SMED30004069

Overview
NameSMED30004069
Smed IDSMED30004069
Length (bp)405
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30004069 (SMED30004069) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30004069 (SMED30004069) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30004069 (SMED30004069) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30004069 (SMED30004069) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004069

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30004069SMESG000051981.1 SmedASXL_055543SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30004069 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000160:137874..138278 -2025
Homology
BLAST of SMED30004069 vs. Ensembl Zebrafish
Match: BX470188.1 (pep chromosome:GRCz11:20:43658361:43663494:-1 gene:ENSDARG00000088165.4 transcript:ENSDART00000144564.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX470188.1)

HSP 1 Score: 44.669 bits (104), Expect = 7.424e-6
Identity = 31/126 (24.60%), Postives = 60/126 (47.62%), Query Frame = 2
Query:   11 LYGRVYFFLRKMMVGKTSKK-----VDNYQKATKMFTMSTFVITVFFILSFAYDTLYYILGFLGVT-SYVISSPLGIAGVFLTALNSVINPFVYIILMKSFRNKYLQVWIPKFIIVKFSREIEDKE 370
            +Y +++  +++ M    +++      +   K  K   M+T +  V F+ +  +  L+ I  FL +  S  +  PL +  + L+  NS +NPF+Y   MK+FRN +  +++         R I D E
Sbjct:  257 IYAQIFVTVKRQMRRIAAERGGAGNTEGTAKMKKEMKMATSLFLVLFLFTSCWIPLHIINCFLLLCPSCPVPLPLLLTAIILSHANSAVNPFLYAYKMKTFRNAFKSIFM-------CCRGISDGE 375          
BLAST of SMED30004069 vs. Ensembl Xenopus
Match: ENSXETT00000004246.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:4230249:4232178:-1 gene:ENSXETG00000006625.1 transcript:ENSXETT00000004246.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.595 bits (109), Expect = 2.769e-6
Identity = 28/105 (26.67%), Postives = 52/105 (49.52%), Query Frame = 2
Query:   11 LYGRVYFFLRKMM----VGKTSKKVDNYQKA--TKMFTMSTFVITVFFILSFAYDTLYYILGFLGVTSYVISSPLGI-AGVFLTALNSVINPFVYIILMKSFRNK 304
            +Y R++   RK +     G T +  D+ Q+    +    +T + TV F+    +  L+ + G + + S     P+ +  G+ L+  NS +NP +Y   +KSFR+K
Sbjct:  177 IYARIFSVARKHINLTDAGATPENADSRQETGIKREIKTATSLFTVIFLFVLCWAPLHVVNGLILLCSQCSIPPVIVDTGIILSHANSALNPILYAYKLKSFRDK 281          
BLAST of SMED30004069 vs. TrEMBL
Match: A0A3S5A5E5 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS938 PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 6.939e-15
Identity = 44/102 (43.14%), Postives = 61/102 (59.80%), Query Frame = 2
Query:   11 LYGRVYFFL-RKMMVGKTSKKVDNYQKATKMFTMSTFVITVFFILSFAYDTLYYILGFLGVTSYVISSPLGIAGVFLTALNSVINPFVYIILMKSFRNKYLQ 313
            LYGRV   L R      ++ K    Q+A    T S  VITV F+++F+YD++YY+LG L V SY  ++     GVFL  LNS  NP VY ++MKSFR + ++
Sbjct:  102 LYGRVICHLSRGSEAAASTAKCQ--QRAATELTKSAVVITVIFVITFSYDSIYYLLGSLDVISYSFNTFEQTIGVFLVGLNSCANPLVYCLIMKSFRQRLVE 201          
BLAST of SMED30004069 vs. TrEMBL
Match: A0A193KUF5 (GCR145 OS=Schmidtea mediterranea OX=79327 GN=gcr145 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.037e-14
Identity = 42/103 (40.78%), Postives = 60/103 (58.25%), Query Frame = 2
Query:    8 YLYGRVYFFLRKMMVGKTSKKVDNYQKATKMFTMSTFVITVFFILSFAYDTLYYILGFLGVTSYVISSPLGIAGVFLTALNSVINPFVYIILMKSFRNKYLQV 316
            +LY +VY  + K+       K     KAT  FT +T ++ + F+L+  +D  YY+LG+LG   YV +SPL + G+ L  +NS +NP VY I MKSFR  Y  V
Sbjct:  196 FLYWKVYKAMNKLKSNNEETK-----KATMKFTKATMIVVIIFMLTCFFDPFYYMLGYLGAVEYVFNSPLQLTGISLITINSAVNPVVYFITMKSFRKFYFDV 293          
BLAST of SMED30004069 vs. TrEMBL
Match: A0A1I8HGG3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.076e-14
Identity = 36/76 (47.37%), Postives = 48/76 (63.16%), Query Frame = 2
Query:   83 QKATKMFTMSTFVITVFFILSFAYDTLYYILGFLGVTSYVISSPLGIAGVFLTALNSVINPFVYIILMKSFRNKYL 310
            Q+A    T S  +ITV FI+ F+YD +YY+LG L +  Y+ SSP  + GV L  +NS  NP VY I+M SFR + L
Sbjct:  476 QRAATELTKSAVIITVIFIVCFSYDCIYYLLGHLDLVEYIYSSPTQLIGVALVTINSCANPVVYCIIMPSFRERML 551          
BLAST of SMED30004069 vs. TrEMBL
Match: A0A1I8FSX6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.852e-14
Identity = 36/76 (47.37%), Postives = 48/76 (63.16%), Query Frame = 2
Query:   83 QKATKMFTMSTFVITVFFILSFAYDTLYYILGFLGVTSYVISSPLGIAGVFLTALNSVINPFVYIILMKSFRNKYL 310
            Q+A    T S  +ITV FI+ F+YD +YY+LG L +  Y+ SSP  + GV L  +NS  NP VY I+M SFR + L
Sbjct:  457 QRAATELTKSAVIITVIFIVCFSYDCIYYLLGHLDLVEYIYSSPTQLIGVALVTINSCANPVVYCIIMPSFRERML 532          
BLAST of SMED30004069 vs. TrEMBL
Match: R7VBF8 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_208570 PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.304e-12
Identity = 42/128 (32.81%), Postives = 63/128 (49.22%), Query Frame = 2
Query:   11 LYGRVYFFLRKMMVGKTSKKVDNYQKATKMFTMSTFVITVFFILSFAYDTLYYILGFLGVTSYVISSPLGIAGVFLTALNSVINPFVYIILMKSFRNKYLQVWIPKFIIVKFSREIEDKEYSTNTSTI 394
            LY  V   LRK        K     +AT   T +   +T+ FILS  YD  +Y+LG+  V  Y   SP    GVFL+ LNSV NP VY +LM  +R   ++   P+        + ED + ++ ++++
Sbjct:  225 LYSLVAHQLRKRKENTELGKSKTIDRATDQLTKTAVTVTIIFILSVGYDLHFYLLGYNHVIEYTFGSPEQKVGVFLSNLNSVANPLVYALLMPIYRKCVVETICPR------RAKSEDADQASKSTSL 346          
BLAST of SMED30004069 vs. Ensembl Cavefish
Match: adora1a (adenosine receptor A1-like [Source:NCBI gene;Acc:103028963])

HSP 1 Score: 44.2838 bits (103), Expect = 9.560e-6
Identity = 29/119 (24.37%), Postives = 60/119 (50.42%), Query Frame = 2
Query:   11 LYGRVYFFLRKMMVGK-TSKKVDNYQKATKMFTMSTFVITVFFILSFAYDTLYYILGFLGVTSYVISSPLGI-AGVFLTALNSVINPFVYIILMKSFRNKYLQVWIPKFIIVKFSREIE 361
            +Y  +++ + K +  K T+ + D  +   K   ++  +  V F+ + ++  L+ +L  + + S      + I   + L+  NS +NP VY   +K FRN +L++W   F   + SR++E
Sbjct:  195 IYAEIFYMIHKQLNKKVTASQTDPSRYYGKELKLAKSLALVLFLFAISWLPLH-VLNCITLFSPKFEKKILIYVAILLSHGNSAVNPVVYAFRIKKFRNSFLKIWKQYFCCREVSRQVE 312          
BLAST of SMED30004069 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010558.1 (pep scaffold:Pmarinus_7.0:GL477661:10193:14261:1 gene:ENSPMAG00000009564.1 transcript:ENSPMAT00000010558.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 1.758e-7
Identity = 33/135 (24.44%), Postives = 64/135 (47.41%), Query Frame = 2
Query:   11 LYGRVYFFLRKMMV--------GKTSKKVDNYQKATKMFTMSTFVITVFFILSFAYDTLYYILGFLGVTSYVISSPLGI--AGVFLTALNSVINPFVYIILMKSFRNKYLQVWIPKFIIVKFSREIEDKEYSTNT 385
            +Y R++  +R  +         G  + +  + Q  TK    +T +  V F+ +  +  L+ +L  + +     ++P G+  A + L+  NSV+NPF+Y   MKS+R  +L       I+ + +RE +D     +T
Sbjct:  192 IYARIFLQVRHQLRRIANEARGGAGNAQERSMQSLTKEVKTATSLFLVLFLFTVCWIPLH-VLNCISLLCPGSNTPYGLLLAAIILSHANSVVNPFLYAYRMKSYRRAFL-----SLIMCRDARETDDDTQVPST 320          
BLAST of SMED30004069 vs. Ensembl Nematostella
Match: EDO31861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWQ1])

HSP 1 Score: 44.2838 bits (103), Expect = 3.759e-6
Identity = 32/124 (25.81%), Postives = 53/124 (42.74%), Query Frame = 2
Query:    8 YLYGRVYFFLRKMMVG-KTSKKVDNYQKATKMFTMSTFVITVFFILSFAYDTLY---YILGFLGVT-SYVISSPLGIAGVFLTALNSVINPFVYIILMKSFRNKYLQVWIPKFIIVKFSREIED 364
            Y    V  FLRK     + S  + +     + F  +   I V F     Y T +    +  F G+  SY +   + ++G  L   NS INP +Y+   K FR +   +  P+ ++   SR+ +D
Sbjct:  210 YTAATVSRFLRKRSRDIQDSANIHSNNSQGRRFKDTKMFINVIFAFCIPYSTYFVYNLVKRFAGLELSYELDFTIRMSGGVLATFNSCINPMIYLFSYKDFRRELRNIICPRQVVNDESRQRQD 333          
BLAST of SMED30004069 vs. Ensembl Nematostella
Match: EDO35995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJT7])

HSP 1 Score: 43.1282 bits (100), Expect = 9.419e-6
Identity = 32/124 (25.81%), Postives = 52/124 (41.94%), Query Frame = 2
Query:    8 YLYGRVYFFLRKMMVG-KTSKKVDNYQKATKMFTMSTFVITVFFILSFAYDTLY---YILGFLGVT-SYVISSPLGIAGVFLTALNSVINPFVYIILMKSFRNKYLQVWIPKFIIVKFSREIED 364
            Y    V  FLRK     + S  + +     + F  +   I V F     Y T +    +  F G+  SY +   + ++G  L   NS INP +Y+   K FR +      P+ ++   SR+ +D
Sbjct:  346 YTAATVSRFLRKRSRDIQDSANIHSNNSQGRRFKDTKMFINVIFAFCIPYSTYFVYNLVKRFAGLELSYELEFTIRMSGCVLATFNSCINPIIYLFSYKDFRRELRNRICPRQVVNDESRQRQD 469          
BLAST of SMED30004069 vs. Planmine SMEST
Match: SMESG000051981.1 (SMESG000051981.1)

HSP 1 Score: 259.996 bits (663), Expect = 2.936e-88
Identity = 131/131 (100.00%), Postives = 131/131 (100.00%), Query Frame = 2
Query:    2 FSYLYGRVYFFLRKMMVGKTSKKVDNYQKATKMFTMSTFVITVFFILSFAYDTLYYILGFLGVTSYVISSPLGIAGVFLTALNSVINPFVYIILMKSFRNKYLQVWIPKFIIVKFSREIEDKEYSTNTSTI 394
            FSYLYGRVYFFLRKMMVGKTSKKVDNYQKATKMFTMSTFVITVFFILSFAYDTLYYILGFLGVTSYVISSPLGIAGVFLTALNSVINPFVYIILMKSFRNKYLQVWIPKFIIVKFSREIEDKEYSTNTSTI
Sbjct:  196 FSYLYGRVYFFLRKMMVGKTSKKVDNYQKATKMFTMSTFVITVFFILSFAYDTLYYILGFLGVTSYVISSPLGIAGVFLTALNSVINPFVYIILMKSFRNKYLQVWIPKFIIVKFSREIEDKEYSTNTSTI 326          
BLAST of SMED30004069 vs. Planmine SMEST
Match: SMESG000037908.1 (SMESG000037908.1)

HSP 1 Score: 96.6709 bits (239), Expect = 7.555e-25
Identity = 50/112 (44.64%), Postives = 74/112 (66.07%), Query Frame = 2
Query:   56 KTSKKVDNYQKATKMFTMSTFVITVFFILSFAYDTLYYILGFLGVTSYVISSPLGIAGVFLTALNSVINPFVYIILMKSFRNKYLQVWIPKFIIVKFSREIEDKEYSTNTST 391
            K  K++ + Q + K FT ST + T+ F+++ AYD +YY+LG+LGV  YV+ SP    GVFLT++NS  NP V+ IL+KSFR K+L VW  K  + K S ++E+     ++ST
Sbjct:  210 KRDKRI-SMQASMKSFTKSTLINTIIFLITIAYDAMYYMLGYLGVVEYVLYSPTQRVGVFLTSVNSSTNPLVFFILVKSFRRKFLMVWCKK-CVRKSSNKVENNNMGKHSST 319          
BLAST of SMED30004069 vs. Planmine SMEST
Match: SMESG000037926.1 (SMESG000037926.1)

HSP 1 Score: 88.5817 bits (218), Expect = 7.588e-22
Identity = 45/119 (37.82%), Postives = 72/119 (60.50%), Query Frame = 2
Query:    8 YLYGRVYFFLRKMMVGKTSKKVDNYQKATKMFTMSTFVITVFFILSFAYDTLYYILGFLGVTSYVISSPLGIAGVFLTALNSVINPFVYIILMKSFRNKYLQVWIPKFIIVKFSREIED 364
            Y+Y +V   L   + G +     N + A + FT  T V T+ FIL+ +YD +YY+LG+LG+  Y+ +SP  + GVFLTA+NS +NP ++  L+K+FR  +  +W   F + K S ++ D
Sbjct:  198 YIYTKVILQLTSSLQGDSG---SNLKTAMRSFTKGTMVTTLIFILTISYDAIYYMLGYLGIAVYIFNSPPQVVGVFLTAVNSSVNPIIFFALVKTFRKSFFIIWCKCF-VKKLSMKVSD 312          
BLAST of SMED30004069 vs. Planmine SMEST
Match: SMESG000027977.1 (SMESG000027977.1)

HSP 1 Score: 80.1073 bits (196), Expect = 8.707e-19
Identity = 48/131 (36.64%), Postives = 77/131 (58.78%), Query Frame = 2
Query:    2 FSYLYGRVYFFLRKMMVGKTSKKVDNYQKATKMFTMSTFVITVFFILSFAYDTLYYILGFLGVTSYVISSPLGIAGVFLTALNSVINPFVYIILMKSFRNKYLQVWIPKFIIVKFSREIEDKEYSTNTSTI 394
            F ++YG +   ++K+      K  D     T+ FT+S F+IT+FF++ F+YDT+YY+LG + V SYV  S L   GV L  +NS +NP +Y+ +MKS R +Y++ ++ K      +   E +E S   ST+
Sbjct:  184 FIFVYGNIVKIIKKL------KSSDGDSMRTR-FTISAFIITLFFVVLFSYDTIYYLLGNMNVVSYVFGSSLQKVGVLLITMNSFVNPTIYLAVMKSMRTRYVKFYL-KLFHCPLALSKEFREVSAMNSTV 306          
BLAST of SMED30004069 vs. Planmine SMEST
Match: SMESG000003474.1 (SMESG000003474.1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.883e-18
Identity = 42/103 (40.78%), Postives = 60/103 (58.25%), Query Frame = 2
Query:    8 YLYGRVYFFLRKMMVGKTSKKVDNYQKATKMFTMSTFVITVFFILSFAYDTLYYILGFLGVTSYVISSPLGIAGVFLTALNSVINPFVYIILMKSFRNKYLQV 316
            +LY +VY  + K+       K     KAT  FT +T ++ + F+L+  +D  YY+LG+LG   YV +SPL + G+ L  +NS +NP VY I MKSFR  Y  V
Sbjct:  196 FLYWKVYKAMNKLKSNNEETK-----KATMKFTKATMIVVIIFMLTCFFDPFYYMLGYLGAVEYVFNSPLQLTGISLITINSAVNPVVYFITMKSFRKFYFDV 293          
The following BLAST results are available for this feature:
BLAST of SMED30004069 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004069 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004069 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004069 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
BX470188.17.424e-624.60pep chromosome:GRCz11:20:43658361:43663494:-1 gene... [more]
back to top
BLAST of SMED30004069 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000004246.12.769e-626.67pep primary_assembly:Xenopus_tropicalis_v9.1:5:423... [more]
back to top
BLAST of SMED30004069 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004069 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004069 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S5A5E56.939e-1543.14G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A193KUF51.037e-1440.78GCR145 OS=Schmidtea mediterranea OX=79327 GN=gcr14... [more]
A0A1I8HGG32.076e-1447.37Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8FSX62.852e-1447.37Uncharacterized protein OS=Macrostomum lignano OX=... [more]
R7VBF81.304e-1232.81G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of SMED30004069 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
adora1a9.560e-624.37adenosine receptor A1-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of SMED30004069 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000010558.11.758e-724.44pep scaffold:Pmarinus_7.0:GL477661:10193:14261:1 g... [more]
back to top
BLAST of SMED30004069 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004069 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO318613.759e-625.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359959.419e-625.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30004069 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004069 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051981.12.936e-88100.00SMESG000051981.1[more]
SMESG000037908.17.555e-2544.64SMESG000037908.1[more]
SMESG000037926.17.588e-2237.82SMESG000037926.1[more]
SMESG000027977.18.707e-1936.64SMESG000027977.1[more]
SMESG000003474.12.883e-1840.78SMESG000003474.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004069 ID=SMED30004069|Name=SMED30004069|organism=Schmidtea mediterranea sexual|type=transcript|length=405bp
CTTCAGTTATTTATATGGTCGAGTGTATTTTTTTCTGAGAAAAATGATGG
TTGGAAAAACATCAAAAAAGGTTGATAACTATCAAAAGGCAACAAAAATG
TTTACAATGTCAACATTTGTTATTACAGTGTTTTTTATTTTAAGTTTCGC
TTATGATACATTATATTACATTCTTGGATTTTTAGGAGTGACTTCATACG
TAATTAGCTCACCGTTAGGTATTGCTGGTGTATTTCTTACTGCACTGAAC
AGTGTCATTAACCCGTTTGTTTACATTATTCTAATGAAAAGTTTTCGAAA
TAAATATCTTCAGGTTTGGATTCCTAAGTTCATAATAGTAAAGTTCTCAC
GAGAAATTGAAGATAAAGAATATTCAACGAATACATCAACAATTTAAACA
AAAAC
back to top

protein sequence of SMED30004069-orf-1

>SMED30004069-orf-1 ID=SMED30004069-orf-1|Name=SMED30004069-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=132bp
FSYLYGRVYFFLRKMMVGKTSKKVDNYQKATKMFTMSTFVITVFFILSFA
YDTLYYILGFLGVTSYVISSPLGIAGVFLTALNSVINPFVYIILMKSFRN
KYLQVWIPKFIIVKFSREIEDKEYSTNTSTI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 1..130
e-value: 2.3E-11
score: 45.0
NoneNo IPR availableCDDcd006377tm_classA_rhodopsin-likecoord: 2..94
e-value: 3.53466E-4
score: 36.8718
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 2..115
NoneNo IPR availableTMHMMTMhelixcoord: 72..94
NoneNo IPR availableTMHMMTMhelixcoord: 40..62
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 1..91
score: 9.9