DUF3421 domain-containing protein

Overview
NameDUF3421 domain-containing protein
Smed IDSMED30004057
Length (bp)813
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF3421 domain-containing protein (SMED30004057) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF3421 domain-containing protein (SMED30004057) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF3421 domain-containing protein (SMED30004057) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF3421 domain-containing protein (SMED30004057) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004057

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30004057h1SMcG0009296 SmedASXL_019036SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30004057h1SMcG0009296 Contig35204newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004057h1SMcG0009296 Contig35204uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004057h1SMcG0009297 Contig17650newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004057h1SMcG0009297 Contig17650uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30004057h1SMcG0009296 dd_Smed_v4_1355_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004057h1SMcG0009296 dd_Smed_v4_1355_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004057h1SMcG0009296 Contig17650newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004057h1SMcG0009296 Contig17650uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30004057h1SMcG0009296 dd_Smed_v6_1355_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
whole organismSMED30004057h1SMcG0009296 Contig35204newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30004057h1SMcG0009296 Contig35204uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30004057h1SMcG0009296 Contig35204newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30004057h1SMcG0009296 Contig35204uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30004057h1SMcG0009296 dd_Smed_v6_1355_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30004057h1SMcG0009296 dd_Smed_v6_1355_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004057h1SMcG0009296 dd_Smed_v4_1355_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG10527 (gene:FBgn0034583 transcript:FBtr0071541)

HSP 1 Score: 95.5153 bits (236), Expect = 8.026e-23
Identity = 59/140 (42.14%), Postives = 77/140 (55.00%), Query Frame = 3
Query:  360 WQNASNGHVPPNSVSAG-DS----YIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQVLGDQGYQWKPCSGSNIPSGAIIGGVDG-GKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEI 761
            W  A+NG VPPN++  G DS    YIARA H G+ IPGKL       ++ + G E   +EY+VL         G QW P    NIP  A+  G    G+PL++GRA  +G +  GK  P HGC YIPYG +E +  + EI
Sbjct:  159 WVPAANGEVPPNALEGGFDSSEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLCA------GGGQWLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVGKVQPSHGCCYIPYGGEELAYKEFEI 292          

HSP 2 Score: 63.5438 bits (153), Expect = 2.270e-11
Identity = 27/65 (41.54%), Postives = 39/65 (60.00%), Query Frame = 3
Query:  573 WKPCSGSNIPSGAIIGGVDGGKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEILC 767
            W P +   +P  A+ GG D  + LY+ RAR EG ++ GK  P HG TY+ +G  EH  ++ E+LC
Sbjct:  159 WVPAANGEVPPNALEGGFDSSEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLC 223          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG13321 (gene:FBgn0033787 transcript:FBtr0345371)

HSP 1 Score: 94.7449 bits (234), Expect = 1.235e-22
Identity = 53/137 (38.69%), Postives = 77/137 (56.20%), Query Frame = 3
Query:  378 GHVPPNSVSAGDS------YIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQVLGDQGYQWKPCSGSNIPSGAI-IGGVDGGKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEILC 767
            G +PP ++ AG        ++ RA HNGE +P K+V G+  A++ + G E+   +++VLV     GD  + W P SG ++P  AI +G    G+PLYVGR   +G +  GK  P H C YIPYG +EH     E+L 
Sbjct:   13 GSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEVLV-----GDH-FSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLV 143          

HSP 2 Score: 83.9593 bits (206), Expect = 1.179e-18
Identity = 52/145 (35.86%), Postives = 69/145 (47.59%), Query Frame = 3
Query:  354 LSWQNASNGHVPPNSVSAGDS------YIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQVLGDQGYQWKPCSGSNIPSGAIIGGVDG-GKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEILC 767
             SW  +S G VPP+++  G +      Y+ R    G   PGK+       +I Y G E     Y+VLV  +        W   SG  I  G ++GG D  G  +YVGRA  EG +L  K +P  GC Y+PYG  E  K D E+L 
Sbjct:   76 FSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLVQPET-------WIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLA 213          

HSP 3 Score: 72.0182 bits (175), Expect = 2.209e-14
Identity = 44/144 (30.56%), Postives = 70/144 (48.61%), Query Frame = 3
Query:  357 SWQNASNGHVPPNSVSAGDS------YIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQVLGDQGYQWKPCSGSNIPSGAII-GGVDGGKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEILC 767
            +W  +S   + P +V  G        Y+ RA H G+ +P K++  +  A++ Y G EV+  +Y++L         GY W   S  N+P  A++ G    G+PL++GRA   G +  GK    H C YIP+  +E      E+L 
Sbjct:  147 TWIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLAGY------GYGWVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVLV 284          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG13321 (gene:FBgn0033787 transcript:FBtr0087792)

HSP 1 Score: 94.7449 bits (234), Expect = 1.235e-22
Identity = 53/137 (38.69%), Postives = 77/137 (56.20%), Query Frame = 3
Query:  378 GHVPPNSVSAGDS------YIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQVLGDQGYQWKPCSGSNIPSGAI-IGGVDGGKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEILC 767
            G +PP ++ AG        ++ RA HNGE +P K+V G+  A++ + G E+   +++VLV     GD  + W P SG ++P  AI +G    G+PLYVGR   +G +  GK  P H C YIPYG +EH     E+L 
Sbjct:   13 GSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEVLV-----GDH-FSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLV 143          

HSP 2 Score: 83.9593 bits (206), Expect = 1.179e-18
Identity = 52/145 (35.86%), Postives = 69/145 (47.59%), Query Frame = 3
Query:  354 LSWQNASNGHVPPNSVSAGDS------YIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQVLGDQGYQWKPCSGSNIPSGAIIGGVDG-GKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEILC 767
             SW  +S G VPP+++  G +      Y+ R    G   PGK+       +I Y G E     Y+VLV  +        W   SG  I  G ++GG D  G  +YVGRA  EG +L  K +P  GC Y+PYG  E  K D E+L 
Sbjct:   76 FSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLVQPET-------WIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLA 213          

HSP 3 Score: 72.0182 bits (175), Expect = 2.209e-14
Identity = 44/144 (30.56%), Postives = 70/144 (48.61%), Query Frame = 3
Query:  357 SWQNASNGHVPPNSVSAGDS------YIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQVLGDQGYQWKPCSGSNIPSGAII-GGVDGGKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEILC 767
            +W  +S   + P +V  G        Y+ RA H G+ +P K++  +  A++ Y G EV+  +Y++L         GY W   S  N+P  A++ G    G+PL++GRA   G +  GK    H C YIP+  +E      E+L 
Sbjct:  147 TWIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLAGY------GYGWVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVLV 284          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG44250 (gene:FBgn0265185 transcript:FBtr0339104)

HSP 1 Score: 87.8113 bits (216), Expect = 4.156e-20
Identity = 50/141 (35.46%), Postives = 72/141 (51.06%), Query Frame = 3
Query:  384 VPPNSVSAGDS------YIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQVLGDQGYQWKPCSGSNIPSGAIIGGVD-GGKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEILCFSKRNV 785
            +PP +V  G        Y+ R+ H GE +P K+V  +  A++ Y G E   + Y+VLV       QG+ W P S   +P  A+  G    G+PLYVGR    G +  GK  P HGC YIP+G +E   +  E+L   + +V
Sbjct:   14 LPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVLVG------QGFAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVLIKQQHDV 148          

HSP 2 Score: 82.8037 bits (203), Expect = 3.056e-18
Identity = 49/142 (34.51%), Postives = 65/142 (45.77%), Query Frame = 3
Query:  360 WQNASNGHVPPNSVSAGDS------YIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQVLGDQGYQWKPCSGSNIPSGAIIGGVDGGKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEILC 767
            W  AS  + PP +V AG        Y  RA+H GE +P K+V  +  A++C+ G E     Y+VL         GY W  C  S  P+    G    G+ LY GR   +G +  G       C YIPYG +E   +  EILC
Sbjct:  149 WVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVLTG------YGYVWMNCGHSIPPNAVTTGRARNGELLYYGRGHYQGSLTPGLISASQRCLYIPYGGREIRINSYEILC 284          

HSP 3 Score: 81.2629 bits (199), Expect = 1.046e-17
Identity = 51/145 (35.17%), Postives = 72/145 (49.66%), Query Frame = 3
Query:  354 LSWQNASNGHVPPNSVSAGDS------YIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQVLGDQGYQWKPCSGSNIPSGAIIGGVDGGK-PLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEILC 767
             +W  +S+G VPPN+V +G +      Y+ R  H G    GK+       +I + G EV  + Y+VL+       Q   W P S S  P GA+I G D  + P+Y GRA  EG+ML  K +P  G  Y+ +G  E  K   E+L 
Sbjct:   75 FAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVLIK-----QQHDVWVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVLT 214          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG44250 (gene:FBgn0265185 transcript:FBtr0339105)

HSP 1 Score: 88.1965 bits (217), Expect = 4.441e-20
Identity = 50/141 (35.46%), Postives = 72/141 (51.06%), Query Frame = 3
Query:  384 VPPNSVSAGDS------YIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQVLGDQGYQWKPCSGSNIPSGAIIGGVD-GGKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEILCFSKRNV 785
            +PP +V  G        Y+ R+ H GE +P K+V  +  A++ Y G E   + Y+VLV       QG+ W P S   +P  A+  G    G+PLYVGR    G +  GK  P HGC YIP+G +E   +  E+L   + +V
Sbjct:   25 LPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVLVG------QGFAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVLIKQQHDV 159          

HSP 2 Score: 82.8037 bits (203), Expect = 3.417e-18
Identity = 49/142 (34.51%), Postives = 65/142 (45.77%), Query Frame = 3
Query:  360 WQNASNGHVPPNSVSAGDS------YIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQVLGDQGYQWKPCSGSNIPSGAIIGGVDGGKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEILC 767
            W  AS  + PP +V AG        Y  RA+H GE +P K+V  +  A++C+ G E     Y+VL         GY W  C  S  P+    G    G+ LY GR   +G +  G       C YIPYG +E   +  EILC
Sbjct:  160 WVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVLTG------YGYVWMNCGHSIPPNAVTTGRARNGELLYYGRGHYQGSLTPGLISASQRCLYIPYGGREIRINSYEILC 295          

HSP 3 Score: 81.2629 bits (199), Expect = 1.074e-17
Identity = 51/145 (35.17%), Postives = 72/145 (49.66%), Query Frame = 3
Query:  354 LSWQNASNGHVPPNSVSAGDS------YIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQVLGDQGYQWKPCSGSNIPSGAIIGGVDGGK-PLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEILC 767
             +W  +S+G VPPN+V +G +      Y+ R  H G    GK+       +I + G EV  + Y+VL+       Q   W P S S  P GA+I G D  + P+Y GRA  EG+ML  K +P  G  Y+ +G  E  K   E+L 
Sbjct:   86 FAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVLIK-----QQHDVWVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVLT 225          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A1I8H8B2 (DUF3421 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012514g1 PE=4 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 3.567e-38
Identity = 76/159 (47.80%), Postives = 104/159 (65.41%), Query Frame = 3
Query:  309 MSQVKSSGGKGIEICLSWQNASNGHVPPNSVSAG-DSYIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQV--LGDQGYQWKPCSGSNIPSGAIIGGVDGGKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHS-KSDSEILCFS 773
            MS+V  +  +GIE+CLSW  ASNG +P  +V AG D Y+ARA H GE++PGKL AG + A++ Y   EV  SEY+VLV++++   G  GYQW P  G+++P GA++ G D G PLYV RA  EG++  GK  P+  C YI +G KEH    D E+L  +
Sbjct:    1 MSRVNHNDIEGIELCLSWHPASNGDIPAGAVKAGEDCYVARAKHEGEWVPGKLSAGHTSAYVPYGDEEVPYSEYEVLVSSEIGHFG-CGYQWLPAKGNSVPKGALVSGYDNGAPLYVARATFEGEVCCGKAQPDLECAYISWGGKEHKIVDDYEVLTMN 158          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A1I8I9L7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020479g1 PE=4 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.794e-35
Identity = 72/163 (44.17%), Postives = 99/163 (60.74%), Query Frame = 3
Query:  309 MSQVKSSGGKGIEICLSWQNASNGHVPPNSVS-AGDSYIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNT---QVLGDQGYQWKPCSGSNIPSGAIIGGVDGGKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDS-EILCFSKRN 782
            MS  KSSGGKG+++CLSW NA+NG +P  +VS  GD ++AR   +GE +PGK+ AG +  +  YDG E     YQVL  T    + G  G++W   SG+  P  A+I G D G+PLYV +A I+G+  AGK +P++G  Y   G  EH K D  E+L    R+
Sbjct:    1 MSTFKSSGGKGVDLCLSWVNAANGEIPAGAVSIGGDVFVARCFSDGELLPGKVAAGHNSCYAPYDGEEKCCDTYQVLCETCNHGLTGGPGFEWVAWSGNTAPKHALISGSDQGRPLYVAKANIDGEWCAGKYIPDYGKAYFSCGGAEHEKEDDFEVLVMCTRS 163          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: Q5DHE4 (SJCHGC04453 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 1.132e-34
Identity = 65/151 (43.05%), Postives = 99/151 (65.56%), Query Frame = 3
Query:  333 GKGIEICLSWQNASNGHVPPNSVS-AGDSYIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQVLG-DQGYQWKPCSGSNIPSGAIIGGVDGGKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEILCFSKR 779
            GKGI+I LSW  A++G+VP N+++ +GD Y+ R+ H+G +IPGK V G + A+   +G E+   EY+VL +T + G ++GY+W+  SG N+P  AII G+ G  PLY+ R  + G++  GK    H C Y P+G  EHS +D E+L + K+
Sbjct:    5 GKGIQIPLSWVPATDGNVPHNAINVSGDIYVIRSKHDGHWIPGKAVIGHNTAYYPMNGQEIKTREYEVLCDTSLSGHNKGYEWESESGGNVPKNAIIAGMSGNDPLYIARGSVNGEVCVGKVHYGHNCAYFPWGGNEHSVNDYEVLVWKKK 155          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A5K4FBP2 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 3.112e-34
Identity = 67/151 (44.37%), Postives = 91/151 (60.26%), Query Frame = 3
Query:  333 GKGIEICLSWQNASNGHVPPNSVSAGDS-YIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQVLGDQGYQWKPCSGSNIPSGAIIGGVDGGKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEILCFSKRN 782
            GKGI+I LSW    NG+VP N++S  +  Y+ R  H+ ++IPGK   G   A+  Y G E    EY+VL +T   G QGY+W   S  N+P  AIIGG+ G  PLY+ +++I G+   GK    H C YIP+G +EHS  D E+L + KRN
Sbjct:    5 GKGIQIPLSWVPDRNGNVPHNAISVTNGIYVVRCQHDRQWIPGKAANGHDTAYYPYGGEEKNTKEYEVLCDTSFSGHQGYEWVQASCGNVPKNAIIGGMSGNDPLYIAKSKINGETCVGKVHHGHECAYIPWGGQEHSVKDYEVLVWKKRN 155          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A4Z2D8K2 (Natterin-4 OS=Schistosoma japonicum OX=6182 GN=EWB00_003361 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 2.348e-33
Identity = 65/147 (44.22%), Postives = 96/147 (65.31%), Query Frame = 3
Query:  333 GKGIEICLSWQNASNGHVPPNSVS-AGDSYIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQVLG-DQGYQWKPCSGSNIPSGAIIGGVDGGKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEILC 767
            GKGI+I LSW  A++G+VP N+V+ +GD Y+ R+ H+G +IPGK V G + A+   +G E+   EY+VL +T + G ++GY+W+  SG N+P  AII G+ G  PLY+ R  + G++  GK    H C Y P+G  EHS +D E+L 
Sbjct:    5 GKGIQIPLSWVPATDGNVPHNAVNVSGDIYVIRSKHDGHWIPGKAVIGHNTAYYPMNGQEIKTREYEVLCDTSLSGHNKGYEWESESGGNVPKNAIIAGMSGNDPLYIARGSVNGEVCVGKVHYGHNCAYFPWGGNEHSVNDYEVLV 151          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000029906.1 (SMESG000029906.1)

HSP 1 Score: 218.779 bits (556), Expect = 4.423e-72
Identity = 102/159 (64.15%), Postives = 127/159 (79.87%), Query Frame = 3
Query:  309 MSQVKSSGGKGIEICLSWQNASNGHVPPNSVSAGDSYIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQVLGDQGYQWKPCSGSNIPSGAIIGGVDGGKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEILCFSKRNV 785
            MS+VKS+ GKGIEI LSWQ ASNGH+P +SV+AG+SYIARA++NGEYIPGK+V GE+ A+ICYDG E+  SEY+VLV+T   G Q Y+WK   GS IP G++IGG D G+PLY+GRAR+  K+LAGK  PEHGCTYIPY  +E+ K D ++LCF KR V
Sbjct:    1 MSKVKSAAGKGIEISLSWQKASNGHIPNDSVNAGNSYIARAVYNGEYIPGKIVRGENCAYICYDGKEISCSEYEVLVDTHNFGGQAYEWKSSRGSVIPKGSVIGGSDEGRPLYIGRARVADKLLAGKFQPEHGCTYIPYDSQENRKEDYDVLCFLKRRV 159          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000074377.1 (SMESG000074377.1)

HSP 1 Score: 169.474 bits (428), Expect = 9.813e-53
Identity = 77/154 (50.00%), Postives = 105/154 (68.18%), Query Frame = 3
Query:  309 MSQVKSSGGKGIEICLSWQNASNGHVPPNSVSAGDS-YIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQVLGDQGYQWKPCSGSNIPSGAIIGGVDGGKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEILC 767
            MS+V S  GKG+EIC+SWQ ASNG +P  +V AG   ++ RA  NG+YIPGKL  G  G ++ Y G E+  + Y+ LV T VL + G+QWK   G+N+PSGAI+GG D G+PLY+ R+ + G+ + GK  P HGC Y P+G +EH K+  E+LC
Sbjct:    1 MSKVSSQYGKGVEICVSWQKASNGEIPHRTVKAGGKCFVGRAQQNGQYIPGKLYEGHKGVYVSYGGKEICVNNYEALVETNVLHNDGFQWKYVDGNNVPSGAIVGGTDNGQPLYIARSEVNGEPVVGKYFPPHGCAYFPFGGEEHRKTGVEVLC 154          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000074396.1 (SMESG000074396.1)

HSP 1 Score: 166.392 bits (420), Expect = 1.644e-51
Identity = 75/161 (46.58%), Postives = 114/161 (70.81%), Query Frame = 3
Query:  309 MSQVKSSGGKGIEICLSWQNASNGHVPPNSVSAG-DSYIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQVLG-DQGYQWKPCSGSNIPSGAIIGGVDGGKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEILCFSKRNV 785
            MS+V S  G G+E+ LSW  A+NG +PP +V AG  +++ARA H+G+YIPGK V G +   + + GVE   + Y++LV + +LG  +GY+WK  +G N+P GA++GG++ G PLYV R+ IE +M+ GK  P+HGC Y+PYG +EH   ++E+LCF+ ++V
Sbjct:    1 MSKVSSQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLCFTTKHV 161          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000074378.1 (SMESG000074378.1)

HSP 1 Score: 166.392 bits (420), Expect = 1.644e-51
Identity = 75/161 (46.58%), Postives = 114/161 (70.81%), Query Frame = 3
Query:  309 MSQVKSSGGKGIEICLSWQNASNGHVPPNSVSAG-DSYIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQVLG-DQGYQWKPCSGSNIPSGAIIGGVDGGKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEILCFSKRNV 785
            MS+V S  G G+E+ LSW  A+NG +PP +V AG  +++ARA H+G+YIPGK V G +   + + GVE   + Y++LV + +LG  +GY+WK  +G N+P GA++GG++ G PLYV R+ IE +M+ GK  P+HGC Y+PYG +EH   ++E+LCF+ ++V
Sbjct:    1 MSKVSSQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLCFTTKHV 161          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000029910.1 (SMESG000029910.1)

HSP 1 Score: 162.54 bits (410), Expect = 4.585e-50
Identity = 76/160 (47.50%), Postives = 108/160 (67.50%), Query Frame = 3
Query:  309 MSQVKSSGGKGIEICLSWQNASNGHVPPNSVSA-GDSYIARALHNGEYIPGKLVAGESGAHICYDGVEVMASEYQVLVNTQVLGDQGYQWKPCSGSNIPSGAIIGGVDGGKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSEILCFSKRNV 785
            MS+V +  G+ +EI +SWQ A +G +P ++V A G  ++ARA HNGEYIPGKLV G S   +CYDG E+  S YQVLV+T +L   GY+WK      IP  AIIGG D G+PL++ ++ +EG+ + GK  P+HGC ++PY   E  K++ EILC  K+++
Sbjct:    1 MSKVITQYGRAVEISVSWQEAHDGSIPLHAVKADGSCFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSEDLEIPPNAIIGGTDNGQPLFIVKSIVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEILCSLKKHL 160          
The following BLAST results are available for this feature:
BLAST of DUF3421 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG105278.026e-2342.14gene:FBgn0034583 transcript:FBtr0071541[more]
CG133211.235e-2238.69gene:FBgn0033787 transcript:FBtr0345371[more]
CG133211.235e-2238.69gene:FBgn0033787 transcript:FBtr0087792[more]
CG442504.156e-2035.46gene:FBgn0265185 transcript:FBtr0339104[more]
CG442504.441e-2035.46gene:FBgn0265185 transcript:FBtr0339105[more]
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8H8B23.567e-3847.80DUF3421 domain-containing protein OS=Macrostomum l... [more]
A0A1I8I9L71.794e-3544.17Uncharacterized protein OS=Macrostomum lignano OX=... [more]
Q5DHE41.132e-3443.05SJCHGC04453 protein OS=Schistosoma japonicum OX=61... [more]
A0A5K4FBP23.112e-3444.37Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A4Z2D8K22.348e-3344.22Natterin-4 OS=Schistosoma japonicum OX=6182 GN=EWB... [more]
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029906.14.423e-7264.15SMESG000029906.1[more]
SMESG000074377.19.813e-5350.00SMESG000074377.1[more]
SMESG000074396.11.644e-5146.58SMESG000074396.1[more]
SMESG000074378.11.644e-5146.58SMESG000074378.1[more]
SMESG000029910.14.585e-5047.50SMESG000029910.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004057 ID=SMED30004057|Name=DUF3421 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=813bp
CAGATCTGATACGCACAGCAATTATTTTCGTATGTTCATATGAATAACAT
AGAGATAATATCTGTTATATACGGCATTGAACATCATTATTGTGAAATGA
GTGATCAAGCTCTTGGCAGGCCACCTAAGGCCCATGACCAAAGACGTGAT
TCATTACTGGCCAACTGATCGCCAGTCATACTTAGCGATTATGCTGCGAT
TCATTCAAGCGAGACGAGTCCACAATTGAATGAGAATGAATCATTTCTTG
TTGATTACCGTGCTTAATATAAATGGTTCGTTAGTTTTCTTTTTGATTTT
ATTTTGAAATGAGTCAAGTAAAAAGTTCTGGTGGTAAAGGTATTGAAATA
TGTCTTTCATGGCAAAATGCATCAAACGGACATGTTCCTCCAAATTCCGT
AAGCGCCGGTGATTCTTATATTGCTAGAGCATTACATAATGGAGAGTACA
TTCCAGGGAAACTCGTGGCTGGTGAGAGTGGTGCCCACATCTGCTATGAT
GGAGTAGAGGTCATGGCTTCTGAATATCAAGTGTTAGTAAATACTCAAGT
TCTTGGTGACCAGGGTTATCAGTGGAAACCTTGTAGTGGATCCAATATTC
CAAGTGGAGCAATTATAGGAGGCGTAGATGGCGGTAAACCTCTTTACGTT
GGAAGAGCCAGAATAGAAGGTAAAATGCTGGCTGGGAAATGTCTACCTGA
GCACGGATGCACCTACATACCTTACGGTTGTAAAGAACATAGCAAATCGG
ATTCTGAAATTTTATGTTTCTCGAAAAGAAACGTTTAATAAAAATATAAT
TATTGAAAAAAAA
back to top

protein sequence of SMED30004057-orf-1

>SMED30004057-orf-1 ID=SMED30004057-orf-1|Name=SMED30004057-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=160bp
MSQVKSSGGKGIEICLSWQNASNGHVPPNSVSAGDSYIARALHNGEYIPG
KLVAGESGAHICYDGVEVMASEYQVLVNTQVLGDQGYQWKPCSGSNIPSG
AIIGGVDGGKPLYVGRARIEGKMLAGKCLPEHGCTYIPYGCKEHSKSDSE
ILCFSKRNV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006368transcription elongation from RNA polymerase II promoter
GO:0016570histone modification
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0016593Cdc73/Paf1 complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000136whole organism
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR006616DM9_repeat
IPR024518DUF3421
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006616DM9 repeatSMARTSM00696dm9coord: 86..155
e-value: 9.2E-24
score: 94.9
coord: 15..79
e-value: 2.2E-8
score: 43.8
IPR024518Domain of unknown function DUF3421PFAMPF11901DUF3421coord: 36..145
e-value: 2.7E-29
score: 101.5
coord: 108..155
e-value: 2.0E-12
score: 47.1
NoneNo IPR availablePANTHERPTHR31649FAMILY NOT NAMEDcoord: 16..79
coord: 79..156