN+WAR IR R+ + E + G F+ +G ++MVHH+WAYKDL+ R+  RN AW + GW+E V +TVPLI+HM S I+   K SP+
Sbjct:   44 EESWFKSLFVRKVDPRKDAHSHLLAKKEESNLYKIQFHNVKP----ECLDSYNKLCEGVLPSIHADTYYPCELVGTWNTWYGEQDQAVHLWRYRGGYPALTEVMNKLRNNKEFMEYRKERGKMLLSRRNQLLLEFSFWNEPVPRPGPN-IYELRSYQLRPGTMIEWGNYWARAIRYRQHNREAVGGFFSQIGSLYMVHHLWAYKDLQSREATRNAAWHHEGWNEAVYYTVPLIQHMESRIMIPMKSSPL 287          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Cavefish
Match: nipsnap1 (protein NipSnap homolog 1-like [Source:NCBI gene;Acc:103038637])

HSP 1 Score: 219.164 bits (557), Expect = 7.675e-70
Identity = 110/254 (43.31%), Postives = 164/254 (64.57%), Query Frame = 2
Query:   71 FNRCFSTGNDNKWFGNLFVRKLDSVHESQSDLLAK--SSTLYEFHIHNVKPAYMSEYLADYAR-YNEMIKTKQSGAELMGSWTTEIGEQDTAYHLWRF-KDFPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
             +R  +  +D  W  ++F  K D+  ++ S+LL+K  +S LY+   HNVKP  +  Y +  A  + E+ +      E++GSW T  GEQD A HLWR+   +P L +     R +  + E+RK R++ML  RK Q+L  FS+W +  PR +  +I+ELR+Y L+PGTMIEWGNHWAR I+ R++++E + G FT +G++++VHH+WAYKDL+ R++ RN AW   GWD  V +TVPLI++M S IL  TK SP+
Sbjct:   25 LSRGLANESDGGWLRSMFAHKADARKDAHSNLLSKKDTSGLYKIQFHNVKPDCLEAYNSLSAEVHKELHRAADYPCEVVGSWNTWYGEQDQAVHLWRYYGGYPALTECLDKLRLNKAYLEYRKERSKMLISRKTQLLMEFSFWNDPVPR-AGPNIYELRTYRLQPGTMIEWGNHWARAIKYRQENNEAVGGFFTQIGELYVVHHLWAYKDLQSREETRNSAWLKEGWDVSVHYTVPLIQNMESRILIPTKSSPL 277          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Cavefish
Match: nipsnap1 (protein NipSnap homolog 1-like [Source:NCBI gene;Acc:103038637])

HSP 1 Score: 217.238 bits (552), Expect = 3.101e-69
Identity = 109/250 (43.60%), Postives = 162/250 (64.80%), Query Frame = 2
Query:   83 FSTGNDNKWFGNLFVRKLDSVHESQSDLLAK--SSTLYEFHIHNVKPAYMSEYLADYAR-YNEMIKTKQSGAELMGSWTTEIGEQDTAYHLWRF-KDFPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
             +  +D  W  ++F  K D+  ++ S+LL+K  +S LY+   HNVKP  +  Y +  A  + E+ +      E++GSW T  GEQD A HLWR+   +P L +     R +  + E+RK R++ML  RK Q+L  FS+W +  PR +  +I+ELR+Y L+PGTMIEWGNHWAR I+ R++++E + G FT +G++++VHH+WAYKDL+ R++ RN AW   GWD  V +TVPLI++M S IL  TK SP+
Sbjct:   23 LANESDGGWLRSMFAHKADARKDAHSNLLSKKDTSGLYKIQFHNVKPDCLEAYNSLSAEVHKELHRAADYPCEVVGSWNTWYGEQDQAVHLWRYYGGYPALTECLDKLRLNKAYLEYRKERSKMLISRKTQLLMEFSFWNDPVPR-AGPNIYELRTYRLQPGTMIEWGNHWARAIKYRQENNEAVGGFFTQIGELYVVHHLWAYKDLQSREETRNSAWLKEGWDVSVHYTVPLIQNMESRILIPTKSSPL 271          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Cavefish
Match: nipsnap1 (protein NipSnap homolog 1-like [Source:NCBI gene;Acc:103038637])

HSP 1 Score: 196.438 bits (498), Expect = 3.333e-61
Identity = 98/234 (41.88%), Postives = 149/234 (63.68%), Query Frame = 2
Query:   71 FNRCFSTGNDNKWFGNLFVRKLDSVHESQSDLLAK--SSTLYEFHIHNVKPAYMSEYLADYAR-YNEMIKTKQSGAELMGSWTTEIGEQDTAYHLWRF-KDFPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHT 760
             +R  +  +D  W  ++F  K D+  ++ S+LL+K  +S LY+   HNVKP  +  Y +  A  + E+ +      E++GSW T  GEQD A HLWR+   +P L +     R +  + E+RK R++ML  RK Q+L  FS+W +  PR +  +I+ELR+Y L+PGTMIEWGNHWAR I+ R++++E + G FT +G++++VHH+WAYKDL+ R++ RN AW   GWD  V +T
Sbjct:   25 LSRGLANESDGGWLRSMFAHKADARKDAHSNLLSKKDTSGLYKIQFHNVKPDCLEAYNSLSAEVHKELHRAADYPCEVVGSWNTWYGEQDQAVHLWRYYGGYPALTECLDKLRLNKAYLEYRKERSKMLISRKTQLLMEFSFWNDPVPR-AGPNIYELRTYRLQPGTMIEWGNHWARAIKYRQENNEAVGGFFTQIGELYVVHHLWAYKDLQSREETRNSAWLKEGWDVSVHYT 257          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Sea Lamprey
Match: nipsnap2 (nipsnap homolog 2 [Source:HGNC Symbol;Acc:HGNC:4179])

HSP 1 Score: 235.728 bits (600), Expect = 3.629e-77
Identity = 117/259 (45.17%), Postives = 168/259 (64.86%), Query Frame = 2
Query:   71 FNRCFSTGN----DNKWFGNLFVRKLDSVHESQSDLLAK--SSTLYEFHIHNVKPAYMSEY--LADYARYNEMIKTKQSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            F R  S  +    ++ W  +L V K+D   ++ S+LLAK  SS+L++   HNVKP  +  Y  L + A    +    +   E++GSW T  G+QD A HLWR+K  +P L +   + R +  F EFR+ R++ML  RKNQ+L  FS+W E  PR    SI+ELR+Y+LKPGTMIEWGN+WAR IR R+++SE + G F+ +G+++ VHH+WAY+DL+ R + R  AW+ PGW+ECV +TVPLIR M S ++   KFSP+
Sbjct:    9 FTRALSVASVCHKEDSWLRSLLVHKVDPRKDAHSNLLAKKESSSLFKLQFHNVKPECLDAYNQLTEEALSAFIESGSEYPCEIVGSWNTWYGDQDQAVHLWRYKGGYPALTEAMNMLRQNKKFMEFRRERSKMLISRKNQLLLEFSFWNEPVPR-PGPSIYELRTYSLKPGTMIEWGNNWARAIRYRQENSEAVGGFFSQIGELYNVHHLWAYRDLQSRDETRAAAWQKPGWEECVYYTVPLIRWMESRVMIPLKFSPL 266          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Sea Lamprey
Match: nipsnap3a (nipsnap homolog 3A (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-040426-1037])

HSP 1 Score: 54.299 bits (129), Expect = 6.500e-9
Identity = 42/215 (19.53%), Postives = 91/215 (42.33%), Query Frame = 2
Query:  185 LYEFHIHNVKPAYMSEYLADYARYNEMIKTKQSGAELMGSWTTEIGEQDTAYHLWRFKDFPILDKHYRLYRSDADFEE-FRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQ--HSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            +YE   +   P     +L      NE I  + + + L+G W+ E G      H+W+++D+            D +++E +  +   ML   ++++ +    W ++   +    ++EL ++ +KPG    WG  +   I   +   ++  I    +  G ++ V  +W +   + R   R+ A  +      V  +V  +   ++ +L  T FSP+
Sbjct:   24 MYELRTYTAHPHAFPAFLK---LTNECIHLRTAHSPLIGYWSVEHGPLVQLVHIWQYEDYAQRTAVRAALAKDPEWQETYIAKALPMLCSLESEVTY-LVPWNKLGEPKKQGGVYELVTFDMKPGGPALWGKAFRAAITTHQHVGYASLIGVWHSEFGKLNRVQVLWNFNSADSRAAGRHLAHEDARVVAAVRESVSYVVAQSNKLLLPTPFSPL 234          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Nematostella
Match: EDO40732 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6D8])

HSP 1 Score: 110.923 bits (276), Expect = 6.325e-29
Identity = 64/216 (29.63%), Postives = 110/216 (50.93%), Query Frame = 2
Query:  176 SSTLYEFHIHNVKPAYMSEYLADYARYN-EMIKTKQSGAELMGSWTTEIGEQDTAYHLWRFKDFPILDKHYRLYRSDADFE-EFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSP 817
            S  +YE   + +KP    +   DY R   + I  + + ++L G W TE+G  + A H+W + +F    +  +    D  ++ ++  +   ML  ++N I+     W E+Q  QS   I+ELR+YTLK G   +W + W +G+  R ++S P+    + +G ++ V H+W Y   + R ++R EA++   W E V      ++ M S IL  T FSP
Sbjct:   29 SEKIYELRTYAIKP----KDFIDYMRLTYDHIGLRTNHSKLCGFWATELGGLNQAVHIWEYDNFAHRTEVRKALSQDEKWQSQYMAKMMPMLQRQENLIMKAVP-WYEMQKFQSRGGIYELRAYTLKTGKSEQWAHRWLQGLPARCKYSAPVGVWMSEIGTLNQVIHLWQYDSADERVRIRQEAFKEEEWAETVRDCGEFVKKMTSKILIPTNFSP 239          

HSP 2 Score: 46.595 bits (109), Expect = 3.895e-6
Identity = 25/102 (24.51%), Postives = 52/102 (50.98%), Query Frame = 2
Query:  503 RQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGW-DECVLHTVPLIRHMNSNILRAT 805
            R + + I+ELR+Y +KP   I++       I +R  HS+      T +G ++   H+W Y +  HR ++R    ++  W  + +   +P+++   + I++A 
Sbjct:   26 RINSEKIYELRTYAIKPKDFIDYMRLTYDHIGLRTNHSKLCGFWATELGGLNQAVHIWEYDNFAHRTEVRKALSQDEKWQSQYMAKMMPMLQRQENLIMKAV 127          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Medaka
Match: nipsnap1 (nipsnap homolog 1 [Source:NCBI gene;Acc:101164564])

HSP 1 Score: 230.335 bits (586), Expect = 2.777e-74
Identity = 112/252 (44.44%), Postives = 169/252 (67.06%), Query Frame = 2
Query:   77 RCFSTGNDNKWFGNLFVRKLDSVHESQSDLLAK--SSTLYEFHIHNVKPAYMSEYLADYARYNEMIKTKQS-GAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            R FS  +D  W  +LFV+K+D+  ++ S+LL+K  +S+LY+   H+VKP  +  Y +  A   + +   Q    E++GSW T  GEQD A HLWR++  +P L +  +  R++ ++ EFR+ R++ML  R+NQ+L  FS+W E  PR+  + I+ELR+Y LKPGTMIEWGN WAR I+ R+ ++E + G F+ +GD+++VHH+WAY+ L+ R++ RN AWR  GWD  V +TVPLIR M S I+  T+ SP+
Sbjct:   21 RRFSESSDKGWLRSLFVQKVDARKDAHSNLLSKKETSSLYKIQFHDVKPECLDAYNSLEAEVQKKLHQDQDFPCEVVGSWNTWYGEQDQAVHLWRYRGGYPALTECLQKLRANKEYLEFRRERSKMLISRRNQLLLEFSFWNEPLPRRGPN-IYELRTYKLKPGTMIEWGNRWARAIKYRQSNNEAVGGFFSQIGDLYVVHHLWAYESLQSREETRNSAWRKEGWDVNVYYTVPLIRSMESRIMIPTESSPL 271          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Medaka
Match: nipsnap2 (nipsnap homolog 2 [Source:NCBI gene;Acc:101168476])

HSP 1 Score: 229.18 bits (583), Expect = 7.970e-74
Identity = 118/260 (45.38%), Postives = 167/260 (64.23%), Query Frame = 2
Query:   77 RCFSTGN----DNKWFGNLFVRKLDSVHESQSDLLAKS--STLYEFHIHNVKPAYMSEYLADYARYNEMI-----KTKQSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            RCF+  +    ++ WF +LFVRK+D   ++ ++LL K+  S LY+   HNVKP    E L  Y +  E +       K    EL+G+W T  GEQD A HLWR++  +P L +     R + +F  +RK R +ML  R+NQ+L  FS+W E  PR+  + I+ELRSY L+PGTMIEWGN+WARGIR R+++ E + G F+ +GD++MVHH+WAY+DL+ R++ RN AW   GW E V +TVPLI+HM S I+   K SP+
Sbjct:   15 RCFTASSHACSEDSWFKSLFVRKVDPRKDAHANLLTKNEESNLYKIQFHNVKP----ECLDAYNKLCEDVLPTIHADKYYPCELVGTWNTWYGEQDQAVHLWRYRGGYPALTEVMNKLRQNKEFTAYRKERGKMLLSRRNQLLLEFSFWNEPVPREGPN-IYELRSYQLRPGTMIEWGNYWARGIRHRQRNKEAVGGFFSQIGDLYMVHHLWAYEDLQSREETRNGAWHQEGWHEAVYYTVPLIQHMESRIMIPLKASPL 269          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Medaka
Match: nipsnap2 (nipsnap homolog 2 [Source:NCBI gene;Acc:101168476])

HSP 1 Score: 226.098 bits (575), Expect = 2.072e-72
Identity = 115/250 (46.00%), Postives = 163/250 (65.20%), Query Frame = 2
Query:   95 NDNKWFGNLFVRKLDSVHESQSDLLAKS--STLYEFHIHNVKPAYMSEYLADYARYNEMI-----KTKQSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            +++ WF +LFVRK+D   ++ ++LL K+  S LY+   HNVKP    E L  Y +  E +       K    EL+G+W T  GEQD A HLWR++  +P L +     R + +F  +RK R +ML  R+NQ+L  FS+W E  PR+  + I+ELRSY L+PGTMIEWGN+WARGIR R+++ E + G F+ +GD++MVHH+WAY+DL+ R++ RN AW   GW E V +TVPLI+HM S I+   K SP+
Sbjct:   43 SEDSWFKSLFVRKVDPRKDAHANLLTKNEESNLYKIQFHNVKP----ECLDAYNKLCEDVLPTIHADKYYPCELVGTWNTWYGEQDQAVHLWRYRGGYPALTEVMNKLRQNKEFTAYRKERGKMLLSRRNQLLLEFSFWNEPVPREGPN-IYELRSYQLRPGTMIEWGNYWARGIRHRQRNKEAVGGFFSQIGDLYMVHHLWAYEDLQSREETRNGAWHQEGWHEAVYYTVPLIQHMESRIMIPLKASPL 287          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000003512.2 (protein NipSnap homolog 2 [Source:NCBI gene;Acc:101159691])

HSP 1 Score: 221.09 bits (562), Expect = 1.312e-70
Identity = 110/256 (42.97%), Postives = 160/256 (62.50%), Query Frame = 2
Query:   68 HFNRCFSTGNDNKWFGNLFVRKLDSVHESQSDLLAKS--STLYEFHIHNVKPAYMSEY--LADYARYNEMIKTKQSGAELMGSWTTEIGEQDTAYHLWRFKD-FPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            H N   +       F +LF+RK+D   ++ S++L+K     LY+   HNVKP  +  Y  L + A    +    +  +EL+G+W T  GEQD A HLWR++  +P L +     + + +F E+RK R +ML  R+NQ+L  FS+W E  PR   + I+ELRSY L+PGTMIEWGN+WAR I +R+++ E + G F+ +G ++ VHH+WAYKDL+ R + RN AW+  GWDE V +TVPLI+HM S I+   K SP+
Sbjct:   21 HINGAVTITRSLSGFKSLFIRKVDPRKDAHSNVLSKKEEQNLYKIQFHNVKPECLDAYNELCE-AVLPSIHANPEYPSELVGTWNTWYGEQDQAVHLWRYRGGYPALTEVMNKLKQNKEFMEYRKERGKMLLSRRNQLLLEFSFWNEPVPRPGPN-IYELRSYQLRPGTMIEWGNYWARAIEIRQKNQEAVGGFFSQIGSLYTVHHLWAYKDLQSRDETRNAAWQQEGWDEVVYYTVPLIQHMESRIMIPMKSSPL 274          
BLAST of NIPSNAP domain-containing protein vs. Ensembl Medaka
Match: nipsnap3a (protein NipSnap homolog 3A [Source:NCBI gene;Acc:101171648])

HSP 1 Score: 71.633 bits (174), Expect = 3.209e-14
Identity = 47/216 (21.76%), Postives = 99/216 (45.83%), Query Frame = 2
Query:  182 TLYEFHIHNVKPAYMSEYLADYARYNEMIKTKQSGAELMGSWTTEIGEQDTAYHLWRFKDFPILDKHYRLYRSDAD-FEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQ--HSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPI 820
            T YEF  +++ P   + +L      NE I  + + +EL+G WT E G  +  +H+W++  +            D     ++  +   ML  + N++ +    W  +  +   + ++EL SY ++PG    WG+ +   I  R    + + +    +  G ++ VH +W Y+  +HR ++R++A  +      V ++V  +    + ++    FSP+
Sbjct:   30 TFYEFRTYSIHPHQNAAFLK---LTNEKIHLRTAHSELIGYWTVEYGGLNQVFHIWKYDSYSQRAAVRAALAQDPTWISDYISKALPMLTSQDNEVTY-LVPWSRLH-KPPKEGVYELASYQMRPGGPAVWGSAFQAAICARDAPGYGKLLGAFHSEFGALNQVHALWWYESADHRAEVRHKAHNDARVVAAVRNSVTHLDTQRNRLMHPCLFSPM 240          
BLAST of NIPSNAP domain-containing protein vs. Planmine SMEST
Match: SMESG000043687.1 (SMESG000043687.1)

HSP 1 Score: 423.705 bits (1088), Expect = 1.149e-151
Identity = 200/200 (100.00%), Postives = 200/200 (100.00%), Query Frame = 2
Query:  224 MSEYLADYARYNEMIKTKQSGAELMGSWTTEIGEQDTAYHLWRFKDFPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPIY 823
            MSEYLADYARYNEMIKTKQSGAELMGSWTTEIGEQDTAYHLWRFKDFPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPIY
Sbjct:    1 MSEYLADYARYNEMIKTKQSGAELMGSWTTEIGEQDTAYHLWRFKDFPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWPEIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFTHVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSNILRATKFSPIY 200          
The following BLAST results are available for this feature:
BLAST of NIPSNAP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NIPSNAP15.179e-7546.09nipsnap homolog 1 [Source:HGNC Symbol;Acc:HGNC:782... [more]
NIPSNAP23.385e-7146.53nipsnap homolog 2 [Source:HGNC Symbol;Acc:HGNC:417... [more]
NIPSNAP21.206e-5139.92nipsnap homolog 2 [Source:HGNC Symbol;Acc:HGNC:417... [more]
NIPSNAP19.940e-3944.00nipsnap homolog 1 [Source:HGNC Symbol;Acc:HGNC:782... [more]
NIPSNAP21.194e-2751.92nipsnap homolog 2 [Source:HGNC Symbol;Acc:HGNC:417... [more]
back to top
BLAST of NIPSNAP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
K02D10.19.997e-5338.50Putative NipSnap protein K02D10.1 [Source:UniProt... [more]
K02D10.19.997e-5338.50Putative NipSnap protein K02D10.1 [Source:UniProt... [more]
K02D10.11.831e-5038.84Putative NipSnap protein K02D10.1 [Source:UniProt... [more]
back to top
BLAST of NIPSNAP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Nipsnap3.517e-7242.01gene:FBgn0030724 transcript:FBtr0074259[more]
Nipsnap3.517e-7242.01gene:FBgn0030724 transcript:FBtr0343595[more]
Nipsnap3.517e-7242.01gene:FBgn0030724 transcript:FBtr0074257[more]
Nipsnap3.517e-7242.01gene:FBgn0030724 transcript:FBtr0074258[more]
back to top
BLAST of NIPSNAP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nipsnap13.531e-7245.06nipsnap homolog 1 (C. elegans) [Source:NCBI gene;A... [more]
nipsnap21.302e-4842.01pep chromosome:GRCz11:15:404891:413541:1 gene:ENSD... [more]
nipsnap3a3.147e-1421.76nipsnap homolog 3A (C. elegans) [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of NIPSNAP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nipsnap21.864e-7547.64nipsnap homolog 2 [Source:NCBI gene;Acc:733910][more]
nipsnap29.221e-7547.81nipsnap homolog 2 [Source:NCBI gene;Acc:733910][more]
mgat25.104e-7144.96mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acet... [more]
mgat23.332e-7045.06mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acet... [more]
mgat23.377e-7044.92mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acet... [more]
back to top
BLAST of NIPSNAP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nipsnap11.105e-7345.70nipsnap homolog 1 [Source:MGI Symbol;Acc:MGI:12783... [more]
Nipsnap22.173e-7146.12nipsnap homolog 2 [Source:MGI Symbol;Acc:MGI:12783... [more]
Nipsnap22.173e-7146.12nipsnap homolog 2 [Source:MGI Symbol;Acc:MGI:12783... [more]
Nipsnap22.173e-7146.12nipsnap homolog 2 [Source:MGI Symbol;Acc:MGI:12783... [more]
Nipsnap15.186e-1536.22nipsnap homolog 1 [Source:MGI Symbol;Acc:MGI:12783... [more]
back to top
BLAST of NIPSNAP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BPW8|NIPS1_HUMAN2.487e-7446.09Protein NipSnap homolog 1 OS=Homo sapiens OX=9606 ... [more]
sp|O55125|NIPS1_MOUSE7.730e-7345.70Protein NipSnap homolog 1 OS=Mus musculus OX=10090... [more]
sp|Q9VXK0|NIPSN_DROME3.526e-7142.01Protein NipSnap OS=Drosophila melanogaster OX=7227... [more]
sp|Q9PU58|NIPS2_DANRE3.977e-7146.59Protein NipSnap homolog 2 OS=Danio rerio OX=7955 G... [more]
sp|O75323|NIPS2_HUMAN1.625e-7046.53Protein NipSnap homolog 2 OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of NIPSNAP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LSE92.189e-9051.97NIPSNAP domain-containing protein OS=Opisthorchis ... [more]
A0A074YZ702.362e-9051.57NIPSNAP domain-containing protein OS=Opisthorchis ... [more]
R7TLM63.530e-8852.50Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1S3H6921.050e-8749.24protein NipSnap-like isoform X1 OS=Lingula unguis ... [more]
A0A1S3JJF01.134e-8749.24protein NipSnap-like OS=Lingula unguis OX=7574 GN=... [more]
back to top
BLAST of NIPSNAP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000034199.19.833e-7647.39protein NipSnap homolog 2 [Source:NCBI gene;Acc:10... [more]
nipsnap23.907e-7246.59nipsnap homolog 2 [Source:HGNC Symbol;Acc:HGNC:417... [more]
nipsnap17.675e-7043.31protein NipSnap homolog 1-like [Source:NCBI gene;A... [more]
nipsnap13.101e-6943.60protein NipSnap homolog 1-like [Source:NCBI gene;A... [more]
nipsnap13.333e-6141.88protein NipSnap homolog 1-like [Source:NCBI gene;A... [more]
back to top
BLAST of NIPSNAP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nipsnap23.629e-7745.17nipsnap homolog 2 [Source:HGNC Symbol;Acc:HGNC:417... [more]
nipsnap3a6.500e-919.53nipsnap homolog 3A (C. elegans) [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of NIPSNAP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NIPSNAP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO407326.325e-2929.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NIPSNAP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nipsnap12.777e-7444.44nipsnap homolog 1 [Source:NCBI gene;Acc:101164564][more]
nipsnap27.970e-7445.38nipsnap homolog 2 [Source:NCBI gene;Acc:101168476][more]
nipsnap22.072e-7246.00nipsnap homolog 2 [Source:NCBI gene;Acc:101168476][more]
ENSORLT00000003512.21.312e-7042.97protein NipSnap homolog 2 [Source:NCBI gene;Acc:10... [more]
nipsnap3a3.209e-1421.76protein NipSnap homolog 3A [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of NIPSNAP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000043687.11.149e-151100.00SMESG000043687.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004082 ID=SMED30004082|Name=NIPSNAP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=950bp
AATATTAACAGAAAAAAATAATTTATAAATTTTACGTTAAATGTTCAAAT
TTATAAGATTACGCAATCATTTTAATCGTTGTTTTTCAACTGGAAACGAT
AATAAATGGTTTGGAAATCTTTTTGTTCGTAAACTAGATTCCGTTCATGA
ATCTCAATCGGATCTCTTAGCTAAAAGTAGTACACTATATGAATTTCATA
TTCATAACGTAAAACCGGCTTATATGAGTGAATATTTAGCAGATTATGCA
CGTTACAATGAAATGATTAAAACGAAACAAAGTGGCGCCGAATTAATGGG
CAGTTGGACAACTGAAATTGGAGAACAGGATACTGCTTATCATTTGTGGC
GTTTTAAAGATTTCCCTATTTTGGATAAGCATTATAGACTCTATAGATCT
GATGCGGATTTTGAAGAATTTCGTAAACGAAGAAATGAAATGCTTTATTT
CCGTAAGAATCAGATTCTATTCCCATTCAGTTATTGGCCGGAAATTCAAC
CCAGACAATCAGATGATTCGATATTTGAATTACGCTCTTACACTCTTAAG
CCGGGTACAATGATCGAATGGGGTAATCATTGGGCACGAGGAATTAGAGT
ACGTAAACAGCATTCTGAACCGATTGCTGGCTTGTTTACTCATGTCGGGG
ATATCCACATGGTTCATCATATGTGGGCTTACAAAGATCTGGAACATCGA
AAGAAAATGAGAAACGAAGCTTGGAGAAATCCTGGATGGGATGAATGTGT
TCTTCATACGGTCCCTTTGATTCGTCATATGAATAGCAACATCCTGAGAG
CGACAAAATTCAGCCCAATCTATTAAGGAATCGCAAATGGAAATTTAAAG
TCCAACTTTTAAAAATAAAATTAGATAAAATATTTAATGAATTTTTTTGC
TAAGTTTTCTCATTTTAAGTAGAATCGTATTGATTGTGATCATTTCTTAA
back to top

protein sequence of SMED30004082-orf-1

>SMED30004082-orf-1 ID=SMED30004082-orf-1|Name=SMED30004082-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=262bp
MFKFIRLRNHFNRCFSTGNDNKWFGNLFVRKLDSVHESQSDLLAKSSTLY
EFHIHNVKPAYMSEYLADYARYNEMIKTKQSGAELMGSWTTEIGEQDTAY
HLWRFKDFPILDKHYRLYRSDADFEEFRKRRNEMLYFRKNQILFPFSYWP
EIQPRQSDDSIFELRSYTLKPGTMIEWGNHWARGIRVRKQHSEPIAGLFT
HVGDIHMVHHMWAYKDLEHRKKMRNEAWRNPGWDECVLHTVPLIRHMNSN
ILRATKFSPIY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0016020membrane
GO:0097060synaptic membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000418head
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR012577NIPSNAP
IPR011008Dimeric_a/b-barrel
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0042165neurotransmitter binding
Vocabulary: biological process
TermDefinition
GO:0019233sensory perception of pain
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012577NIPSNAPPFAMPF07978NIPSNAPcoord: 50..148
e-value: 2.8E-10
score: 40.3
coord: 162..259
e-value: 3.6E-28
score: 97.8
NoneNo IPR availableGENE3DG3DSA:3.30.70.100coord: 158..261
e-value: 1.3E-35
score: 123.9
coord: 43..157
e-value: 5.2E-21
score: 76.7
NoneNo IPR availablePANTHERPTHR21017:SF17PROTEIN NIPSNAPcoord: 24..260
NoneNo IPR availablePANTHERPTHR21017NIPSNAP-RELATEDcoord: 24..260
IPR011008Dimeric alpha-beta barrelSUPERFAMILYSSF54909Dimeric alpha+beta barrelcoord: 156..260
IPR011008Dimeric alpha-beta barrelSUPERFAMILYSSF54909Dimeric alpha+beta barrelcoord: 44..150