PIM-1-like protein

Overview
NamePIM-1-like protein
Smed IDSMED30004080
Length (bp)901
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PIM-1-like protein (SMED30004080) t-SNE clustered cells

Violin plots show distribution of expression levels for PIM-1-like protein (SMED30004080) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PIM-1-like protein (SMED30004080) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PIM-1-like protein (SMED30004080) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004080

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal progenitor cellSMED30004080SMESG000061809.1 SMESG000061808.1 SMED30004080smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30004080SMESG000061809.1 SMESG000061808.1 SmedASXL_016012SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30004080SMESG000061809.1 SMESG000061808.1 SmedASXL_016012SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30004080SMESG000061809.1 SMESG000061808.1 dd_Smed_v4_16306_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004080SMESG000061809.1 SMESG000061808.1 dd_Smed_v4_16306_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004080SMESG000061809.1 SMESG000061808.1 dd_Smed_v4_16306_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30004080SMESG000061809.1 SMESG000061808.1 dd_Smed_v4_16306_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30004080SMESG000061809.1 SMESG000061808.1 dd_Smed_v4_16306_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004080SMESG000061809.1 SMESG000061808.1 SMESG000032312.1 SMED_08691_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30004080SMESG000061809.1 SMESG000061808.1 SMESG000032312.1 SMED_08691_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30004080SMESG000061809.1 SMESG000061808.1 SMED_08691_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30004080SMESG000061809.1 SMESG000061808.1 SMED_08691_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PIM-1-like protein vs. Ensembl Human
Match: PIM3 (Pim-3 proto-oncogene, serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:19310])

HSP 1 Score: 60.4622 bits (145), Expect = 7.132e-10
Identity = 42/158 (26.58%), Postives = 72/158 (45.57%), Query Frame = 2
Query:  365 EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLID------LEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            E L +     +++ V      G  HRDIK EN++V+ ++ E+KLID      L+D +Y + +        GT  +  PE      Y+ + + V+++G L Y  +  +  F+   E  +  L   +  S   +  I  C+ L P ER   D +  H W+
Sbjct:  144 EPLARRFFAQVLAAVRHCHSCGVVHRDIKDENLLVDLRSGELKLIDFGSGALLKDTVYTDFD--------GTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWM 293          
BLAST of PIM-1-like protein vs. Ensembl Human
Match: RPS6KA5 (ribosomal protein S6 kinase A5 [Source:HGNC Symbol;Acc:HGNC:10434])

HSP 1 Score: 61.2326 bits (147), Expect = 8.730e-10
Identity = 50/193 (25.91%), Postives = 91/193 (47.15%), Query Frame = 2
Query:  383 IMRNLISIVYKMSDIGYYHRDIKPENIMVNQK--TLEIKLIDLE-DMLYDENEIPI---CISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKC-----LLPEMKVS------------SKLARSFITECIKLDPDERIEFDDLLFHDWLEXXXXXXXXXXXSYNPMAIAESLG 892
            IMR L+S V  M D+G  HRD+KPEN++   +   LEIK+ID     L   +  P+   C     TL + +PE  ++  Y+    L +++G + Y  +  +  F +   +  C     ++ ++K              S+ A+  I   + +DP++R++   L +++WL+        +  S NP+   + LG
Sbjct:  524 IMRKLVSAVSHMHDVGVVHRDLKPENLLFTDENDNLEIKIIDFGFARLKPPDNQPLKTPCF----TLHYAAPELLNQNGYDESCDL-WSLGVILYTMLSGQVPFQSHDRSLTCTSAVEIMKKIKKGDFSFEGEAWKNVSQEAKDLIQGLLTVDPNKRLKMSGLRYNEWLQ------DGSQLSSNPLMTPDILG 705          
BLAST of PIM-1-like protein vs. Ensembl Human
Match: RPS6KA5 (ribosomal protein S6 kinase A5 [Source:HGNC Symbol;Acc:HGNC:10434])

HSP 1 Score: 60.8474 bits (146), Expect = 1.013e-9
Identity = 47/189 (24.87%), Postives = 88/189 (46.56%), Query Frame = 2
Query:  383 IMRNLISIVYKMSDIGYYHRDIKPENIMVNQK--TLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKC-----LLPEMKVS------------SKLARSFITECIKLDPDERIEFDDLLFHDWLEXXXXXXXXXXXSYNPMAIAESLG 892
            IMR L+S V  M D+G  HRD+KPEN++   +   LEIK+ID         +     +   TL + +PE  ++  Y+    L +++G + Y  +  +  F +   +  C     ++ ++K              S+ A+  I   + +DP++R++   L +++WL+        +  S NP+   + LG
Sbjct:  445 IMRKLVSAVSHMHDVGVVHRDLKPENLLFTDENDNLEIKIIDFGFARLKPPDNQPLKTPCFTLHYAAPELLNQNGYDESCDL-WSLGVILYTMLSGQVPFQSHDRSLTCTSAVEIMKKIKKGDFSFEGEAWKNVSQEAKDLIQGLLTVDPNKRLKMSGLRYNEWLQ------DGSQLSSNPLMTPDILG 626          
BLAST of PIM-1-like protein vs. Ensembl Human
Match: PIM1 (Pim-1 proto-oncogene, serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:8986])

HSP 1 Score: 60.077 bits (144), Expect = 1.054e-9
Identity = 43/161 (26.71%), Postives = 78/161 (48.45%), Query Frame = 2
Query:  365 EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLID------LEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAY--FCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLE 823
            E+L ++    ++  V    + G  HRDIK ENI+++    E+KLID      L+D +Y + +        GT  +  PE      Y+ + + V+++G L Y   C +  +  D +I   +      +VSS+  +  I  C+ L P +R  F+++  H W++
Sbjct:  141 EELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFD--------GTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFF-RQRVSSE-CQHLIRWCLALRPSDRPTFEEIQNHPWMQ 291          
BLAST of PIM-1-like protein vs. Ensembl Human
Match: IKBKB (inhibitor of nuclear factor kappa B kinase subunit beta [Source:HGNC Symbol;Acc:HGNC:5960])

HSP 1 Score: 58.9214 bits (141), Expect = 3.994e-9
Identity = 44/142 (30.99%), Postives = 77/142 (54.23%), Query Frame = 2
Query:  254 VPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEG-----EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQ--KTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCI 658
            VP+ ++ +  N+   +AMEY  G   DL  YL +FE      E  + T++ ++ S +  + +    HRD+KPENI++ Q  + L  K+IDL     + ++  +C S +GTL + +PE  ++  Y +     ++ G LA+ CI
Sbjct:   15 VPEGMQNLAPNDLPLLAMEYCQGG--DLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDL-GYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVD-YWSFGTLAFECI 152          
BLAST of PIM-1-like protein vs. Ensembl Celegans
Match: pig-1 (Maternal embryonic leucine zipper kinase [Source:UniProtKB/Swiss-Prot;Acc:U4PR86])

HSP 1 Score: 70.0922 bits (170), Expect = 3.425e-13
Identity = 61/222 (27.48%), Postives = 105/222 (47.30%), Query Frame = 2
Query:  206 IPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYI-GGDWMDLSYYLVEFEG--EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDL------EDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFD--------TKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            +  E+  L  LS ++ + +L  YI+  +   + MEY  GG+  D   Y+V  E   E   +   R L+S +  +   GY HRD+KPEN+++ +  L +KLID       E    D++ +  C    G+  + +PE    + Y   ++ V+++G L Y  +     F+         KI++     PE    S L++  +   +++ P+ RI    LL HDWL
Sbjct:   54 VQTEMDALRNLS-HQNICRLYHYIETEDKFFIVMEYCSGGEMFD---YIVRKERLEESEARHFFRQLVSAIAFVHSQGYAHRDLKPENLLLTED-LHLKLIDFGLCAKTEKGRIDKHNLDTCC---GSPAYAAPELIQGLQYKGNEADVWSMGILLYTLLVGALPFEDDNMQIMYKKIQSGCFYEPEF--LSPLSKQLLRAMLQVVPERRISVKKLLEHDWL 265          
BLAST of PIM-1-like protein vs. Ensembl Celegans
Match: pig-1 (Maternal embryonic leucine zipper kinase [Source:UniProtKB/Swiss-Prot;Acc:U4PR86])

HSP 1 Score: 70.0922 bits (170), Expect = 3.594e-13
Identity = 61/222 (27.48%), Postives = 105/222 (47.30%), Query Frame = 2
Query:  206 IPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYI-GGDWMDLSYYLVEFEG--EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDL------EDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFD--------TKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            +  E+  L  LS ++ + +L  YI+  +   + MEY  GG+  D   Y+V  E   E   +   R L+S +  +   GY HRD+KPEN+++ +  L +KLID       E    D++ +  C    G+  + +PE    + Y   ++ V+++G L Y  +     F+         KI++     PE    S L++  +   +++ P+ RI    LL HDWL
Sbjct:   54 VQTEMDALRNLS-HQNICRLYHYIETEDKFFIVMEYCSGGEMFD---YIVRKERLEESEARHFFRQLVSAIAFVHSQGYAHRDLKPENLLLTE-DLHLKLIDFGLCAKTEKGRIDKHNLDTCC---GSPAYAAPELIQGLQYKGNEADVWSMGILLYTLLVGALPFEDDNMQIMYKKIQSGCFYEPEF--LSPLSKQLLRAMLQVVPERRISVKKLLEHDWL 265          
BLAST of PIM-1-like protein vs. Ensembl Celegans
Match: pig-1 (Maternal embryonic leucine zipper kinase [Source:UniProtKB/Swiss-Prot;Acc:U4PR86])

HSP 1 Score: 70.0922 bits (170), Expect = 3.658e-13
Identity = 61/222 (27.48%), Postives = 105/222 (47.30%), Query Frame = 2
Query:  206 IPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYI-GGDWMDLSYYLVEFEG--EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDL------EDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFD--------TKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            +  E+  L  LS ++ + +L  YI+  +   + MEY  GG+  D   Y+V  E   E   +   R L+S +  +   GY HRD+KPEN+++ +  L +KLID       E    D++ +  C    G+  + +PE    + Y   ++ V+++G L Y  +     F+         KI++     PE    S L++  +   +++ P+ RI    LL HDWL
Sbjct:   54 VQTEMDALRNLS-HQNICRLYHYIETEDKFFIVMEYCSGGEMFD---YIVRKERLEESEARHFFRQLVSAIAFVHSQGYAHRDLKPENLLLTED-LHLKLIDFGLCAKTEKGRIDKHNLDTCC---GSPAYAAPELIQGLQYKGNEADVWSMGILLYTLLVGALPFEDDNMQIMYKKIQSGCFYEPEF--LSPLSKQLLRAMLQVVPERRISVKKLLEHDWL 265          
BLAST of PIM-1-like protein vs. Ensembl Celegans
Match: pig-1 (Maternal embryonic leucine zipper kinase [Source:UniProtKB/Swiss-Prot;Acc:U4PR86])

HSP 1 Score: 69.707 bits (169), Expect = 4.094e-13
Identity = 61/222 (27.48%), Postives = 105/222 (47.30%), Query Frame = 2
Query:  206 IPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYI-GGDWMDLSYYLVEFEG--EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDL------EDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFD--------TKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            +  E+  L  LS ++ + +L  YI+  +   + MEY  GG+  D   Y+V  E   E   +   R L+S +  +   GY HRD+KPEN+++ +  L +KLID       E    D++ +  C    G+  + +PE    + Y   ++ V+++G L Y  +     F+         KI++     PE    S L++  +   +++ P+ RI    LL HDWL
Sbjct:   54 VQTEMDALRNLS-HQNICRLYHYIETEDKFFIVMEYCSGGEMFD---YIVRKERLEESEARHFFRQLVSAIAFVHSQGYAHRDLKPENLLLTE-DLHLKLIDFGLCAKTEKGRIDKHNLDTCC---GSPAYAAPELIQGLQYKGNEADVWSMGILLYTLLVGALPFEDDNMQIMYKKIQSGCFYEPEF--LSPLSKQLLRAMLQVVPERRISVKKLLEHDWL 265          
BLAST of PIM-1-like protein vs. Ensembl Celegans
Match: cmk-1 (Calcium/calmodulin-dependent protein kinase type 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXJ0])

HSP 1 Score: 63.929 bits (154), Expect = 2.195e-11
Identity = 55/207 (26.57%), Postives = 89/207 (43.00%), Query Frame = 2
Query:  260 KLIEYIDENNWSTVAMEYI-GGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAY--FC-----------------IEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            +L +  DE  +  + ME + GG+  D       +  E+    ++R ++  V  M D G  HRD+KPEN++   +  + K++  +  L    +  +  +  GT G+ +PE   + PY  K   V++IG +AY   C                 I+ EY FD          P     S  A+ FIT  +  DP+ R    D L H W+
Sbjct:   83 QLFDTYDEKQFVYLVMELVTGGELFDRIVAKGSYT-EQDASNLIRQVLEAVGFMHDNGVVHRDLKPENLLYYNQDEDSKIMISDFGLSKTEDSGVMATACGTPGYVAPEVLQQKPYG-KAVDVWSIGVIAYILLCGYPPFYDESDANLFAQIIKGEYEFDA---------PYWDQISDSAKDFITHLMCCDPEARFTCQDALSHPWI 278          
BLAST of PIM-1-like protein vs. Ensembl Fly
Match: CG17528 (gene:FBgn0261387 transcript:FBtr0111274)

HSP 1 Score: 65.4698 bits (158), Expect = 1.409e-11
Identity = 62/228 (27.19%), Postives = 102/228 (44.74%), Query Frame = 2
Query:  203 YIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYI-GGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMV----NQKTLEIKLID------LEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLL------------PEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDW 817
            YI  E+  +++L+ + ++  LI  +D+N    + +EY+ GGD  D    +  F  E   + ++R+L + +  +  +G  HRDIKPEN++V    +   LE+KL D      + D+LY      +C    GT  + +PE   +V Y LK   V+  G + Y  +     F      Q+ L             P         R  I   ++ DPD R   +D+L H W
Sbjct:  519 YIDAEVRVMKKLN-HPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFS-ENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKLDEHGNVLELKLADFGLACEVNDLLY-----AVC----GTPTYVAPEILLEVGYGLKID-VWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHSW 734          
BLAST of PIM-1-like protein vs. Ensembl Fly
Match: CG17528 (gene:FBgn0261387 transcript:FBtr0111277)

HSP 1 Score: 65.4698 bits (158), Expect = 1.409e-11
Identity = 62/228 (27.19%), Postives = 102/228 (44.74%), Query Frame = 2
Query:  203 YIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYI-GGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMV----NQKTLEIKLID------LEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLL------------PEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDW 817
            YI  E+  +++L+ + ++  LI  +D+N    + +EY+ GGD  D    +  F  E   + ++R+L + +  +  +G  HRDIKPEN++V    +   LE+KL D      + D+LY      +C    GT  + +PE   +V Y LK   V+  G + Y  +     F      Q+ L             P         R  I   ++ DPD R   +D+L H W
Sbjct:  519 YIDAEVRVMKKLN-HPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFS-ENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKLDEHGNVLELKLADFGLACEVNDLLY-----AVC----GTPTYVAPEILLEVGYGLKID-VWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHSW 734          
BLAST of PIM-1-like protein vs. Ensembl Fly
Match: fu (gene:FBgn0001079 transcript:FBtr0074602)

HSP 1 Score: 57.7658 bits (138), Expect = 4.737e-9
Identity = 64/269 (23.79%), Postives = 118/269 (43.87%), Query Frame = 2
Query:   59 YSEFIILSESCKGIVIKALNEENN-LVLLKTFYKIKKNGTFMKKTNSNFYIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLV--EFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDL---EDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAY--------FCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLE 823
            Y+   ++ +   G V KA  ++++ +V +K   K  +    +K       I   L       ++ +V ++IE  +      V  E+     MDL  YL      GE+  + +  +L+S +Y +      HRD+KP+N++++ K +  KL D     +M    +   +  S  GT  + +PE   + PY+   + ++++GC+AY        FC          I+ +    P    S    RSF+   ++ DP  RI +  LL H ++E
Sbjct:    4 YAVSSMVGQGSFGCVYKATRKDDSKVVAIKVISKRGRATKELKNLRRECDIQARL-------KHPHVIEMIESFESKTDLFVVTEFA---LMDLHRYLSYNGAMGEEPARRVTGHLVSALYYLHSNRILHRDLKPQNVLLD-KNMHAKLCDFGLARNMTLGTH---VLTSIKGTPLYMAPELLAEQPYD-HHADMWSLGCIAYESMAGQPPFCASSILHLVKMIKHEDVKWPSTLTSE--CRSFLQGLLEKDPGLRISWTQLLCHPFVE 255          
BLAST of PIM-1-like protein vs. Ensembl Fly
Match: Unc-89 (gene:FBgn0053519 transcript:FBtr0343286)

HSP 1 Score: 55.0694 bits (131), Expect = 4.576e-8
Identity = 48/180 (26.67%), Postives = 85/180 (47.22%), Query Frame = 2
Query:  335 LSYYLVEFE-GEKLVKTIMRNLISIVYKMSDIGYYHRDIKPEN-IMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYF----CIEYEYA--FDTKIETQ----------KCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            L+Y+    E  E++V T++  L+  +  +   GY H +I+P+N +M + +++++KL+D        N++ + ++  G+L FQ PE  +  P    QS ++++G L Y     C  +  A  ++TK              K + PE       A  FI    K  P +R   +D L H WL
Sbjct: 3073 LTYFSSRHEYSEQMVATVVTQLLDALQYLHWRGYCHLNIQPDNVVMASVRSIQVKLVDF-GSAKKVNKLGMKVTPCGSLDFQPPEMINDEPI-FPQSDIWSLGALTYLLLSGCSPFRGADEYETKQNISFVRYRFENLFKEVTPE-------ATRFIMLLFKRHPTKRPYTEDCLEHRWL 3243          
BLAST of PIM-1-like protein vs. Ensembl Fly
Match: Unc-89 (gene:FBgn0053519 transcript:FBtr0343287)

HSP 1 Score: 55.0694 bits (131), Expect = 4.697e-8
Identity = 48/180 (26.67%), Postives = 85/180 (47.22%), Query Frame = 2
Query:  335 LSYYLVEFE-GEKLVKTIMRNLISIVYKMSDIGYYHRDIKPEN-IMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYF----CIEYEYA--FDTKIETQ----------KCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            L+Y+    E  E++V T++  L+  +  +   GY H +I+P+N +M + +++++KL+D        N++ + ++  G+L FQ PE  +  P    QS ++++G L Y     C  +  A  ++TK              K + PE       A  FI    K  P +R   +D L H WL
Sbjct: 3666 LTYFSSRHEYSEQMVATVVTQLLDALQYLHWRGYCHLNIQPDNVVMASVRSIQVKLVDFGSA-KKVNKLGMKVTPCGSLDFQPPEMINDEPI-FPQSDIWSLGALTYLLLSGCSPFRGADEYETKQNISFVRYRFENLFKEVTPE-------ATRFIMLLFKRHPTKRPYTEDCLEHRWL 3836          
BLAST of PIM-1-like protein vs. Ensembl Zebrafish
Match: pimr181 (Pim proto-oncogene, serine/threonine kinase, related 181 [Source:ZFIN;Acc:ZDB-GENE-141211-77])

HSP 1 Score: 81.6481 bits (200), Expect = 8.890e-18
Identity = 58/218 (26.61%), Postives = 102/218 (46.79%), Query Frame = 2
Query:  206 IPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYI-----GGDWMDLSYYLVEFE---GEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLID--LEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFD--TKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLE 823
            +P E+  +  +S+  YVP++I+ +D   W     +Y          MDL  +  +      E + + +M  +++   +  +   YH DIKPEN+++N  T +IKLID  +  ++  E     C    GT  +  PE  D   +  K + V++IG + Y  +  +Y     TKI  +     E    SK     I  C++ DP +RI  +++L H+W +
Sbjct:    7 VPHEVGLMYLMSKGPYVPQIIQLLD---WYETPSQYTLVLERPNSCMDLQTFAWKHRKKMTESVARLVMHQVVAAAIECCERDVYHSDIKPENVLINPHTFQIKLIDFGVGRIMNSEGYSTFC----GTKPYAPPEFSDCKKFYAKPATVYSIGVMLYRLLHRKYPRRELTKIVARTW---ERDKLSKECIDMICSCLQRDPQQRIPLEEILHHNWFQ 214          
BLAST of PIM-1-like protein vs. Ensembl Zebrafish
Match: pimr182 (Pim proto-oncogene, serine/threonine kinase, related 182 [Source:ZFIN;Acc:ZDB-GENE-141222-19])

HSP 1 Score: 75.485 bits (184), Expect = 1.221e-15
Identity = 54/216 (25.00%), Postives = 99/216 (45.83%), Query Frame = 2
Query:  206 IPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYI-----GGDWMDLSYYLVEFE---GEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLID--LEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLE 823
            +P E+  +  +S   YVP++I+ +D   W     +Y          MDL  +  +      E +V+ +M  +++      ++  YH DIKP+N+++N  T +IKLID  +  ++  E          GT  +  PE  D   ++ K + V++IG + Y  +  +      IE       E    SK     I  C++ +P +RI  +++L H+W +
Sbjct:    7 VPLEVGLMYLVSTGPYVPQIIQLLD---WYETPSQYTLVLERPNSCMDLQKFAWKHRKKMTESVVRLVMHQVVTAAIACCEMNVYHSDIKPQNVLINPHTFQIKLIDFGVGRIMTSEGYSTFG----GTQAYAPPEFSDCKKFHAKPATVYSIGIMLYRLLHRKSPHRELIEIVARTW-ERDRLSKECIDMICSCLQRNPRQRIPLEEILHHNWFQ 214          
BLAST of PIM-1-like protein vs. Ensembl Zebrafish
Match: pimr47 (Pim proto-oncogene, serine/threonine kinase, related 47 [Source:ZFIN;Acc:ZDB-GENE-090312-19])

HSP 1 Score: 76.6406 bits (187), Expect = 1.481e-15
Identity = 58/264 (21.97%), Postives = 114/264 (43.18%), Query Frame = 2
Query:   59 YSEFIILSESCKGIVIKALNEENNLVLLKTFYKIKKNGTFMKKTNSNFYIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYI-----GGDWMDLSYYLVEFE--GEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDL--EDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAY--FCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDW 817
            Y++  +L     G V   +   + L +   +    +  T +K  +    +P E+  +  ++     P +++ +D   W      Y+          DL  +  E     E+L K ++  LI+ +      G  HRD+KPEN+++++++ +IKL+D    D+L             GT  +  PE + +  YN   + V+++G   Y   C  + +    K+ ++  L+   K+S++  R  I  C+   P +R   DD+  H W
Sbjct:   86 YAKGPLLGRGGFGSVFAGIRRSDGLPVAIKYVSKDRTHTRLK-VDGQGRLPLEVALMTRVTSAPACPSVLQLLD---WFDRPRRYVLILERPAPCQDLQSFCEENGCLDERLAKKVLVQLIAALKHCESSGVLHRDVKPENLLISKESQDIKLLDFGCGDLLKRSAYKYFA----GTPAYAPPEWFRRHRYNATPATVWSVGVTLYNILCDRFPFRGAQKVTSKSRLIFPRKLSTE-CRHLIRWCLSAAPADRPSLDDIERHPW 340          
BLAST of PIM-1-like protein vs. Ensembl Zebrafish
Match: pimr182 (Pim proto-oncogene, serine/threonine kinase, related 182 [Source:ZFIN;Acc:ZDB-GENE-141222-19])

HSP 1 Score: 75.8702 bits (185), Expect = 2.182e-15
Identity = 52/216 (24.07%), Postives = 100/216 (46.30%), Query Frame = 2
Query:  206 IPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYI-----GGDWMDLSYYLVEFE---GEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLID--LEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLE 823
            +P E+  +  +S   YVP++I+ +D   W     +Y          MDL  +  +      E +V+ +M  +++      ++  YH DIKP+N+++N  T +IKLID  +  ++  E          GT  +  PE  D   ++ K + V++IG + Y  +  +      IE         ++S +     I  C++ +P +RI  +++L H+W +
Sbjct:   68 VPLEVGLMYLVSTGPYVPQIIQLLD---WYETPSQYTLVLERPNSCMDLQKFAWKHRKKMTESVVRLVMHQVVTAAIACCEMNVYHSDIKPQNVLINPHTFQIKLIDFGVGRIMTSEGYSTFG----GTQAYAPPEFSDCKKFHAKPATVYSIGIMLYRLLHRKSPHRELIEIVARTWERDRLSKECI-DMICSCLQRNPRQRIPLEEILHHNWFQ 275          
BLAST of PIM-1-like protein vs. Ensembl Zebrafish
Match: pimr180 (Pim proto-oncogene, serine/threonine kinase, related 180 [Source:ZFIN;Acc:ZDB-GENE-141222-35])

HSP 1 Score: 72.4034 bits (176), Expect = 1.022e-14
Identity = 45/157 (28.66%), Postives = 78/157 (49.68%), Query Frame = 2
Query:  365 EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLID--LEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFD--TKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLE 823
            E + + +M  +++   +  +   YH DIKPEN+++N  T +IKLID  +  ++  E     C    GT  +  PE  D   ++ K + V++IG + Y  +  +Y     TKI  +     E    SK     I  C++ DP +RI  +++L H+W +
Sbjct:   29 ESVARLVMHQVVAAAIECCERDVYHSDIKPENVLINPHTFQIKLIDFGVGRIMNSEGYSTFC----GTKPYAPPEFSDCKKFHAKPATVYSIGVMLYRLLHRKYPRRELTKIVARTW---ERDKLSKECIDMICSCLQRDPQQRIPLEEILQHNWFQ 178          
BLAST of PIM-1-like protein vs. Ensembl Xenopus
Match: ncbp1 (nuclear cap binding protein subunit 1 [Source:Xenbase;Acc:XB-GENE-5841194])

HSP 1 Score: 62.7734 bits (151), Expect = 1.006e-10
Identity = 57/223 (25.56%), Postives = 100/223 (44.84%), Query Frame = 2
Query:  179 MKKTNSNFYIPKELFFLEELSQY-EYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFE--GEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLID------LEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            MK  N    +P E++ L+++S     V +L+++ +  +   + ME       DL  ++ E    GE+L     R ++  V         HRDIK ENI+V+ +T E+KLID      L D +Y + +        GT  +  PE      Y+ + + V+++G L Y  +  +  F+   E  K  +      S+  +  I  C+   P +R   + +L H W+
Sbjct:   76 MKHMNGTL-VPLEIYLLKKVSNGCRGVIRLLDWYERPDGFIIIMER-PEPVQDLFDFITERGALGEELATNFFRQVVEAVRHCHSCDVVHRDIKDENILVDLRTAELKLIDFGSGALLRDAVYTDFD--------GTRVYSPPEWIRFHKYHGRSATVWSLGILLYDMVCGDIPFEHDDEILKGKIQYRCRVSRECQHLIEWCLSKRPSDRPSLEQILAHPWM 288          
BLAST of PIM-1-like protein vs. Ensembl Xenopus
Match: ncbp1 (nuclear cap binding protein subunit 1 [Source:Xenbase;Acc:XB-GENE-5841194])

HSP 1 Score: 62.7734 bits (151), Expect = 1.202e-10
Identity = 57/223 (25.56%), Postives = 100/223 (44.84%), Query Frame = 2
Query:  179 MKKTNSNFYIPKELFFLEELSQ-YEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFE--GEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLID------LEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            MK  N    +P E++ L+++S     V +L+++ +  +   + ME       DL  ++ E    GE+L     R ++  V         HRDIK ENI+V+ +T E+KLID      L D +Y + +        GT  +  PE      Y+ + + V+++G L Y  +  +  F+   E  K  +      S+  +  I  C+   P +R   + +L H W+
Sbjct:   95 MKHMNGTL-VPLEIYLLKKVSNGCRGVIRLLDWYERPDGFIIIMERPE-PVQDLFDFITERGALGEELATNFFRQVVEAVRHCHSCDVVHRDIKDENILVDLRTAELKLIDFGSGALLRDAVYTDFD--------GTRVYSPPEWIRFHKYHGRSATVWSLGILLYDMVCGDIPFEHDDEILKGKIQYRCRVSRECQHLIEWCLSKRPSDRPSLEQILAHPWM 307          
BLAST of PIM-1-like protein vs. Ensembl Xenopus
Match: b3galt5.2 (beta-1,3-galactosyltransferase 5 gene 2 [Source:Xenbase;Acc:XB-GENE-992036])

HSP 1 Score: 60.4622 bits (145), Expect = 1.192e-9
Identity = 50/189 (26.46%), Postives = 86/189 (45.50%), Query Frame = 2
Query:  383 IMRNLISIVYKMSDIGYYHRDIKPENIMVNQKT--LEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPE--MKV---------------SSKLARSFITECIKLDPDERIEFDDLLFHDWLEXXXXXXXXXXXSYNPMAIAESLG 892
            IMR L+S V  M D+G  HRD+KPEN +   ++   EIK+ID         +     +   TL + +PE  ++  Y+    L +++G + Y  +  +  F    +T +C   E  MK                 S+ A+  I   + +DP++RI+   L +++WL+        +  S NP+   + LG
Sbjct:  507 IMRRLVSAVSHMHDVGVVHRDLKPENFLFTDESDNSEIKIIDFGFARLKPPDNQPLKTPCFTLHYAAPELLNENGYDESCDL-WSLGVILYTMLSGQVPFQCHGKTLQCTSAEDIMKKIKQGDFSCEGEAWTNVSQEAKDLIQGLLTVDPNKRIKMSTLRYNEWLQ------DGSQLSSNPLMTPDILG 688          
BLAST of PIM-1-like protein vs. Ensembl Xenopus
Match: b3galt5.2 (beta-1,3-galactosyltransferase 5 gene 2 [Source:Xenbase;Acc:XB-GENE-992036])

HSP 1 Score: 60.4622 bits (145), Expect = 1.325e-9
Identity = 50/189 (26.46%), Postives = 86/189 (45.50%), Query Frame = 2
Query:  383 IMRNLISIVYKMSDIGYYHRDIKPENIMVNQKT--LEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPE--MKV---------------SSKLARSFITECIKLDPDERIEFDDLLFHDWLEXXXXXXXXXXXSYNPMAIAESLG 892
            IMR L+S V  M D+G  HRD+KPEN +   ++   EIK+ID         +     +   TL + +PE  ++  Y+    L +++G + Y  +  +  F    +T +C   E  MK                 S+ A+  I   + +DP++RI+   L +++WL+        +  S NP+   + LG
Sbjct:  477 IMRRLVSAVSHMHDVGVVHRDLKPENFLFTDESDNSEIKIIDFGFARLKPPDNQPLKTPCFTLHYAAPELLNENGYDESCDL-WSLGVILYTMLSGQVPFQCHGKTLQCTSAEDIMKKIKQGDFSCEGEAWTNVSQEAKDLIQGLLTVDPNKRIKMSTLRYNEWLQ------DGSQLSSNPLMTPDILG 658          
BLAST of PIM-1-like protein vs. Ensembl Xenopus
Match: b3galt5.2 (beta-1,3-galactosyltransferase 5 gene 2 [Source:Xenbase;Acc:XB-GENE-992036])

HSP 1 Score: 60.4622 bits (145), Expect = 1.353e-9
Identity = 52/190 (27.37%), Postives = 89/190 (46.84%), Query Frame = 2
Query:  383 IMRNLISIVYKMSDIGYYHRDIKPENIMVNQKT--LEIKLIDLE-DMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPE--MKV---------------SSKLARSFITECIKLDPDERIEFDDLLFHDWLEXXXXXXXXXXXSYNPMAIAESLG 892
            IMR L+S V  M D+G  HRD+KPEN +   ++   EIK+ID     L   +  P+  +   TL + +PE  ++  Y+    L +++G + Y  +  +  F    +T +C   E  MK                 S+ A+  I   + +DP++RI+   L +++WL+        +  S NP+   + LG
Sbjct:  484 IMRRLVSAVSHMHDVGVVHRDLKPENFLFTDESDNSEIKIIDFGFARLKPPDNQPL-KTPCFTLHYAAPELLNENGYDESCDL-WSLGVILYTMLSGQVPFQCHGKTLQCTSAEDIMKKIKQGDFSCEGEAWTNVSQEAKDLIQGLLTVDPNKRIKMSTLRYNEWLQ------DGSQLSSNPLMTPDILG 665          
BLAST of PIM-1-like protein vs. Ensembl Mouse
Match: Pim3 (proviral integration site 3 [Source:MGI Symbol;Acc:MGI:1355297])

HSP 1 Score: 60.8474 bits (146), Expect = 4.032e-10
Identity = 42/158 (26.58%), Postives = 73/158 (46.20%), Query Frame = 2
Query:  365 EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLID------LEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            E L +     +++ V    + G  HRDIK EN++V+ ++ E+KLID      L+D +Y + +        GT  +  PE      Y+ + + V+++G L Y  +  +  F+   E  +  L   +  S   +  I  C+ L P ER   D +  H W+
Sbjct:  144 EPLARRFFAQVLAAVRHCHNCGVVHRDIKDENLLVDLRSGELKLIDFGSGAVLKDTVYTDFD--------GTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLFFRRRVSPECQQLIEWCLSLRPSERPSLDQIAAHPWM 293          
BLAST of PIM-1-like protein vs. Ensembl Mouse
Match: Ikbkb (inhibitor of kappaB kinase beta [Source:MGI Symbol;Acc:MGI:1338071])

HSP 1 Score: 61.2326 bits (147), Expect = 4.910e-10
Identity = 46/142 (32.39%), Postives = 77/142 (54.23%), Query Frame = 2
Query:  254 VPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEG-----EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQ--KTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCI 658
            VP+ ++ +  N+   +AMEY  G   DL  YL +FE      E  V T++ ++ S +  + +    HRD+KPENI++ Q  K L  K+IDL     + ++  +C S +GTL + +PE  ++  Y +     ++ G LA+ CI
Sbjct:   79 VPEGMQNLAPNDLPLLAMEYCQGG--DLRRYLNQFENCCGLREGAVLTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEKRLIHKIIDL-GYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVD-YWSFGTLAFECI 216          
BLAST of PIM-1-like protein vs. Ensembl Mouse
Match: Ikbkb (inhibitor of kappaB kinase beta [Source:MGI Symbol;Acc:MGI:1338071])

HSP 1 Score: 61.2326 bits (147), Expect = 5.683e-10
Identity = 46/142 (32.39%), Postives = 77/142 (54.23%), Query Frame = 2
Query:  254 VPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEG-----EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQ--KTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCI 658
            VP+ ++ +  N+   +AMEY  G   DL  YL +FE      E  V T++ ++ S +  + +    HRD+KPENI++ Q  K L  K+IDL     + ++  +C S +GTL + +PE  ++  Y +     ++ G LA+ CI
Sbjct:   79 VPEGMQNLAPNDLPLLAMEYCQGG--DLRRYLNQFENCCGLREGAVLTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEKRLIHKIIDL-GYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVD-YWSFGTLAFECI 216          
BLAST of PIM-1-like protein vs. Ensembl Mouse
Match: Rps6ka5 (ribosomal protein S6 kinase, polypeptide 5 [Source:MGI Symbol;Acc:MGI:1920336])

HSP 1 Score: 60.4622 bits (145), Expect = 9.250e-10
Identity = 65/271 (23.99%), Postives = 115/271 (42.44%), Query Frame = 2
Query:  182 KKTNSNFYIP-----------KELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQK--TLEIKLIDLE-DMLYDENEIPI---CISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKC-----LLPEMKVS------------SKLARSFITECIKLDPDERIEFDDLLFHDWLEXXXXXXXXXXXSYNPMAIAESLG 892
            KKTN  F +            KE+  L+    +  + KL E   +   + + ME + G  +       +   E     IMR L+S V  M D+G  HRD+KPEN++   +   LEIK+ID     L   +  P+   C     TL + +PE      Y+    L +++G + Y  +  +  F +   +  C     ++ ++K              S+ A+  I   + +DP++R++   L +++WL+        +  S NP+   + LG
Sbjct:  445 KKTNQAFAVKIISKRMEANTQKEITALKLCEGHPNIVKLHEVFHDQLHTFLVMELLNGGELFERIKRKKHFSETEASYIMRKLVSAVSHMHDVGVVHRDLKPENLLFTDENDNLEIKVIDFGFARLKPPDNQPLKTPCF----TLHYAAPELLTHNGYDESCDL-WSLGVILYTMLSGQVPFQSHDRSLTCTSAVEIMKKIKKGDFSFEGEAWKNVSQEAKDLIQGLLTVDPNKRLKMSGLRYNEWLQ------DGSQLSSNPLMTPDILG 704          
BLAST of PIM-1-like protein vs. Ensembl Mouse
Match: Ikbkb (inhibitor of kappaB kinase beta [Source:MGI Symbol;Acc:MGI:1338071])

HSP 1 Score: 60.077 bits (144), Expect = 1.004e-9
Identity = 46/142 (32.39%), Postives = 77/142 (54.23%), Query Frame = 2
Query:  254 VPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEG-----EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQ--KTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCI 658
            VP+ ++ +  N+   +AMEY  G   DL  YL +FE      E  V T++ ++ S +  + +    HRD+KPENI++ Q  K L  K+IDL     + ++  +C S +GTL + +PE  ++  Y +     ++ G LA+ CI
Sbjct:   79 VPEGMQNLAPNDLPLLAMEYCQGG--DLRRYLNQFENCCGLREGAVLTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEKRLIHKIIDL-GYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVD-YWSFGTLAFECI 216          
BLAST of PIM-1-like protein vs. UniProt/SwissProt
Match: sp|U4PR86|MELK_CAEEL (Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans OX=6239 GN=pig-1 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.207e-12
Identity = 61/222 (27.48%), Postives = 105/222 (47.30%), Query Frame = 2
Query:  206 IPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYI-GGDWMDLSYYLVEFEG--EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDL------EDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFD--------TKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            +  E+  L  LS ++ + +L  YI+  +   + MEY  GG+  D   Y+V  E   E   +   R L+S +  +   GY HRD+KPEN+++ +  L +KLID       E    D++ +  C    G+  + +PE    + Y   ++ V+++G L Y  +     F+         KI++     PE    S L++  +   +++ P+ RI    LL HDWL
Sbjct:   54 VQTEMDALRNLS-HQNICRLYHYIETEDKFFIVMEYCSGGEMFD---YIVRKERLEESEARHFFRQLVSAIAFVHSQGYAHRDLKPENLLLTE-DLHLKLIDFGLCAKTEKGRIDKHNLDTCC---GSPAYAAPELIQGLQYKGNEADVWSMGILLYTLLVGALPFEDDNMQIMYKKIQSGCFYEPEF--LSPLSKQLLRAMLQVVPERRISVKKLLEHDWL 265          
BLAST of PIM-1-like protein vs. UniProt/SwissProt
Match: sp|Q9Y899|KCC1B_EMEND (Calcium/calmodulin-dependent protein kinase cmkB OS=Emericella nidulans OX=162425 GN=cmkB PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 7.116e-12
Identity = 56/226 (24.78%), Postives = 106/226 (46.90%), Query Frame = 2
Query:  206 IPKELFFLEELSQ-YEYVPKLIEYIDE-NNWSTVAMEYIGGDWMDL-----SYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIM--VNQKTLEIKLIDLE-DMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYF--CIEYEYAFDTKIETQKCLLPE---------MKVSSKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            +  E+  L+++S  ++ +  L++Y +  NN   V    +GG+  D      SYY      E     ++R ++S V  + D G  HRD+KPEN++    +   ++ + D     + DE ++ +  +  GT G+ +PE +DK  +  K   ++ IG + YF  C    +  +T +E  + +             +  S+ AR FI  C+ ++P +R+     L H W+
Sbjct:   61 VRNEIAILKQVSTGHQNILTLVDYFETMNNLYLVTDLALGGELFDRICRKGSYY------ESDAADLVRAILSAVAYLHDHGIVHRDLKPENLLFRTPEDNADLLIADFGLSRIMDEEQLHVLTTTCGTPGYMAPEIFDKSGHG-KPVDIWAIGLITYFMLCGYTPFDRETNLEEVQAIATANFSFTPVEYWRGVSQEARDFIKRCLTVNPKKRMTAHQALQHPWI 279          
BLAST of PIM-1-like protein vs. UniProt/SwissProt
Match: sp|P32491|MKK2_YEAST (MAP kinase kinase MKK2/SSP33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MKK2 PE=1 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 9.127e-12
Identity = 74/273 (27.11%), Postives = 122/273 (44.69%), Query Frame = 2
Query:   74 ILSESCKGIVIKA-LNEENNLVLLKTFYKIKKNGTFMKKTNSNFYIPKELFFLEELSQYEYVPKLIEYIDENNWST-VAMEYIGGDWMDLSYY-LVEFEG---EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLL-----------------PEMKVS-SKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            IL E   G V K  L     +  LKT   +  +  + K+      I +EL F +       V     + DE + S  +AMEY+GG  ++ +Y  L++  G   E+++  I  +++  +  + +    HRDIKP+NI++N+K  EIKL D    +  E    + ++  GT  + +PE     PY++    V+++G          + F++   TQ                     PE+ +S SK  RSFI  C+K D  ER     +L H W+
Sbjct:  219 ILGEGAGGSVAKCRLKNGKKVFALKTINTMNTDPEYQKQ------IFRELQFNKSFKSDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKG-EIKLCDFG--VSGEAVNSLAMTFTGTSFYMAPERIQGQPYSVTCD-VWSLGLTLLEVAGGRFPFESDKITQNVAPIELLTMILTFSPQLKDEPELDISWSKTFRSFIDYCLKKDARERPSPRQMLKHPWI 481          
BLAST of PIM-1-like protein vs. UniProt/SwissProt
Match: sp|Q7PLI7|DCLK_DROME (Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster OX=7227 GN=CG17528 PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.412e-10
Identity = 62/228 (27.19%), Postives = 102/228 (44.74%), Query Frame = 2
Query:  203 YIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYI-GGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMV----NQKTLEIKLID------LEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLL------------PEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDW 817
            YI  E+  +++L+ + ++  LI  +D+N    + +EY+ GGD  D    +  F  E   + ++R+L + +  +  +G  HRDIKPEN++V    +   LE+KL D      + D+LY      +C    GT  + +PE   +V Y LK   V+  G + Y  +     F      Q+ L             P         R  I   ++ DPD R   +D+L H W
Sbjct:  519 YIDAEVRVMKKLN-HPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFS-ENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKLDEHGNVLELKLADFGLACEVNDLLY-----AVC----GTPTYVAPEILLEVGYGLKID-VWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHSW 734          
BLAST of PIM-1-like protein vs. UniProt/SwissProt
Match: sp|B4NSS9|DCLK_DROSI (Serine/threonine-protein kinase GD17699 OS=Drosophila simulans OX=7240 GN=GD17699 PE=3 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.572e-10
Identity = 62/229 (27.07%), Postives = 102/229 (44.54%), Query Frame = 2
Query:  200 FYIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYI-GGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMV----NQKTLEIKLID------LEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLL------------PEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDW 817
             YI  E+  +++L+ + ++  LI  +D+N    + +EY+ GGD  D    +  F  E   + ++R+L + +  +  +G  HRDIKPEN++V    +   LE+KL D      + D+LY      +C    GT  + +PE   +V Y LK   V+  G + Y  +     F      Q+ L             P         R  I   ++ DPD R   +D+L H W
Sbjct:  514 HYIDAEVRVMKKLN-HPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFS-ESQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKLDEHGHVLELKLADFGLACEVNDLLY-----AVC----GTPTYVAPEILLEVGYGLKID-VWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHPW 730          
BLAST of PIM-1-like protein vs. TrEMBL
Match: A0A2P1ERR9 (PIM-1-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 456.447 bits (1173), Expect = 1.353e-160
Identity = 236/241 (97.93%), Postives = 238/241 (98.76%), Query Frame = 2
Query:  179 MKKTNSNFYIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLEXXXXXXXXXXXSYNPMAIAESLGEMF 901
            MKKTNSNFYIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQ+TLEIKLIDLEDMLYDENEIP CISELGTLGFQSPETY KVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDP+ERIEFDDLLFHDWLENENNVDKNNINSYNPMAIAESL EMF
Sbjct:    1 MKKTNSNFYIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQRTLEIKLIDLEDMLYDENEIPKCISELGTLGFQSPETYGKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPNERIEFDDLLFHDWLENENNVDKNNINSYNPMAIAESLREMF 241          
BLAST of PIM-1-like protein vs. TrEMBL
Match: A0A498MXV6 (Serine threonine-kinase pim-1-like protein OS=Labeo rohita OX=84645 GN=ROHU_036603 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.146e-16
Identity = 81/283 (28.62%), Postives = 126/283 (44.52%), Query Frame = 2
Query:   17 MDTDKILKSLTKRNYSEFII--LSESCKGIVIKALNEENNLVLLKTFYKIKKNGTFMKKTNSNFYIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYI-----GGDWMDLSYYLVEFEG----EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLID--LEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCI--EYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            +D DKI +      ++  I   L E   G V      E+ L +   F +  ++  ++  T+    +P E+      +Q      +IE +D   W      YI         MD+  Y  E  G    E LV   MR  I         G +HRDIK  N++VN +T+E+KLID  + D+L     I       GT  F  PE + K  Y+ KQ+ V+++G L +  +   Y Y+ DTK+     +  E   S    R FI  C+K +P++R+  +++L HDW 
Sbjct:  178 LDCDKITRDKDPICWTYAIGEKLGEGGCGSVFAGTRVEDGLQVAVKFTEKGEDEPYLSLTDHPSPVPAEVALTVMANQGPRCRHIIELLD---WQDNPDHYIMVLERPSPCMDMHDYF-EHHGDLFTEALVCHFMRQAIEAAVVCCSRGVFHRDIKMSNLLVNTETMEVKLIDFGVGDLLKSSPYIFF----SGTANFCPPEYFTKGEYHGKQATVWSLGVLLFNMMTNRYPYSSDTKL-MDAGVWTEPDFSDDCCR-FIRGCLKSNPEQRVHLEEMLSHDWF 450          
BLAST of PIM-1-like protein vs. TrEMBL
Match: A0A556TUR0 (Serine/threonine-protein kinase pim-3 OS=Bagarius yarrelli OX=175774 GN=Baya_5442 PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 3.269e-16
Identity = 65/215 (30.23%), Postives = 111/215 (51.63%), Query Frame = 2
Query:  203 YIPKELFFLEELSQY---EYVPKLIEYIDENNWSTVAMEYIGGDWMDL-SYYLVEFEG--EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDL--EDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLE 823
            ++P E+  +E  S+    E V +L+E+ + +N   + +E      MDL S+Y    +   E L +TIMR ++    +  D G +HRDIKPEN+++N +TLE+KLID    D++ DE       S  GT  +  PE   +  Y    + V+++G   +  +  +  F+ + E     LP +   S+   S I+ C+  DP++R   D++L H W +
Sbjct:  193 HLPMEVVLMELTSRAPCCENVVELLEWFEMSNHFILVLERPKSS-MDLESFYNRNRKNLPEPLSRTIMRQVVRAASQCFDRGVFHRDIKPENLLINPETLEVKLIDFGCGDLMKDE----FYSSYSGTPAYTPPEWIVEKKYLAVPATVWSLGVFLFEMVSGDLPFNNEEEISAACLPLVNGVSEECYSLISWCLTKDPNQRPSLDEILNHSWFK 402          
BLAST of PIM-1-like protein vs. TrEMBL
Match: A0A418D811 (Protein kinase domain-containing protein OS=Aphanomyces astaci OX=112090 GN=DYB35_004525 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 5.328e-16
Identity = 54/212 (25.47%), Postives = 95/212 (44.81%), Query Frame = 2
Query:  215 ELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDK-VPYNLKQSLVFNIGCLAYFCIEYEYAFDT--------KIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLE 823
            EL  L +L     V  L+    ++    +   Y+GG  +  +    +   E  ++T++R L+ ++  M  +G  HRD+KPEN+++ +    +K++D      D++  P  +   GT  F +PE +D  VPY  K   ++ +G   +  +     F+         KI   +  LP  +  S  ARSF+  C+      R     LL H WL+
Sbjct:   37 ELRALSQLRAQPQVLTLLAVYQDDTTVALVTSYVGGGQLVPALCARKSINEHTIRTLVRELVEVLAAMHSLGITHRDLKPENLLLEEAD-RLKVVDFGISHIDDSNHPPMVGLCGTGPFMAPEVFDTNVPYTSKVD-IWALGVCVFVLVTGHVPFEAKFMSAMEDKIRAGEYTLPPHQHVSATARSFVATCLNTVASNRPSAKSLLLHPWLD 246          
BLAST of PIM-1-like protein vs. TrEMBL
Match: A0A3R6Z579 (Protein kinase domain-containing protein OS=Aphanomyces astaci OX=112090 GN=DYB37_003510 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 5.375e-16
Identity = 58/257 (22.57%), Postives = 111/257 (43.19%), Query Frame = 2
Query:   80 SESCKGIVIKALNEENNLVLLKTFYKIKKNGTFMKKTNSNFYIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDK-VPYNLKQSLVFNIGCLAYFCIEYEYAFDT--------KIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLE 823
             ++C+    +A  +   +V +K         +++   +    +  EL  L +L     V  L+    ++    +   Y+GG  +  +    +   E  ++T++R L+ ++  M  +G  HRD+KPEN+++ +    +K++D      D++  P  +   GT  F +PE +D  VPY  K   ++ +G   +  +     F+         KI   +  LP  +  S  ARSF+  C+      R     LL H WL+
Sbjct:   43 GKTCRVYRARAKQDATTIVAVKVI-----QTSYLSTPSRVHALECELRALSQLRAQPQVLTLLAVYQDDTTVALVTSYVGGGQLVPALCARKSINEHTIRTLVRELVEVLAAMHSLGITHRDLKPENLLLEEAD-RLKVVDFGISHIDDSNHPPMVGLCGTGPFMAPEVFDTNVPYTSKVD-IWALGVCVFVLVTGHVPFEAKFMSAMEDKIRAGEYTLPPHQHVSATARSFVATCLNTVASNRPSAKSLLLHPWLD 292          
BLAST of PIM-1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000030133.1 (serine/threonine-protein kinase pim-3-like [Source:NCBI gene;Acc:103028120])

HSP 1 Score: 78.9518 bits (193), Expect = 2.111e-16
Identity = 67/257 (26.07%), Postives = 114/257 (44.36%), Query Frame = 2
Query:   77 LSESCKGIVIKALNEENNLVLLKTFYKIKKNGTFMKKTNSNFYIPKELFFLEELSQ--YEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEG---EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLE-DMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLAR---SFITECIKLDPDERIEFDDLLFHDWL 820
            L E   G V       + L +   F + ++N  +++ + ++  IP E+  +E++S+   + + +LI++ DE     V ME      MDL  ++    G   EK  + IM   I  V +    G  HRDIK EN ++N  T E+KL+D      + E E+   I   GT  F  PE +    Y+   S V+++G   Y  +   + F T+ E    +  +++    L+      I  C++ DP  R     +  H W 
Sbjct:   68 LGEGGFGTVFAGTRVSDGLQVAIKFVRKQQNDRYVQSSVNSRSIPIEVALIEKMSEPPVKSIIQLIQWFDEPERYIVVMELFR-PCMDLLDFMCSKRGFFTEKKARHIMVQAIKAVTECHKRGVLHRDIKLENFLINTNTFEVKLVDFGCGDFFTERELNHYI---GTEEFCPPEFFLSRSYHAAPSTVWSLGVFLYTMVHGYHPFTTRHEI---IAGDLRFGDHLSNEVCDLIRWCLQDDPTWRPSLQQIFGHPWF 317          
BLAST of PIM-1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000040711.1 (serine/threonine-protein kinase pim-1-like [Source:NCBI gene;Acc:103035777])

HSP 1 Score: 75.0998 bits (183), Expect = 4.420e-15
Identity = 66/264 (25.00%), Postives = 115/264 (43.56%), Query Frame = 2
Query:   59 YSEFIILSESCKGIVIKALNEENNLVLLKTFYKIKKNGTFMKKTNSNFYIPKELFFLEELSQYEY--VPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEG---EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDL--EDML--YDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLE 823
            Y   + + E   G+V +     + L +   F   +    ++   + +  IP E+  ++ +S+     + +LIE+ D+  +  + +E      +DL  +L  F G   E + + IM  ++    +    G  HRDIKPEN ++N  TLE+KLID    D L  Y  N         GT  +  PE + K  Y+ K + V+++G   +  +     F    +    LL      S      I +C++  P +R    ++L HDWL 
Sbjct:   51 YITGVKIGEGAFGLVHEGTRRSDGLQVAIKFVVKRDTTQYVPSADGSKPIPMEVALMQRMSEPPVTNIIRLIEWFDDPRYYILVLERFQ-PCLDLKDFLDIFGGSLTEDMARHIMPQVVKAAGECLKRGVLHRDIKPENFLINPNTLELKLIDFGCGDWLKKYGYNLYS------GTFEYVPPELFRKRRYHSKTATVWSLGIFLFRMLCGSCPFKNAKDIVAGLLYFKDGLSDECCDLIRQCLQYIPAKRPTIREILKHDWLH 307          
BLAST of PIM-1-like protein vs. Ensembl Cavefish
Match: pim1 (serine/threonine-protein kinase pim-1-like [Source:NCBI gene;Acc:103031835])

HSP 1 Score: 69.707 bits (169), Expect = 3.196e-13
Identity = 56/221 (25.34%), Postives = 111/221 (50.23%), Query Frame = 2
Query:  194 SNFYIPKELFFLEELSQ-YEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEG--EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLID------LEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAY--FCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLE 823
            +   +P E+  L+++S  +  V K++++ +  +   + ME    +  DL  ++ E     E+L ++  R ++  V    + G  HRDIK ENI+++ ++ E+KLID      L+D +Y + +        GT  +  PE      Y+ + + V+++G L Y   C +  +  D +I   + L    ++S++  +  I  C+ L P +R  F+DL+ H W++
Sbjct:   81 TGARVPMEIVLLKKVSTGFRGVIKMLDWYERPDSFIIVMER-PENAKDLFDFITEKGALPEELARSFFRQVLEAVRHCHNSGVVHRDIKDENILIDLRSGELKLIDFGSGALLKDTVYTDFD--------GTRVYSPPEWIKYHRYHGRSATVWSLGILLYDMVCGDIPFEQDEEIVRGQVLF-RRRISTE-CQQLIKWCLALRPADRPSFEDLVNHPWMQ 290          
BLAST of PIM-1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000037345.1 (serine/threonine-protein kinase pim-1-like [Source:NCBI gene;Acc:111193727])

HSP 1 Score: 68.5514 bits (166), Expect = 7.417e-13
Identity = 64/263 (24.33%), Postives = 113/263 (42.97%), Query Frame = 2
Query:   59 YSEFIILSESCKGIVIKALNEENNLVLLKTFYKIKKNGTFMKKTNSNF-YIPKELFFLEELSQ--YEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEG---EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDL--EDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLE 823
            YS  + L +   G V +     + L +   F   + +  +++  + +   +P E+  +  +S    + + KLIE+ DE     + +E      +DL  +L    G   + +VK IM   +    K    G  HRDIKP+N ++N  T+E+KLID    D +  +          GT  +  PE      Y+ + + V+++G L +  I   + F T  +  + +       S      I  C++ +P  R  F  +L HDW E
Sbjct:   73 YSTGVKLGQGSFGAVFEGTRLCDGLQVAIKFVTKRDSDCYVQSVDDDSKSVPIEVALMLRMSNPPVDNIVKLIEWFDEPERFILILERPQ-PCIDLETFLDSNGGSLTKTMVKDIMLQAVRAARKCCQRGVLHRDIKPKNFVINTDTMELKLIDFGCGDWVRRDGYANF----AGTFKYCPPEYLLSKRYHARSATVWSLGVLLFRMICGYHPFTTAKDILEGISYLENSQSDECWDLIHWCLQCEPAMRPSFQQILLHDWFE 330          
BLAST of PIM-1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000012249.2 (pep primary_assembly:Astyanax_mexicanus-2.0:10:9011990:9016852:-1 gene:ENSAMXG00000035243.1 transcript:ENSAMXT00000012249.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 1.247e-12
Identity = 50/174 (28.74%), Postives = 80/174 (45.98%), Query Frame = 2
Query:  329 MDLSYYLVEFEG---EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLID------LEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLE 823
            MDL+ ++    G   E+  K+IM   +  V    + G +HRDIK EN ++N +TLE+KLID      ++   Y+        S  GT  +  PE   +  Y+ K + V+++G L Y  +   + F    E    L    K  S      I  C++  P+ R  F+ +L H+W  
Sbjct:  196 MDLNIFIHRCGGSLNERTAKSIMLQAVQAVRTCHERGVFHRDIKLENFLINPRTLELKLIDFGCGDWVKSTGYN--------SFAGTRIYCPPEHLIEGRYHAKPATVWSLGVLLYRMVCGFFPFRNDWEICGGLRCIRKGLSHECCDLIMRCLQPRPNWRPCFEQILHHNWFH 361          
BLAST of PIM-1-like protein vs. Ensembl Sea Lamprey
Match: camk2a (calcium/calmodulin-dependent protein kinase II alpha [Source:ZFIN;Acc:ZDB-GENE-051113-72])

HSP 1 Score: 57.3806 bits (137), Expect = 1.028e-9
Identity = 46/171 (26.90%), Postives = 74/171 (43.27%), Query Frame = 2
Query:  353 EFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKT--LEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAY-FCIEYEYAFDTKIETQKCLL------------PEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            E+  E    T ++ ++  V     +G  HRD+KPEN+++  KT    +KL D    +  + E        GT G+ SPE   K PY  K   ++  G + Y   + Y   +D   E Q  L             PE    +  A+S I + + ++P +RI   + L H W+
Sbjct:   14 EYYSEADASTGIQQILEAVLHCHQLGIVHRDLKPENLLLASKTKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRKDPYG-KPVDMWACGVILYILLVGYPPFWD---EDQHRLYQQIKAGAYDFPSPEWDTVTPEAKSLINQMLTINPAKRITASEALTHPWI 180          
BLAST of PIM-1-like protein vs. Ensembl Sea Lamprey
Match: rps6ka5 (ribosomal protein S6 kinase, polypeptide 5 [Source:ZFIN;Acc:ZDB-GENE-130530-693])

HSP 1 Score: 52.7582 bits (125), Expect = 3.846e-8
Identity = 42/168 (25.00%), Postives = 78/168 (46.43%), Query Frame = 2
Query:  383 IMRNLISIVYKMSDIGYYHRDIKPENIMVNQKT--LEIKLIDLE-DMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKC-----LLPEMKVS------------SKLARSFIT-ECIKLDPDERIEFDDLLFHDWLE 823
            IMR L+S    M D G  HRD+KPEN++    T    IK+ID     L  ++  P+  +   TL + +PE      Y+ +   V+++G + Y  +  +  F +  +   C     ++ ++K              S+ A+  I    + +DP +R++   L +++WL+
Sbjct:  209 IMRKLVSATSFMHDTGVVHRDLKPENLLFADDTEGAAIKVIDFGFARLKPQDNAPL-KTPCFTLQYAAPELLQHAGYD-ESCDVWSLGVILYTMLSGQVPFQSHGQPMTCSSATDIMRKIKEGDFSFEGEAWQNVSQAAKDLIQGRLLTVDPSKRVKMSGLRYNEWLQ 374          
BLAST of PIM-1-like protein vs. Ensembl Sea Lamprey
Match: snrka (SNF related kinase a [Source:ZFIN;Acc:ZDB-GENE-040718-84])

HSP 1 Score: 52.373 bits (124), Expect = 5.592e-8
Identity = 49/208 (23.56%), Postives = 91/208 (43.75%), Query Frame = 2
Query:  233 ELSQYEYVPKLIEYIDENNWSTVAMEYI-GGDWMDLSYYLVEFEG---EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLID--LEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCI----EYEYAFDTKIET--QKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            +L Q+  V +L E ID      + +E   GGD  D   Y++  EG   E+L KT    ++  +     +   HRD+KPEN++  +K   +KL D    ++     ++    +  G+L + +PE      Y+     ++++G + Y  +     ++ A D++  T    C        S+  +  I   ++ DP  R    ++  H WL
Sbjct:   69 KLVQHPNVVRLYEVIDTQTKLYLILELADGGDLYD---YIMRHEGGLQEELAKTYFAQVVHAISYCHRLHVVHRDLKPENVVFFEKQGLVKLTDFGFSNLFQPGTKL---ATSCGSLAYSAPEILLGDEYDAPAVDIWSLGVILYMLVCGHPPFQEANDSETLTMIMDCKYTVPAHISRECKDLIARMLQRDPRRRASLQEMEGHPWL 270          
BLAST of PIM-1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008748.1 (pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 gene:ENSPMAG00000007907.1 transcript:ENSPMAT00000008748.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 2.169e-7
Identity = 46/208 (22.12%), Postives = 87/208 (41.83%), Query Frame = 2
Query:  233 ELSQYEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQ--KTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAY--------FCIEYEYAFDTKIETQKCLL--PEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWL 820
             L ++  + +L E I E  +  +  + + G  +       E+  E      ++ ++  V+     G  HRD+KPEN+++    K   +KL D    +  + +        GT G+ SPE   K PY  K   ++  G + Y        F  E ++    +I+        PE    +  A++ I + + ++P +RI   + L H W+
Sbjct:   66 RLLKHSNIVRLHESIAEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHHCHQHGIVHRDLKPENLLLASKMKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYG-KPVDMWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTAEAKNLINQMLTINPAKRITAAEALKHPWI 272          
BLAST of PIM-1-like protein vs. Ensembl Sea Lamprey
Match: plk3 (polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-030131-6134])

HSP 1 Score: 49.2914 bits (116), Expect = 5.958e-7
Identity = 54/229 (23.58%), Postives = 95/229 (41.48%), Query Frame = 2
Query:  179 MKKTNSNFYIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDENEIP------ICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTK--IETQKCLL-------PEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            ++K      I +E+    +L  + ++ + I    + N+  + +E   G  +       +   E  VK  +R LIS +  +   G  HRD+K  N  V   ++E+K+ DL   L    E P      +C    GT  + +PE  +K  +   ++ ++++GC  +  +     F T     T  C+        P +   S  AR  +T  +  DPD R    DL  H +L
Sbjct:   63 VEKPGHRAKIEQEISLHRKL-HHRHIVQFISSFKDENFIYIILELCNGQSLAHMLRSRKVLTETEVKYYLRQLISGLRYLHQCGVVHRDLKLGNFFVTD-SMEVKIGDLG--LATTLEPPEMRKRTVC----GTPNYLAPEVLNKRGHG-PEADIWSLGCAVFTMLAGRPPFSTSDLANTYACIRSGRFNFPPSL---SHAARDLLTSALTPDPDLRASLLDLQSHPFL 279          
BLAST of PIM-1-like protein vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 68.9366 bits (167), Expect = 1.314e-13
Identity = 74/273 (27.11%), Postives = 122/273 (44.69%), Query Frame = 2
Query:   74 ILSESCKGIVIKA-LNEENNLVLLKTFYKIKKNGTFMKKTNSNFYIPKELFFLEELSQYEYVPKLIEYIDENNWST-VAMEYIGGDWMDLSYY-LVEFEG---EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLL-----------------PEMKVS-SKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            IL E   G V K  L     +  LKT   +  +  + K+      I +EL F +       V     + DE + S  +AMEY+GG  ++ +Y  L++  G   E+++  I  +++  +  + +    HRDIKP+NI++N+K  EIKL D    +  E    + ++  GT  + +PE     PY++    V+++G          + F++   TQ                     PE+ +S SK  RSFI  C+K D  ER     +L H W+
Sbjct:  219 ILGEGAGGSVAKCRLKNGKKVFALKTINTMNTDPEYQKQ------IFRELQFNKSFKSDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKG-EIKLCDFG--VSGEAVNSLAMTFTGTSFYMAPERIQGQPYSVTCD-VWSLGLTLLEVAGGRFPFESDKITQNVAPIELLTMILTFSPQLKDEPELDISWSKTFRSFIDYCLKKDARERPSPRQMLKHPWI 481          
BLAST of PIM-1-like protein vs. Ensembl Yeast
Match: RAD53 (DNA damage response protein kinase; required for cell-cycle arrest, regulation of copper genes in response to DNA damage; phosphorylates nuclear pores to counteract gene gating, preventing aberrant transitions at forks approaching transcribed genes; activates downstream kinase Dun1p; differentially senses mtDNA depletion, mitochondrial ROS; relocalizes to cytosol under hypoxia; human homolog CHEK2 implicated in breast cancer can complement yeast null mutant [Source:SGD;Acc:S000006074])

HSP 1 Score: 58.9214 bits (141), Expect = 3.076e-10
Identity = 55/233 (23.61%), Postives = 106/233 (45.49%), Query Frame = 2
Query:  206 IPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYI-GGDWMDL--SYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQ-KTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLK----------QSLV--FNIGCLAYFCIEYEYAFDTKIETQ-----------KCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLE 823
            + +EL  L++L+    V +L  + ++     + ME++ GGD MD   ++  V   GE   + I R +++ +  +  +G  HRD+KP+NI++ Q   + +K+ D   +   +       +  GTL + +PE       ++            SLV  +++GCL Y  +     F    + Q           +  L + ++S + AR FI   +++DP+ R      L H W++
Sbjct:  241 VTRELEVLQKLNHPRIV-RLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAV---GEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDF-GLAKVQGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQDQLYKQIGRGSYHEGPLKDFRISEE-ARDFIDSLLQVDPNNRSTAAKALNHPWIK 467          
BLAST of PIM-1-like protein vs. Ensembl Yeast
Match: MKK1 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p; MKK1 has a paralog, MKK2, that arose from the whole genome duplication [Source:SGD;Acc:S000005757])

HSP 1 Score: 58.5362 bits (140), Expect = 3.283e-10
Identity = 71/274 (25.91%), Postives = 120/274 (43.80%), Query Frame = 2
Query:   74 ILSESCKGIVIKA-LNEENNLVLLKTFYKIKKNGTFMKKTNSNFYIPKELFFLEELSQYEYVPKLIEYI--DENNWSTVAMEYIGGDWMDLSYY-LVEFEG---EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSL------VFNIGCLAYFCIEYEYAFD-TKIETQKCLL---PEMK-------VSSKLARSFITECIKLDPDERIEFDDLLFHDWLE 823
            IL E   G V K  L   + +  LK    +  +  + K+      I +EL F     Q EY+ +       DEN+   +AMEY+GG  +D  Y  L+E  G   EK++  I   ++  +  + +    HRDIKP+NI++N+   ++KL D    +  E    +  +  GT  + +PE     PY++   +      +  +    + C   + A +    E    +L   PE+K       + S   +SFI  C+K D  ER     ++ H W++
Sbjct:  226 ILGEGAGGSVSKCKLKNGSKIFALKVINTLNTDPEYQKQ------IFRELQFNRSF-QSEYIVRYYGMFTDDENSSIYIAMEYMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENG-QVKLCDFG--VSGEAVNSLATTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKFPCSSEKMAANIAPFELLMWILTFTPELKDEPESNIIWSPSFKSFIDYCLKKDSRERPSPRQMINHPWIK 489          
BLAST of PIM-1-like protein vs. Ensembl Yeast
Match: PSK1 (PAS domain-containing serine/threonine protein kinase; coordinately regulates protein synthesis and carbohydrate metabolism and storage in response to a unknown metabolite that reflects nutritional status; PSK1 has a paralog, PSK2, that arose from the whole genome duplication [Source:SGD;Acc:S000000015])

HSP 1 Score: 57.3806 bits (137), Expect = 1.123e-9
Identity = 62/256 (24.22%), Postives = 119/256 (46.48%), Query Frame = 2
Query:   98 IVIKALNEENNLVLLKTFYKIKKNGTFMKKTNSNFYIPKELFFLEELSQ--YEYVPKLIEYIDENNWSTVAMEYIGG-------DWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYE---YAFDTKIETQKCLLPEMKVSS---KLARSFITECIKLDPDERIEFDDLLFHDWL 820
            +VIK + +E   +L+ T+ + +K GT          IP E+  +  L++  +E + +L+++ +++++  +     G        D ++    + EFE     K I + +++ +  + D G  HRDIK EN++V+ K   +K+ID     Y ++  P  +  +GT+ + +PE     PY  +   ++ IG L Y  +  E   Y  D  +E         +VS    +L +S +  C+     +R   DD+    WL
Sbjct: 1122 VVIKMIFKER--ILVDTWVRDRKLGT----------IPSEIQIMATLNKKPHENILRLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFKTNMTEFEA----KLIFKQVVAGIKHLHDQGIVHRDIKDENVIVDSKGF-VKIIDFGSAAYVKSG-PFDVF-VGTIDYAAPEVLGGNPYEGQPQDIWAIGILLYTVVFKENPFYNIDEILEGDLKFNNAEEVSEDCIELIKSILNRCVP----KRPTIDDINNDKWL 1354          
BLAST of PIM-1-like protein vs. Ensembl Yeast
Match: GIN4 (Protein kinase involved in bud growth and assembly of the septin ring; proposed to have kinase-dependent and kinase-independent activities; undergoes autophosphorylation; similar to Hsl1p; GIN4 has a paralog, KCC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002915])

HSP 1 Score: 56.9954 bits (136), Expect = 1.510e-9
Identity = 38/143 (26.57%), Postives = 69/143 (48.25%), Query Frame = 2
Query:  425 IGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDT----------KIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLE 823
            +G  HRD+KPEN++++ K   IK+ D   M   E E  +  +  G+  + +PE    +PY    S V++ G + +  +     FD           K++  +  +P     S+ A+  I + + +DP+ RI+  D+L H  L+
Sbjct:  150 LGIVHRDLKPENLLLDHK-YNIKIADF-GMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290          
BLAST of PIM-1-like protein vs. Ensembl Nematostella
Match: EDO46861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNH5])

HSP 1 Score: 69.707 bits (169), Expect = 8.795e-14
Identity = 59/229 (25.76%), Postives = 106/229 (46.29%), Query Frame = 2
Query:  158 IKKNGTFMKKTNSNFYIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFE--GEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLID------LEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            I KN  +  +      +P E++ L  +  +  V +L +Y + N    + +E     + DL  Y+ E +   E+  K I + ++  V      G +HRDIK EN++++ KT ++KL D      LE+ LY + E        GT  +  PE +    Y+ +   V+++G L +  +  +  F  +IE  +  L   +  SK A+S +   +   P  R   +++L H WL
Sbjct:   19 IPKNNVYFFEEVGGISVPMEVY-LHRVLDHPNVVRLYDYFEYNQAYVLVLER-PTHYRDLFDYITEKKLLSEREAKDIFKQVVHAVAYCEGKGVFHRDIKDENLLLDTKTGQVKLFDFGSGTVLENTLYTDYE--------GTRAYCPPEWFRFHRYHARPCTVWSLGILLFNMLSGDVPFANQIEIVRGELNFAENVSKEAQSLVRWLLAKHPSYRPTLENILKHPWL 237          
BLAST of PIM-1-like protein vs. Ensembl Nematostella
Match: EDO46647 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPA2])

HSP 1 Score: 60.4622 bits (145), Expect = 1.869e-10
Identity = 56/214 (26.17%), Postives = 99/214 (46.26%), Query Frame = 2
Query:  233 ELSQYEYVPKLIEYIDENNWSTVAMEYIGG-DWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMV----NQKTLEIKLIDLEDMLYDENEIPI---CISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTK---IET--QKCLLPEM-KVSSKLA---RSFITECIKLDPDERIEFDDLLFHDWLE 823
            ++ ++ ++  L+E ++  N   +  E  GG D MD   Y     GE  V+  +R +IS V  +   G  HRD+K EN+++    N + ++  L +   +    +  PI   C ++ G+  + +PE      Y  K   V++IG   Y  +  +  +  +   I T   K +  EM  V  +L+   R  +   +  DPDERI  D+ + H WL+
Sbjct:   79 QMVRHPHIISLLEVVETENRYYLVFELAGGGDLMDYICYRKRL-GETEVRKFIRQIISAVQYLHQGGIIHRDLKVENLLLDEEYNIRIIDFGLSNTVSVAKPGDLSPIKDYCKTQCGSPAYAAPEILGHQLYGTKVD-VWSIGVNMYAMLTGKLPYTAEPFNIVTLYNKMVRGEMNAVPDRLSPSCRDLLMRFLTFDPDERISLDEAINHVWLK 290          
BLAST of PIM-1-like protein vs. Ensembl Nematostella
Match: EDO44439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVS7])

HSP 1 Score: 57.7658 bits (138), Expect = 1.259e-9
Identity = 54/218 (24.77%), Postives = 110/218 (50.46%), Query Frame = 2
Query:  206 IPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYI-GGDWMDLSYYLVEFE--GEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDEN----EIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLL---PEMKVSSKLAR---SFITECIKLDPDERIEFDDLLFHDWL 820
            + +EL  +++L  ++++ +L   I+ +    + +EY  GG+  D   Y+V  +   E   +   R +IS V  + + GY HRD+KPEN++++++   IKLID   +   E     ++  C    G+  + +PE    +PY   +  ++++G L Y  +     FD     +   L    E ++ S L++   + + + +++ P +R +  DL+ HDW+
Sbjct:   57 VQRELEAMKDLC-HQHICQLYHVIETDENIYMVLEYAQGGELFD---YIVAKDRLKEDEARGFFRQIISAVAYIHEKGYAHRDLKPENLLLDEEQ-NIKLIDFGLVAKPEGGMTEQLETCC---GSPAYAAPELISGLPYFGNEVDLWSMGVLLYALVCGFLPFDDDNTYKLYRLIQKGEYEIPSWLSQGTVAILGQLLQVSPRKRAKIQDLVNHDWV 266          
BLAST of PIM-1-like protein vs. Ensembl Nematostella
Match: EDO34646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNS0])

HSP 1 Score: 53.9138 bits (128), Expect = 1.862e-8
Identity = 59/212 (27.83%), Postives = 97/212 (45.75%), Query Frame = 2
Query:  212 KELFFLEELSQYEYVPKLIEYID---ENNWSTVAMEYIGGDWMDLSYYLVEFEGEKLV---KTIMR---NLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYE----------YAFDTKIETQKCLLPEMKVS--SKLARSFITECIKLDPDER 784
            KE+  L++L+     P +I+Y     ENN   + +E    D  DLS  +  F+ +K +   +T+ +    L + +  M      HRDIKP N+ +   T  +KL DL    +  ++     S +GT  + SPE   +  YN K S ++++GCL Y     +          Y+   KIE  +C  P +     S+  R  ++ CI   PD+R
Sbjct:   68 KEIDLLKQLNH----PNVIKYYASFIENNELNIVLEL--ADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLTAALEHMHSRRVMHRDIKPANVFIT-ATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIKENGYNFK-SDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIE--QCDYPPLPAEHYSQQLRHLVSLCINPIPDQR 269          
BLAST of PIM-1-like protein vs. Ensembl Nematostella
Match: EDO39163 (Ribosomal protein S6 kinase [Source:UniProtKB/TrEMBL;Acc:A7SAZ2])

HSP 1 Score: 54.6842 bits (130), Expect = 2.152e-8
Identity = 43/174 (24.71%), Postives = 75/174 (43.10%), Query Frame = 2
Query:  365 EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMV--NQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNL---KQSLVFNIGCLAYFCIEYEYAF---------DTKIETQKCLLPEMKVS-------SKLARSFITECIKLDPDERIEFDDLLFHDWLE 823
            E     IMR ++S V  M   G  HRD+KPEN++   N +  EIK++D       + E     +   TL + +PE  D+   N    +   ++++G + Y  +  +  F          T    Q+    +++         S  A+  I   + +DP +R+   ++L HDWL 
Sbjct:  486 ESAASVIMRKIVSAVEFMHQRGVVHRDLKPENLLFVDNSEDAEIKIVDF-GFACVKPEAQQLQTPCFTLSYAAPEVLDQTVSNSGYDESCDLWSLGVILYTMLSGQVPFQSSGSWYKSSTGFVMQRITQGDVRFDGQQWQSISPQAKDLIQGLLTVDPSQRLTVQEVLRHDWLR 658          
BLAST of PIM-1-like protein vs. Ensembl Medaka
Match: pim1 (serine/threonine-protein kinase pim-1 [Source:NCBI gene;Acc:101157054])

HSP 1 Score: 72.4034 bits (176), Expect = 4.004e-14
Identity = 57/221 (25.79%), Postives = 111/221 (50.23%), Query Frame = 2
Query:  194 SNFYIPKELFFLEEL-SQYEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEG--EKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLID------LEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAY--FCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLE 823
            S   +P E+  L+++ + +  V K++++ +  +   + ME    +  DL  ++ E     E+L ++  R ++  V      G  HRDIK ENI+++ +T E+KLID      L+D +Y + +        GT  +  PE      Y  + + V+++G L Y   C +  +  D +I T+  +L   ++S++  +  I  C+ L P +R  F+D++ H W++
Sbjct:   78 SGARVPMEIVLLKKVGTGFRGVIKMLDWFERPDSFIIVMERPE-NVKDLFDFITERGALPEELARSFFRQVLEAVRHCHSCGVVHRDIKDENILIDLRTGEMKLIDFGSGALLKDTIYTDFD--------GTRVYSPPEWIKYHRYQGRSATVWSLGILLYDMVCGDIPFEHDEEI-TRGQVLFRRRISTE-CQHLIKWCLSLRPTDRPSFEDVINHSWMQ 287          
BLAST of PIM-1-like protein vs. Ensembl Medaka
Match: ENSORLT00000033085.1 (pep primary_assembly:ASM223467v1:9:28839537:28844420:-1 gene:ENSORLG00000028814.1 transcript:ENSORLT00000033085.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 2.803e-11
Identity = 46/170 (27.06%), Postives = 83/170 (48.82%), Query Frame = 2
Query:  329 MDLSYYLVEFE---GEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKT--LEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLE 823
            +DL  Y+ E     GEK  K I++ LI     + D   +HRDIK ENI+++  +   +++LID     + E+      +  GT     PE + +  Y+ + + V+ +G + + C+  +    TK+  +K  L   +  SK  + F+ +C   +P  R   + +L H WL+
Sbjct:  128 VDLQTYVQECRDWFGEKEAKMILKQLIKAAISLQDKKIFHRDIKVENILIDMSSGAPQVRLIDFGVSCFTESHSEY-TTFYGTEIHAPPEWWYEHTYSARPTTVWQLGIVLFECLHNKRFNSTKLMEKKLQL--RQNLSKDCKDFMKQCFIQNPRRRPSLEQILLHPWLK 294          
BLAST of PIM-1-like protein vs. Ensembl Medaka
Match: pim3 (Pim-3 proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:101171374])

HSP 1 Score: 63.5438 bits (153), Expect = 3.844e-11
Identity = 59/221 (26.70%), Postives = 100/221 (45.25%), Query Frame = 2
Query:  206 IPKELFFLEELSQ-YEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEGEK------LVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLID------LEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAY--FCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLE 823
            +P E+  L+++S  +  V KL++Y +  +   + ME       DL   L +F  EK        +   R ++  V      G  HRDIK EN++V+ +T E+KLID      L+D +Y + +        GT  +  PE      Y+ + + V+++G L Y   C +  +  D +I   K      +VS +  +  I  C+ L P +R   D +  H W+ 
Sbjct:   87 VPLEILLLKKVSSSFRGVIKLLDYYERPDGWLIVMER-----PDLVKDLFDFITEKGALDEGTARGFFRQVLEAVRHCYSCGVVHRDIKDENLLVDLRTGELKLIDFGSGAILKDTVYTDFD--------GTRVYSPPEWIRFHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGKVYF-RRRVSPE-CQQIIKWCLALRPSDRPTLDQICDHPWMR 292          
BLAST of PIM-1-like protein vs. Ensembl Medaka
Match: ENSORLT00000038016.1 (pep primary_assembly:ASM223467v1:9:28804470:28811607:-1 gene:ENSORLG00000028961.1 transcript:ENSORLT00000038016.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 4.959e-11
Identity = 45/169 (26.63%), Postives = 82/169 (48.52%), Query Frame = 2
Query:  329 MDLSYYLVEFE---GEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKT--LEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            +DL  Y+ E     GEK  K I++ L+     + D   +HRDIK ENI+++  +   +++LID     + E+      +  GT     PE + +  Y+ + + V+ +G + + C+  +    TK+  +K  L   +  SK  + F+ +C   +P  R   + +L H WL
Sbjct:  122 VDLQTYVQECRDWFGEKEAKMILKQLVKAAISLQDKKIFHRDIKVENILIDMSSGAPQVRLIDFGVSCFTESHSEY-TTFYGTEIHAPPEWWYEHTYSARPTTVWQLGIVLFECLHNKRFNSTKLMEKKLQL--RQNLSKDCKDFMKQCFIQNPRRRPSLEQILLHPWL 287          
BLAST of PIM-1-like protein vs. Ensembl Medaka
Match: ENSORLT00000045813.1 (pep primary_assembly:ASM223467v1:9:28820797:28827943:-1 gene:ENSORLG00000027076.1 transcript:ENSORLT00000045813.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 5.758e-11
Identity = 45/169 (26.63%), Postives = 82/169 (48.52%), Query Frame = 2
Query:  329 MDLSYYLVEFE---GEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKT--LEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWL 820
            +DL  Y+ E     GEK  K I++ L+     + D   +HRDIK ENI+++  +   +++LID     + E+      +  GT     PE + +  Y+ + + V+ +G + + C+  +    TK+  +K  L   +  SK  + F+ +C   +P  R   + +L H WL
Sbjct:  122 VDLQTYVQECRDWFGEKEAKMILKQLVKAAISLQDKKIFHRDIKVENILIDMSSGAPQVRLIDFGVSCFTESHSEY-TTFYGTEIHAPPEWWYEHTYSARPTTVWQLGIVLFECLHNKNFSSTKLMEKKLQL--RQNLSKDCKDFMKQCFIQNPRRRPSLEQILLHPWL 287          
BLAST of PIM-1-like protein vs. Planmine SMEST
Match: SMESG000061809.1 (SMESG000061809.1)

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 294/295 (99.66%), Postives = 294/295 (99.66%), Query Frame = 2
Query:   17 MDTDKILKSLTKRNYSEFIILSESCKGIVIKALNEENNLVLLKTFYKIKKNGTFMKKTNSNFYIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLEXXXXXXXXXXXSYNPMAIAESLGEMF 901
            MDTDKILKSLTKRNYSEFIILSESCKGIVIKALNEENNLVLLKTFYKIKKNGTFMKKTNSNFYIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETY KVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLENENNVDKNNINSYNPMAIAESLGEMF
Sbjct:    1 MDTDKILKSLTKRNYSEFIILSESCKGIVIKALNEENNLVLLKTFYKIKKNGTFMKKTNSNFYIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYGKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLENENNVDKNNINSYNPMAIAESLGEMF 295          
BLAST of PIM-1-like protein vs. Planmine SMEST
Match: SMESG000061808.1 (SMESG000061808.1)

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 294/295 (99.66%), Postives = 294/295 (99.66%), Query Frame = 2
Query:   17 MDTDKILKSLTKRNYSEFIILSESCKGIVIKALNEENNLVLLKTFYKIKKNGTFMKKTNSNFYIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLEXXXXXXXXXXXSYNPMAIAESLGEMF 901
            MDTDKILKSLTKRNYSEFIILSESCKGIVIKALNEENNLVLLKTFYKIKKNGTFMKKTNSNFYIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETY KVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLENENNVDKNNINSYNPMAIAESLGEMF
Sbjct:    1 MDTDKILKSLTKRNYSEFIILSESCKGIVIKALNEENNLVLLKTFYKIKKNGTFMKKTNSNFYIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYGKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLENENNVDKNNINSYNPMAIAESLGEMF 295          
BLAST of PIM-1-like protein vs. Planmine SMEST
Match: SMESG000061880.1 (SMESG000061880.1)

HSP 1 Score: 397.512 bits (1020), Expect = 3.522e-140
Identity = 195/295 (66.10%), Postives = 243/295 (82.37%), Query Frame = 2
Query:   17 MDTDKILKSLTKRNYSEFIILSESCKGIVIKALNEENNLVLLKTFYKIKKNGTFMKKTNSNFYIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLEXXXXXXXXXXXSYNPMAIAESLGEMF 901
            M+ ++I++SL+ R Y EFI+L +SCKGIV+ A + EN LVLLKTFYKIKK  TF+    SN  +P+EL FLE+LSQYEYVPKLI YIDENNWSTV MEY+ GDWMDL  Y ++F  E  +KTI++NLI IVYKMS+IGYYHRDIKP+NIMVN++TLE+KLIDLED+L+D+ +IPIC S LGTLGFQSPE +  VPYNLKQSLV NIGC+AYFC+E+++ F++KIET+KC LP++ +SS LARSFIT+CIK DPDERIEF DLLFH+WL+     +++ I SYNPMAIA+SL   F
Sbjct:    1 MELNEIVQSLSNRKYHEFIVLQQSCKGIVMSAFDGENKLVLLKTFYKIKKCFTFIVDKKSNRSVPRELLFLEQLSQYEYVPKLITYIDENNWSTVVMEYLDGDWMDLHDYTMQFPYESPIKTIIKNLIIIVYKMSEIGYYHRDIKPKNIMVNEETLEVKLIDLEDVLFDQYDIPICNSTLGTLGFQSPEIFGDVPYNLKQSLVCNIGCVAYFCLEFQFPFNSKIETKKCNLPKINLSSDLARSFITDCIKPDPDERIEFGDLLFHNWLD-----NEDKITSYNPMAIAKSLWNFF 290          
BLAST of PIM-1-like protein vs. Planmine SMEST
Match: SMESG000000218.1 (SMESG000000218.1)

HSP 1 Score: 397.897 bits (1021), Expect = 4.719e-140
Identity = 194/300 (64.67%), Postives = 243/300 (81.00%), Query Frame = 2
Query:    2 KNQNKMDTDKILKSLTKRNYSEFIILSESCKGIVIKALNEENNLVLLKTFYKIKKNGTFMKKTNSNFYIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLEXXXXXXXXXXXSYNPMAIAESLGEMF 901
            +NQNKM   ++ KSL KRNY + I++ ES KG+V+KAL+EEN LVLLKTFYKI+K  +F++   SN  IPKEL FLE+LSQYEYVPKLI+YIDENNWSTV MEY+ GDWM+L  + + F  EKL+K IM NLI IVY+MSD+GYYHRDIKPENIM+N++T E+KLIDLED+LY+ +++PIC S LGT+G+QSPE +  VPYNLKQSLVFNIGC+AYFC+E+++ FDT+ ET+KC LP+MKVSS+LA+SFI  CIKLDPDERIEF + L H WL       +N   SYNP+AIA+SL  +F
Sbjct:   15 QNQNKMKITEVAKSLIKRNYHKLIVIQESDKGVVMKALDEENKLVLLKTFYKIEKFYSFIEDKKSNRSIPKELLFLEQLSQYEYVPKLIKYIDENNWSTVVMEYLNGDWMNLGEFTMRFADEKLIKIIMINLILIVYEMSDLGYYHRDIKPENIMINRETFEVKLIDLEDVLYNIDDMPICNSTLGTIGYQSPEIFGDVPYNLKQSLVFNIGCVAYFCLEFQFPFDTEAETRKCCLPKMKVSSELAQSFIANCIKLDPDERIEFGEFLSHQWL-----AKENRTKSYNPVAIAKSLWGIF 309          
BLAST of PIM-1-like protein vs. Planmine SMEST
Match: SMESG000032312.1 (SMESG000032312.1)

HSP 1 Score: 395.201 bits (1014), Expect = 3.283e-139
Identity = 195/295 (66.10%), Postives = 241/295 (81.69%), Query Frame = 2
Query:   17 MDTDKILKSLTKRNYSEFIILSESCKGIVIKALNEENNLVLLKTFYKIKKNGTFMKKTNSNFYIPKELFFLEELSQYEYVPKLIEYIDENNWSTVAMEYIGGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIKPENIMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVPYNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFITECIKLDPDERIEFDDLLFHDWLEXXXXXXXXXXXSYNPMAIAESLGEMF 901
            M+ ++I++SL+ R Y EFI++ +SCKGIV++A N EN LVLLKTFYKI+K  TF+    SN  +P+EL FLE+LSQYEYVPKLI YIDENNWSTV MEY+GGDWMDLS + + F  EK +KTI++NLI IVY+MS+IGYYHRDIKPENIMVN++TLE+KLIDLED L+D+ +IPIC S LGTLGFQSPE +  VPYNLKQSLV   GC+AYFC+E+   F ++IET+KC LP++ +SS+LARSFIT+CIKLDPDERIEF DLL HDWL      +K+ I SYNPMAIA+SL  +F
Sbjct:    1 MELNEIVQSLSNRKYHEFIVMHQSCKGIVMRAFNGENKLVLLKTFYKIEKYFTFIVDKKSNRSVPRELLFLEQLSQYEYVPKLITYIDENNWSTVVMEYLGGDWMDLSKFTMAFPIEKPIKTIIKNLIIIVYEMSEIGYYHRDIKPENIMVNKETLEVKLIDLEDALFDQYDIPICNSTLGTLGFQSPEIFGDVPYNLKQSLVCTFGCVAYFCLEFRVPFKSEIETKKCNLPKINLSSELARSFITDCIKLDPDERIEFGDLLSHDWL-----YNKDKITSYNPMAIAKSLWNIF 290          
The following BLAST results are available for this feature:
BLAST of PIM-1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIM37.132e-1026.58Pim-3 proto-oncogene, serine/threonine kinase [Sou... [more]
RPS6KA58.730e-1025.91ribosomal protein S6 kinase A5 [Source:HGNC Symbol... [more]
RPS6KA51.013e-924.87ribosomal protein S6 kinase A5 [Source:HGNC Symbol... [more]
PIM11.054e-926.71Pim-1 proto-oncogene, serine/threonine kinase [Sou... [more]
IKBKB3.994e-930.99inhibitor of nuclear factor kappa B kinase subunit... [more]
back to top
BLAST of PIM-1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pig-13.425e-1327.48Maternal embryonic leucine zipper kinase [Source:... [more]
pig-13.594e-1327.48Maternal embryonic leucine zipper kinase [Source:... [more]
pig-13.658e-1327.48Maternal embryonic leucine zipper kinase [Source:... [more]
pig-14.094e-1327.48Maternal embryonic leucine zipper kinase [Source:... [more]
cmk-12.195e-1126.57Calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of PIM-1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG175281.409e-1127.19gene:FBgn0261387 transcript:FBtr0111274[more]
CG175281.409e-1127.19gene:FBgn0261387 transcript:FBtr0111277[more]
fu4.737e-923.79gene:FBgn0001079 transcript:FBtr0074602[more]
Unc-894.576e-826.67gene:FBgn0053519 transcript:FBtr0343286[more]
Unc-894.697e-826.67gene:FBgn0053519 transcript:FBtr0343287[more]
back to top
BLAST of PIM-1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pimr1818.890e-1826.61Pim proto-oncogene, serine/threonine kinase, relat... [more]
pimr1821.221e-1525.00Pim proto-oncogene, serine/threonine kinase, relat... [more]
pimr471.481e-1521.97Pim proto-oncogene, serine/threonine kinase, relat... [more]
pimr1822.182e-1524.07Pim proto-oncogene, serine/threonine kinase, relat... [more]
pimr1801.022e-1428.66Pim proto-oncogene, serine/threonine kinase, relat... [more]
back to top
BLAST of PIM-1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncbp11.006e-1025.56nuclear cap binding protein subunit 1 [Source:Xenb... [more]
ncbp11.202e-1025.56nuclear cap binding protein subunit 1 [Source:Xenb... [more]
b3galt5.21.192e-926.46beta-1,3-galactosyltransferase 5 gene 2 [Source:Xe... [more]
b3galt5.21.325e-926.46beta-1,3-galactosyltransferase 5 gene 2 [Source:Xe... [more]
b3galt5.21.353e-927.37beta-1,3-galactosyltransferase 5 gene 2 [Source:Xe... [more]
back to top
BLAST of PIM-1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pim34.032e-1026.58proviral integration site 3 [Source:MGI Symbol;Acc... [more]
Ikbkb4.910e-1032.39inhibitor of kappaB kinase beta [Source:MGI Symbol... [more]
Ikbkb5.683e-1032.39inhibitor of kappaB kinase beta [Source:MGI Symbol... [more]
Rps6ka59.250e-1023.99ribosomal protein S6 kinase, polypeptide 5 [Source... [more]
Ikbkb1.004e-932.39inhibitor of kappaB kinase beta [Source:MGI Symbol... [more]
back to top
BLAST of PIM-1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|U4PR86|MELK_CAEEL5.207e-1227.48Maternal embryonic leucine zipper kinase OS=Caenor... [more]
sp|Q9Y899|KCC1B_EMEND7.116e-1224.78Calcium/calmodulin-dependent protein kinase cmkB O... [more]
sp|P32491|MKK2_YEAST9.127e-1227.11MAP kinase kinase MKK2/SSP33 OS=Saccharomyces cere... [more]
sp|Q7PLI7|DCLK_DROME1.412e-1027.19Serine/threonine-protein kinase CG17528 OS=Drosoph... [more]
sp|B4NSS9|DCLK_DROSI1.572e-1027.07Serine/threonine-protein kinase GD17699 OS=Drosoph... [more]
back to top
BLAST of PIM-1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2P1ERR91.353e-16097.93PIM-1-like protein OS=Schmidtea mediterranea OX=79... [more]
A0A498MXV63.146e-1628.62Serine threonine-kinase pim-1-like protein OS=Labe... [more]
A0A556TUR03.269e-1630.23Serine/threonine-protein kinase pim-3 OS=Bagarius ... [more]
A0A418D8115.328e-1625.47Protein kinase domain-containing protein OS=Aphano... [more]
A0A3R6Z5795.375e-1622.57Protein kinase domain-containing protein OS=Aphano... [more]
back to top
BLAST of PIM-1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000030133.12.111e-1626.07serine/threonine-protein kinase pim-3-like [Source... [more]
ENSAMXT00000040711.14.420e-1525.00serine/threonine-protein kinase pim-1-like [Source... [more]
pim13.196e-1325.34serine/threonine-protein kinase pim-1-like [Source... [more]
ENSAMXT00000037345.17.417e-1324.33serine/threonine-protein kinase pim-1-like [Source... [more]
ENSAMXT00000012249.21.247e-1228.74pep primary_assembly:Astyanax_mexicanus-2.0:10:901... [more]
back to top
BLAST of PIM-1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk2a1.028e-926.90calcium/calmodulin-dependent protein kinase II alp... [more]
rps6ka53.846e-825.00ribosomal protein S6 kinase, polypeptide 5 [Source... [more]
snrka5.592e-823.56SNF related kinase a [Source:ZFIN;Acc:ZDB-GENE-040... [more]
ENSPMAT00000008748.12.169e-722.12pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 ge... [more]
plk35.958e-723.58polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of PIM-1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MKK21.314e-1327.11MAPKK involved in the protein kinase C signaling p... [more]
RAD533.076e-1023.61DNA damage response protein kinase; required for c... [more]
MKK13.283e-1025.91MAPKK involved in the protein kinase C signaling p... [more]
PSK11.123e-924.22PAS domain-containing serine/threonine protein kin... [more]
GIN41.510e-926.57Protein kinase involved in bud growth and assembly... [more]
back to top
BLAST of PIM-1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468618.795e-1425.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466471.869e-1026.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444391.259e-924.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346461.862e-827.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391632.152e-824.71Ribosomal protein S6 kinase [Source:UniProtKB/TrE... [more]
back to top
BLAST of PIM-1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pim14.004e-1425.79serine/threonine-protein kinase pim-1 [Source:NCBI... [more]
ENSORLT00000033085.12.803e-1127.06pep primary_assembly:ASM223467v1:9:28839537:288444... [more]
pim33.844e-1126.70Pim-3 proto-oncogene, serine/threonine kinase [Sou... [more]
ENSORLT00000038016.14.959e-1126.63pep primary_assembly:ASM223467v1:9:28804470:288116... [more]
ENSORLT00000045813.15.758e-1126.63pep primary_assembly:ASM223467v1:9:28820797:288279... [more]
back to top
BLAST of PIM-1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061809.10.000e+099.66SMESG000061809.1[more]
SMESG000061808.10.000e+099.66SMESG000061808.1[more]
SMESG000061880.13.522e-14066.10SMESG000061880.1[more]
SMESG000000218.14.719e-14064.67SMESG000000218.1[more]
SMESG000032312.13.283e-13966.10SMESG000032312.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004080 ID=SMED30004080|Name=PIM-1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=901bp
CAAAAATCAAAATAAAATGGATACTGATAAAATACTTAAAAGTTTGACGA
AAAGAAATTATAGCGAATTCATAATTTTAAGTGAATCTTGTAAAGGAATT
GTTATAAAAGCATTGAATGAAGAAAATAATTTAGTTCTTCTTAAAACATT
TTACAAAATAAAAAAAAATGGCACATTTATGAAAAAAACAAATTCTAATT
TCTATATTCCAAAAGAATTGTTCTTTTTAGAAGAATTATCACAATATGAG
TATGTTCCAAAATTAATAGAGTATATCGATGAAAATAATTGGTCAACAGT
TGCCATGGAATATATTGGCGGTGATTGGATGGATTTAAGCTATTACCTAG
TCGAATTTGAGGGTGAAAAATTAGTCAAAACTATAATGAGAAATTTAATT
TCAATTGTATATAAAATGTCAGATATCGGATATTATCATCGAGATATCAA
ACCAGAAAATATTATGGTCAACCAAAAAACACTTGAAATAAAACTCATTG
ACTTAGAAGATATGCTTTACGATGAAAATGAAATCCCGATATGTATCTCA
GAATTAGGAACACTTGGTTTTCAAAGTCCTGAAACATATGATAAGGTTCC
ATACAACTTGAAACAAAGCTTAGTGTTCAATATTGGATGTTTAGCATATT
TTTGTATAGAATATGAATATGCATTTGACACAAAAATTGAAACTCAAAAG
TGTCTTTTACCAGAAATGAAAGTTTCATCAAAACTGGCCAGATCATTCAT
CACAGAGTGCATTAAACTAGATCCCGATGAACGGATTGAATTTGATGACC
TTCTTTTCCACGATTGGCTTGAGAATGAAAATAATGTTGATAAAAATAAT
ATTAACAGCTATAATCCAATGGCAATCGCAGAATCTTTGGGAGAAATGTT
T
back to top

protein sequence of SMED30004080-orf-1

>SMED30004080-orf-1 ID=SMED30004080-orf-1|Name=SMED30004080-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=300bp
KNQNKMDTDKILKSLTKRNYSEFIILSESCKGIVIKALNEENNLVLLKTF
YKIKKNGTFMKKTNSNFYIPKELFFLEELSQYEYVPKLIEYIDENNWSTV
AMEYIGGDWMDLSYYLVEFEGEKLVKTIMRNLISIVYKMSDIGYYHRDIK
PENIMVNQKTLEIKLIDLEDMLYDENEIPICISELGTLGFQSPETYDKVP
YNLKQSLVFNIGCLAYFCIEYEYAFDTKIETQKCLLPEMKVSSKLARSFI
TECIKLDPDERIEFDDLLFHDWLENENNVDKNNINSYNPMAIAESLGEMF
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000033epidermal progenitor cell
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 12..31