Non-specific ribonucleoside hydrolase RihC

Overview
NameNon-specific ribonucleoside hydrolase RihC
Smed IDSMED30004055
Length (bp)1150
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Non-specific ribonucleoside hydrolase RihC (SMED30004055) t-SNE clustered cells

Violin plots show distribution of expression levels for Non-specific ribonucleoside hydrolase RihC (SMED30004055) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Non-specific ribonucleoside hydrolase RihC (SMED30004055) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Non-specific ribonucleoside hydrolase RihC (SMED30004055) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004055

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30004055SMESG000051886.1 SMESG000051820.1 SMESG000051808.1 SMESG000051775.1 dd_Smed_v4_2952_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004055SMESG000051886.1 SMESG000051820.1 SMESG000051808.1 SMESG000051775.1 dd_Smed_v4_2952_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004055SMESG000080852.1 SMESG000069362.1 SMESG000051886.1 SMESG000051820.1 SMESG000051808.1 SMESG000051775.1 Contig17098uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004055SMESG000080852.1 SMESG000069362.1 SMESG000051886.1 SMESG000051820.1 SMESG000051808.1 SMESG000051775.1 Contig17098newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30004055SMESG000051886.1 SMESG000051820.1 SMESG000051808.1 SMESG000051775.1 dd_Smed_v4_2952_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30004055SMESG000051886.1 SMESG000051820.1 SMESG000051808.1 SMESG000051775.1 dd_Smed_v4_2952_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Celegans
Match: F13H8.3 (pep chromosome:WBcel235:II:6264050:6265496:1 gene:WBGene00017436.1 transcript:F13H8.3.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F13H8.3)

HSP 1 Score: 100.908 bits (250), Expect = 1.339e-23
Identity = 86/307 (28.01%), Postives = 153/307 (49.84%), Query Frame = 1
Query:   97 MKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRNLQLIVSSI-RPEIKIYKGSSQFII-ENPV-IADDYHGPDGLG-------RFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIK-KEYFENWNANELFKQILEISHGYLDAKMAK----------IYLY-DLILAIIVMHPEVVLKETTKSATIDLTGN-FSRGFIIID 948
            +KL ID D   DD   L   LT ++++++ I +V+G V + +   N+  ++ +I +  + ++ G+   ++ + P+ + ++  G DG+G       +   S++  A                 +AV  +I L+ K  K +++  LGPLTNIA+A   DP+  +RVK++ IMGGN  G GN+      EFNF MDPEA  +VL+ +     + P D   T F+K  EY E  +  E   Q  ++S+ +L    A+          IY + D I   + + P + ++  T  ++++L     +RG + +D
Sbjct:   23 VKLIIDTDGVYDDIRGLTIALTNQNVEVIAITTVHGGVTANQSAANVARLLRAIGKHNVPVFIGAQDSLVPKGPIQVWEELFGSDGIGGVPDVEPKTLPSDFNSAQVG--------------NAVDAIINLT-KSTKDIILVGLGPLTNIAMAIRKDPDISKRVKQVVIMGGNYLGVGNTQFNSTAEFNFLMDPEAAHIVLSSLHTT--MIPWD---TCFLKGPEYNEEVDYEESLNQKTKLSY-FLSNITARGRQYNKASGQIYAFVDDIAVSVAIDPRIAVRNMTLCSSVELKKEAVARGQVTVD 308          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Celegans
Match: F13H8.3 (pep chromosome:WBcel235:II:6264050:6265502:1 gene:WBGene00017436.1 transcript:F13H8.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F13H8.3)

HSP 1 Score: 100.908 bits (250), Expect = 1.339e-23
Identity = 86/307 (28.01%), Postives = 153/307 (49.84%), Query Frame = 1
Query:   97 MKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRNLQLIVSSI-RPEIKIYKGSSQFII-ENPV-IADDYHGPDGLG-------RFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIK-KEYFENWNANELFKQILEISHGYLDAKMAK----------IYLY-DLILAIIVMHPEVVLKETTKSATIDLTGN-FSRGFIIID 948
            +KL ID D   DD   L   LT ++++++ I +V+G V + +   N+  ++ +I +  + ++ G+   ++ + P+ + ++  G DG+G       +   S++  A                 +AV  +I L+ K  K +++  LGPLTNIA+A   DP+  +RVK++ IMGGN  G GN+      EFNF MDPEA  +VL+ +     + P D   T F+K  EY E  +  E   Q  ++S+ +L    A+          IY + D I   + + P + ++  T  ++++L     +RG + +D
Sbjct:   23 VKLIIDTDGVYDDIRGLTIALTNQNVEVIAITTVHGGVTANQSAANVARLLRAIGKHNVPVFIGAQDSLVPKGPIQVWEELFGSDGIGGVPDVEPKTLPSDFNSAQVG--------------NAVDAIINLT-KSTKDIILVGLGPLTNIAMAIRKDPDISKRVKQVVIMGGNYLGVGNTQFNSTAEFNFLMDPEAAHIVLSSLHTT--MIPWD---TCFLKGPEYNEEVDYEESLNQKTKLSY-FLSNITARGRQYNKASGQIYAFVDDIAVSVAIDPRIAVRNMTLCSSVELKKEAVARGQVTVD 308          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Celegans
Match: Y43F8C.13 (pep chromosome:WBcel235:V:19693896:19697398:-1 gene:WBGene00012834.1 transcript:Y43F8C.13.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y43F8C.13)

HSP 1 Score: 90.5077 bits (223), Expect = 3.978e-20
Identity = 68/213 (31.92%), Postives = 107/213 (50.23%), Query Frame = 1
Query:   82 ILLNKMKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRNLQ-LIVSSIRPEIKIYKGSSQFIIENPV--IADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDA 711
            + ++K+KL ID D   DD  A+   L     +I+   +V+G V  ++   N++  I ++ R  I +YKG+++ I+  P      D+ G DG+G   K E +   ++   E   K       A   LI++ R+  +   +  +GPLTN+A+A  +  EF      + IMGGN    GN       E+NF  DPEA  +VL RM+CP  I P +A
Sbjct:    1 MTVDKVKLVIDSDGVSDDVRAISLALQHPKAEILAFTAVHGCVTVDQACANIKRTIRANDRSNIPVYKGAAKSILSLPKDDTVSDFFGIDGIGD--KPEEFPKVERSDFEGEGKH------ASLALIDILRE-NRDATLVTIGPLTNVAIALQLCEEFSTYPSRLVIMGGNYYAVGNVDGGSSAEYNFHGDPEAASIVLRRMKCPITIVPWEA 204          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Fly
Match: CG12177 (gene:FBgn0030510 transcript:FBtr0340399)

HSP 1 Score: 112.079 bits (279), Expect = 1.902e-27
Identity = 104/359 (28.97%), Postives = 161/359 (44.85%), Query Frame = 1
Query:  109 IDCDPGIDDAFALGYFLTRKD------LDIVGIGSVNGNVDSEKVNRNLQLIVSSI-RPEIKIYKGSSQFIIENPVIADD---YHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALA-QLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFE---NWNANELFKQILEISHGYLDA----------KMAKIYLYD-------LILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDHPFYYKDRSKF-SSVSIIKELDEQKIIDFIKSF*QFLEAV 1089
            +DCD G DDA+AL   L          L I  +G   GN   E   RN++ I+ +  R +I IY G+   +I  P + D+   +HG DG G     +           +  +       AV  + +L R  PK + I A+GPLTN+AL   +  PEFG   +++FIMGGN +G GNS      EFNF  DPEA   VL R +CP  I P +A        E F    NW   +   +  E  H  +             M + Y  D       + +A+ +    ++ +  T  AT+DL G  +RG +++D           + ++R K+  +V II+ +D    ++F K   +++  +
Sbjct:   29 LDCDGGSDDAWALLLLLHAAKSHGIHLLAITTMGC--GNTSRENAARNMRRILDACKRTDIPIYLGAVDALI--PSLEDEKKYFHGRDGFGDCLTDD---------CALQLEDIVQAEHAVTAIHDLCRSRPKQITIFAVGPLTNLALGYTMYGPEFGNNFRDLFIMGGNYQGVGNSSR--SAEFNFHSDPEAAHTVLLRTRCPITILPWEAC-----LPERFNIHINWRLKDFAARAKEAGHPAITMLNQVEAAQWLPMIEQYGIDTWNPCDAIAVAVWLFEDHLIRRHNTWHATVDLRGTHTRGQMVLD-----------HLREREKYPENVRIIELVD----VEFFKRICEWIAGL 352          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Fly
Match: CG12177 (gene:FBgn0030510 transcript:FBtr0346119)

HSP 1 Score: 112.079 bits (279), Expect = 1.902e-27
Identity = 104/359 (28.97%), Postives = 161/359 (44.85%), Query Frame = 1
Query:  109 IDCDPGIDDAFALGYFLTRKD------LDIVGIGSVNGNVDSEKVNRNLQLIVSSI-RPEIKIYKGSSQFIIENPVIADD---YHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALA-QLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFE---NWNANELFKQILEISHGYLDA----------KMAKIYLYD-------LILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDHPFYYKDRSKF-SSVSIIKELDEQKIIDFIKSF*QFLEAV 1089
            +DCD G DDA+AL   L          L I  +G   GN   E   RN++ I+ +  R +I IY G+   +I  P + D+   +HG DG G     +           +  +       AV  + +L R  PK + I A+GPLTN+AL   +  PEFG   +++FIMGGN +G GNS      EFNF  DPEA   VL R +CP  I P +A        E F    NW   +   +  E  H  +             M + Y  D       + +A+ +    ++ +  T  AT+DL G  +RG +++D           + ++R K+  +V II+ +D    ++F K   +++  +
Sbjct:   29 LDCDGGSDDAWALLLLLHAAKSHGIHLLAITTMGC--GNTSRENAARNMRRILDACKRTDIPIYLGAVDALI--PSLEDEKKYFHGRDGFGDCLTDD---------CALQLEDIVQAEHAVTAIHDLCRSRPKQITIFAVGPLTNLALGYTMYGPEFGNNFRDLFIMGGNYQGVGNSSR--SAEFNFHSDPEAAHTVLLRTRCPITILPWEAC-----LPERFNIHINWRLKDFAARAKEAGHPAITMLNQVEAAQWLPMIEQYGIDTWNPCDAIAVAVWLFEDHLIRRHNTWHATVDLRGTHTRGQMVLD-----------HLREREKYPENVRIIELVD----VEFFKRICEWIAGL 352          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Fly
Match: CG12177 (gene:FBgn0030510 transcript:FBtr0073846)

HSP 1 Score: 112.079 bits (279), Expect = 1.902e-27
Identity = 104/359 (28.97%), Postives = 161/359 (44.85%), Query Frame = 1
Query:  109 IDCDPGIDDAFALGYFLTRKD------LDIVGIGSVNGNVDSEKVNRNLQLIVSSI-RPEIKIYKGSSQFIIENPVIADD---YHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALA-QLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFE---NWNANELFKQILEISHGYLDA----------KMAKIYLYD-------LILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDHPFYYKDRSKF-SSVSIIKELDEQKIIDFIKSF*QFLEAV 1089
            +DCD G DDA+AL   L          L I  +G   GN   E   RN++ I+ +  R +I IY G+   +I  P + D+   +HG DG G     +           +  +       AV  + +L R  PK + I A+GPLTN+AL   +  PEFG   +++FIMGGN +G GNS      EFNF  DPEA   VL R +CP  I P +A        E F    NW   +   +  E  H  +             M + Y  D       + +A+ +    ++ +  T  AT+DL G  +RG +++D           + ++R K+  +V II+ +D    ++F K   +++  +
Sbjct:   29 LDCDGGSDDAWALLLLLHAAKSHGIHLLAITTMGC--GNTSRENAARNMRRILDACKRTDIPIYLGAVDALI--PSLEDEKKYFHGRDGFGDCLTDD---------CALQLEDIVQAEHAVTAIHDLCRSRPKQITIFAVGPLTNLALGYTMYGPEFGNNFRDLFIMGGNYQGVGNSSR--SAEFNFHSDPEAAHTVLLRTRCPITILPWEAC-----LPERFNIHINWRLKDFAARAKEAGHPAITMLNQVEAAQWLPMIEQYGIDTWNPCDAIAVAVWLFEDHLIRRHNTWHATVDLRGTHTRGQMVLD-----------HLREREKYPENVRIIELVD----VEFFKRICEWIAGL 352          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Fly
Match: CG5418 (gene:FBgn0032436 transcript:FBtr0080382)

HSP 1 Score: 89.7373 bits (221), Expect = 1.278e-19
Identity = 90/332 (27.11%), Postives = 144/332 (43.37%), Query Frame = 1
Query:  112 DCDPGIDDAFALGYFLTRKDLDI--------VGIGSVNGNVDSEKVNRN-LQLIVSSIRPEIKIYKGSSQFIIENPVI-ADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIA-LAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEY--FENWNAN-------ELFKQILEISHGYLDAKMAKIYLY-DLILAIIVMHPEVVLKETTK-SATIDLTGNFSRGFIIIDEENHYLKDHPFYYKDRSKFSSVSIIKELDEQ 1041
            DCD G DDA+AL   L  + L +        + I  V GN D     +N L+++    R ++ +++G +  I+    +    +HG DGL       Y + +  +           +  AV  +  L  +YPK +     GPLTN A    L   +F  ++  IFIMGGN  G GN +     EFNF MDPEA    L R++ P  I P +    P I  ++    +W  +        L + +  +    L  +  K ++  D  LA   + P+ ++ E     AT++L G  +RG +++D       D         K S+V II  L+ +
Sbjct:   15 DCDIGTDDAWALALLLRGEQLSLASGRRYKLIAITCVQGNTDVVNGAQNALKILRLLERRDVPVFRGCANPIVTRTWLDISRFHGTDGLNDI--GGYPDVSDLQEQ-------LQQEHAVNAMYRLVCQYPKQVDFLLCGPLTNFASCINLYGDDFLDKIGGIFIMGGNIYGRGNIMKC--AEFNFMMDPEAAHTTLERLKVPAVILPWE----PSIDDDFNLSLDWRLDVLGSVDHPLVELLSRVERSMLVPRDIKHWINPDAALAAAYIFPKAMIAEQLDYHATVELAGVHTRGQMVLDHLRGRRVD-----AIHGKKSNVRIITHLNRE 326          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Fly
Match: CG11158 (gene:FBgn0030511 transcript:FBtr0073812)

HSP 1 Score: 89.3521 bits (220), Expect = 1.430e-19
Identity = 82/309 (26.54%), Postives = 138/309 (44.66%), Query Frame = 1
Query:   94 KMKLYI-DCDPGIDDAFALGYFLTRKDLD--------IVGIGSVNGNVDSEKVNRNLQLIVSSI-RPEIKIYKGSSQFIIENPV-IADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIA-LAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFE--NWNANEL------FKQIL-EISHGYLDAK-MAKIYLYDLILAIIVMHPEVVLKETTK-SATIDLTGNFSRGFIIIDE 951
            K +L + DCD G DDA+ L   L  ++L         ++ I +V+GN D++    N   ++ ++ R ++ +++G  + I+       + +HG DGL         +  ++               AV  +  L+R  P  +     GPLTN A    L    F   +  ++IMGGN  G GN       EFNF MDPEA  + L R+  P  I P +    P I  E+    +W  N L      F ++L  +    L+ +   K    D +L    + P+ ++ E  +  AT++L+G  +RG +++D 
Sbjct:    4 KHRLVVYDCDIGTDDAWGLAMLLRAEELTLREGRTCKVLAITTVHGNTDADNGTLNALRVLHTLNRRDVPVFRGCYESIVPRTWEYTNCFHGQDGLNDVGNYPVVDVEQE----------LQPEHAVNAMYRLARANPGQVDFLLCGPLTNFANCINLYGNSFLTNIGRVYIMGGNIFGKGNVTK--SAEFNFMMDPEAAHITLERLLEPAIILPWE----PCIDGEFDTTLDWRLNVLGAVDHPFIELLTRVERSMLEPRGFVKWISCDSLLTAAYLFPDAMIAEQRQYYATVELSGIHTRGQMVLDH 296          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Zebrafish
Match: si:dkey-4e7.3 (si:dkey-4e7.3 [Source:ZFIN;Acc:ZDB-GENE-070912-542])

HSP 1 Score: 134.035 bits (336), Expect = 8.488e-36
Identity = 91/307 (29.64%), Postives = 148/307 (48.21%), Query Frame = 1
Query:  100 KLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRNLQLIVSSIRP-EIKIYKGSSQFIIENPVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENWNANE-----LFKQILEIS---------HGYLDAKMAKIYLYDLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDH 975
            KL++D D G+DDA A+   L    + I+GI  V+GN   E V +N+  I+   +  EI +++G+++ ++   V   D+HG DGLG     E                   +  AV  +I +  + P  + + A  PLTN+ALA  +DP   Q++K ++IMGGN+   GN  T +  EFNF+ DPEA  +VLN   CP +I   + +    +  E+ + W A +       KQI + S            L A    I      +A  +    ++L+   ++ T++L GN  RG +++D  +   K H
Sbjct:    3 KLFVDVDCGVDDAQAIMMALAVPGVQILGISCVHGNTSVENVCKNVLRILKVCKHLEIPVFRGANKPLLGQVVGTGDFHGKDGLGDAPDPE-----------APGLDLVQKEGAVSAMIRIVNENPGEVSLVATAPLTNVALAVKLDPSLPQKLKGLYIMGGNTDSRGN--TTMCGEFNFAADPEAAYIVLNEFTCPVYIAAWEFTCHSKLPWEFCDGWLAQDTDKARFMKQIFQHSMKNSYSERIEKELVAGQGFISCDSYAIAAAI-DDTIILESLERAVTVELAGNCCRGMMVVDHLDLLQKTH 295          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Zebrafish
Match: si:ch211-201h21.5 (si:ch211-201h21.5 [Source:ZFIN;Acc:ZDB-GENE-030131-9599])

HSP 1 Score: 121.709 bits (304), Expect = 3.279e-31
Identity = 93/329 (28.27%), Postives = 149/329 (45.29%), Query Frame = 1
Query:  103 LYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRN-LQLIVSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRF------WKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENW-----NANELFKQILEISHGYL---------DAKMAKIYL-YDLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDHPFYYK---DRSKFSSV 1014
            L ID D GIDDA A+   L   ++ ++GI    GN + + V  N ++++    + +I ++KGS+  ++   +   D+ G DGLG        WK +  +                   AV  ++ L  + P  + + ALGPLTN+ALA  +DP   Q++K++++MGGN  G GN      +EFNF MD E+  VVL    CP HI   + +    +  EYFE       +  +  K+I      Y          D    K ++ YD       +   V+ +    +  +++ G   RG +I+D  N   K H  +     D  KFSS+
Sbjct:    6 LIIDTDCGIDDALAIIVALAAPNVKVLGITCCFGNTNVDNVCMNVMRVLTVCQQTQIPVFKGSAAPLLGPELPLKDHFGTDGLGGVLENSEEWKQQIQKE-----------------HAVHAILRLVNENPGQVSLIALGPLTNLALAVRLDPGLPQKLKDLYVMGGNMEGKGNMTP--SSEFNFRMDAESAYVVLEEYTCPTHIATWEFTCRNKLSWEYFEELVNQKTSVAQFIKKITSKCWAYSRDFNSSNNKDVLFGKGFVPYDAFAVAACLDSSVITESLRCAVRVEVRGELGRGMMIVDAANTLKKGHLAFVMRTCDLKKFSSM 315          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Zebrafish
Match: si:ch211-201h21.5 (si:ch211-201h21.5 [Source:ZFIN;Acc:ZDB-GENE-030131-9599])

HSP 1 Score: 121.709 bits (304), Expect = 3.279e-31
Identity = 93/329 (28.27%), Postives = 149/329 (45.29%), Query Frame = 1
Query:  103 LYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRN-LQLIVSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRF------WKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENW-----NANELFKQILEISHGYL---------DAKMAKIYL-YDLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDHPFYYK---DRSKFSSV 1014
            L ID D GIDDA A+   L   ++ ++GI    GN + + V  N ++++    + +I ++KGS+  ++   +   D+ G DGLG        WK +  +                   AV  ++ L  + P  + + ALGPLTN+ALA  +DP   Q++K++++MGGN  G GN      +EFNF MD E+  VVL    CP HI   + +    +  EYFE       +  +  K+I      Y          D    K ++ YD       +   V+ +    +  +++ G   RG +I+D  N   K H  +     D  KFSS+
Sbjct:    6 LIIDTDCGIDDALAIIVALAAPNVKVLGITCCFGNTNVDNVCMNVMRVLTVCQQTQIPVFKGSAAPLLGPELPLKDHFGTDGLGGVLENSEEWKQQIQKE-----------------HAVHAILRLVNENPGQVSLIALGPLTNLALAVRLDPGLPQKLKDLYVMGGNMEGKGNMTP--SSEFNFRMDAESAYVVLEEYTCPTHIATWEFTCRNKLSWEYFEELVNQKTSVAQFIKKITSKCWAYSRDFNSSNNKDVLFGKGFVPYDAFAVAACLDSSVITESLRCAVRVEVRGELGRGMMIVDAANTLKKGHLAFVMRTCDLKKFSSM 315          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Zebrafish
Match: si:dkey-4e7.3 (si:dkey-4e7.3 [Source:ZFIN;Acc:ZDB-GENE-070912-542])

HSP 1 Score: 118.242 bits (295), Expect = 2.000e-30
Identity = 71/213 (33.33%), Postives = 110/213 (51.64%), Query Frame = 1
Query:   52 SFKFKIFRNEILLNKMKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRNLQLIVSSIRP-EIKIYKGSSQFIIENPVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCP 687
            +   + F N    +  KL++D D G+DDA A+   L    + I+GI  V+GN   E V +N+  I+   +  EI +++G+++ ++   V   D+HG DGLG     E                   +  AV  +I +  + P  + + A  PLTN+ALA  +DP   Q++K ++IMGGN+   GN  T +  EFNF+ DPEA  +VLN   CP
Sbjct:   58 TCSLRHFSNVTEFSMKKLFVDVDCGVDDAQAIMMALAVPGVQILGISCVHGNTSVENVCKNVLRILKVCKHLEIPVFRGANKPLLGQVVGTGDFHGKDGLGDAPDPE-----------APGLDLVQKEGAVSAMIRIVNENPGEVSLVATAPLTNVALAVKLDPSLPQKLKGLYIMGGNTDSRGN--TTMCGEFNFAADPEAAYIVLNEFTCP 257          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Xenopus
Match: ENSXETT00000048559.1 (novel protein containing an Inosine-uridine preferring nucleoside hydrolase domain [Source:NCBI gene;Acc:734042])

HSP 1 Score: 131.339 bits (329), Expect = 1.142e-34
Identity = 92/329 (27.96%), Postives = 151/329 (45.90%), Query Frame = 1
Query:   88 LNKMKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRN-LQLIVSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENW-----NANELFKQILEISHGYLD-----------AKMAKIYLYDLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDHPFYYKDRSKFSSVSII 1023
            + K  L +D D G+DDA AL   L   +++I+GI   +GN   E V +N L+++    R EI +YKG+S+ ++ N + AD YHG DGLG                         +  AV  ++ ++ ++   + + A GPLTN+ALA  +DP F +++K +FIMGGN    GN    V  EFNF+ DPEA  VVLN   CP +I   + +   ++   + + W       +E  ++I   S  Y +           A       Y +  AI       V        +++L G  +RG +++D  +   K +  +   +     +  +
Sbjct:    1 MAKKLLLVDVDCGVDDAQALMVALAAPNVEILGITCCHGNSTIENVCQNVLRVLHVCDRMEIPVYKGASKPLLGNCLHADPYHGKDGLGDV-----------PDPGAPGLELLQKEHAVLAMLRIASEHAGQVSLVATGPLTNLALAVNMDPNFPKKIKNLFIMGGNMESRGN--VTVCGEFNFACDPEAAYVVLNAFDCPTYIATWEFTYKNYLPWTFHDEWIMQGTRKSEFMRKISAHSAKYTEECNSNPGEVWTAGFVSCDSYAMAAAI---DESFVTGSIHCGISVELNGALTRGMMVLDTTDKLKKKNKVFVLTKCDLEKLKCL 313          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Xenopus
Match: ENSXETT00000022763.1 (pyrimidine-specific ribonucleoside hydrolase rihA [Source:NCBI gene;Acc:548390])

HSP 1 Score: 117.857 bits (294), Expect = 1.508e-29
Identity = 92/342 (26.90%), Postives = 154/342 (45.03%), Query Frame = 1
Query:   88 LNKMKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRN-LQLIVSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENWNANELFKQILEISHGYLDAKMAKIYLYDLILAIIV---------MHPEVVLKETT------KSATIDLTGNFSRGFIIIDEENHYLKDHPFYYKDRSKFSSVSIIKELDEQKIIDFIKS 1065
              K  L ID D G DDA A+   +    ++I+GI  V GN   + V +N L+++    R +I +++G+ + ++   + A  +HG DGLG     +  +             +  +  AV  L  +  ++P  + + A GPLTN+ALA  +DP F Q++K ++IMGGN    GN  T    EFNF  DPE   +VLN   C  +I   + +    +  E++E W  N   K+   I   Y  +     Y    + A++                + ETT       + T++L+G F+RG +++D              D  K S   ++   D +K +  ++S
Sbjct:    3 CEKKLLLIDVDCGTDDAQAIMMAVAAPHVEILGITCVGGNTAVDNVCKNVLRVLRVCNRSDIPVFRGAFKPVLGEAIHASYFHGVDGLGDVPDQDAPD-----------MEQIQKEHAVDALNRIVSEHPGQISLVATGPLTNLALAVRMDPTFPQKLKSLYIMGGNMESRGN--TTACGEFNFLADPEGAYIVLNEFTCLTYIATWEHACRHKLSWEWYEQW-VNRSTKKADFIKKIYAHSLQYSRYNEKEVKAVVAGPGFVSCDSYAMAAAIDETTVTDFIECAVTVELSGKFARGMMVLD-----------LIGDLKKKSKARVMTGCDMEKFVVLMES 319          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Xenopus
Match: elof1 (ELF1 homolog, elongation factor 1 [Source:Xenbase;Acc:XB-GENE-940560])

HSP 1 Score: 112.079 bits (279), Expect = 1.903e-27
Identity = 92/311 (29.58%), Postives = 142/311 (45.66%), Query Frame = 1
Query:   94 KMKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRN-LQLIVSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENWNANELFKQILEISHGYLDAK-MAKIYLYDLI--------LAIIVMHPEVV----------LKETTKS------ATIDLTGNFSRGFIIID 948
            K  L ID D G DDA A+   +   ++ I+GI  V GN     V +N L+++    R +I +++G+ + I+   + A D+HG DGLG                         +  AV  L  +  K+P+ + + A GPLTN+ALA   D  F Q++K +FIMGGN    GN  T    EFNF  DPEA  VVLN   C  +I   + +    +  E+++ W           +S G   A  + KIY + L         +  +V  P  V          + E+T +       T+++ G F+RG +++D
Sbjct:    5 KKLLLIDVDCGTDDAQAIMMAIAAPNIHILGITCVEGNTSLNNVCKNVLRVLKLCNRLDIPVFRGAGKPILGEAIHASDFHGSDGLGDV-----------PDPNAPGLDLIQKEYAVDALKRIVSKHPEQISLIATGPLTNLALAVRTDSTFPQKLKALFIMGGNMESRGN--TTACGEFNFLADPEAAYVVLNEFTCKTYIATWEHTCYYKLPWEWYDQW-----------VSRGTKKADFIKKIYAHSLQYSRNNEKEIKALVGGPGFVSCDSYAMAAAIDESTVTNVIECGVTVEMCGKFTRGMMVLD 291          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Xenopus
Match: elof1 (ELF1 homolog, elongation factor 1 [Source:Xenbase;Acc:XB-GENE-940560])

HSP 1 Score: 78.9518 bits (193), Expect = 7.154e-16
Identity = 57/175 (32.57%), Postives = 85/175 (48.57%), Query Frame = 1
Query:   94 KMKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRN-LQLIVSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGR----------FWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGN 585
            K  L ID D G DDA A+   +   ++ I+GI  V GN     V +N L+++    R +I +++G+ + I+   + A D+HG DGLG             + EY                     AV  L  +  K+P+ + + A GPLTN+ALA   D  F Q++K +FIMGGN
Sbjct:    5 KKLLLIDVDCGTDDAQAIMMAIAAPNIHILGITCVEGNTSLNNVCKNVLRVLKLCNRLDIPVFRGAGKPILGEAIHASDFHGSDGLGDVPDPNAPGLDLIQKEY---------------------AVDALKRIVSKHPEQISLIATGPLTNLALAVRTDSTFPQKLKALFIMGGN 158          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Xenopus
Match: ENSXETT00000035956.1 (pyrimidine-specific ribonucleoside hydrolase rihA [Source:NCBI gene;Acc:548390])

HSP 1 Score: 68.1662 bits (165), Expect = 2.856e-12
Identity = 72/303 (23.76%), Postives = 125/303 (41.25%), Query Frame = 1
Query:   88 LNKMKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRN-LQLIVSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENWNANELFKQILEISHGYLDAKMAKIYLYDLILAIIV---------MHPEVVLKETT------KSATIDLTGNFSRGFIIID 948
              K  L ID D G DDA A+   +    ++I+GI  V GN   + V +N L+++    R +I +++G+ + ++   + A  +HG DGLG     +  +             +  +  AV  L  +  ++P        G +T         PE     + I+ + GN+   G        EFNF  DPE   +VLN   C  +I   + +    +  E++E W  N   K+   I   Y  +     Y    + A++                + ETT       + T++L+G F+RG +++D
Sbjct:    3 CEKKLLLIDVDCGTDDAQAIMMAVAAPHVEILGITCVGGNTAVDNVCKNVLRVLRVCNRSDIPVFRGAFKPVLGEAIHASYFHGVDGLGDVPDQDAPD-----------MEQIQKEHAVDALNRIVSEHP--------GQVT---------PEL----QIIYTLLGNTTACG--------EFNFLADPEGAYIVLNEFTCLTYIATWEHACRHKLSWEWYEQW-VNRSTKKADFIKKIYAHSLQYSRYNEKEVKAVVAGPGFVSCDSYAMAAAIDETTVTDFIECAVTVELSGKFARGMMVLD 264          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. UniProt/SwissProt
Match: sp|Q652Q8|URH2_ORYSJ (Probable uridine nucleosidase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=URH2 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 9.960e-22
Identity = 93/334 (27.84%), Postives = 150/334 (44.91%), Query Frame = 1
Query:  100 KLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRN-LQLIVSSIRPEIKIYKGSSQFIIEN-PVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTP---FIKKEYFENWNANELFKQIL-EISHGYLDAKMAK-----IYLYDLILAIIVMHPEVVLKETTKSATIDL-TGNFSRGFIIIDEE-NHYLKDHPFYYKDRSKFSSVSIIKELDEQKIIDFIK 1062
            K+ ID DPGIDD+ A+        + +VG+ ++ GN  +    RN L L   + RPE+ + +GS++ +    P +AD  HG DGLG    + + +                E SA   L++   + P  + + ALGPLTNIALA   D  F  +VK I ++GG     GN+      E N   DPEA  +V         IY +  + T    F  K+  E  N+     Q L +I   Y D  +       ++L+D +    ++HPE     T K   + + T    +G   +D     +  D+P+     + +S +S+   +D  K++ + K
Sbjct:   22 KVIIDTDPGIDDSVAIMMAFEAPGVKVVGLTTIFGNCTTSHATRNALILCDRAGRPEVPVAEGSAEPLKGGKPHVADFVHGSDGLGN---TSFPDPTTTNKV---------EQSAAEFLVDKVSESPGEISVLALGPLTNIALAMKKDSSFASKVKRIVVLGGAFFAAGNATP--SAEANIHSDPEAADIVFTSGA---DIYVVGLNITTQVYFTDKDMLELRNSKGKHAQFLCDICKFYRDWHVHSYGVDALFLHDPVSFTALVHPEYF---TFKKGVVRVETQGICKGHTSMDMGLKKWNSDNPW-----TGYSPISVAWTVDVPKVLAYAK 330          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. UniProt/SwissProt
Match: sp|Q9P6J4|YHD6_SCHPO (Uncharacterized protein C1683.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1683.06c PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.389e-21
Identity = 70/206 (33.98%), Postives = 101/206 (49.03%), Query Frame = 1
Query:   97 MKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRN-LQLIVSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAV-FELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPID 708
            MK+ ID DPG DDA      +   +++++G+ +V GNV      RN LQ++  + RP+I +Y GS++ ++  P+ A   HG  G         +E               +E  AV F +  L    P T+ I  +GPLTNIALA    PE  QR K+I +M G     GN       EFN  +DP A Q+VL+    P  + P+D
Sbjct:    1 MKIIIDTDPGQDDAITALLAIASPEIELLGVTTVAGNVPVSMTTRNALQMLDLAGRPDIPVYAGSNKPLLRAPITATHVHGASG---------FEGAVLPPPSRKE----NEGHAVDFIIDTLRNNEPGTITICTIGPLTNIALALNKAPEVIQRAKQIVMMAGAFSEVGN--ITPAAEFNIYVDPHAAQMVLSS-GIPIVMMPLD 190          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. UniProt/SwissProt
Match: sp|Q27546|IUNH_CRIFA (Inosine-uridine preferring nucleoside hydrolase OS=Crithidia fasciculata OX=5656 GN=IUNH PE=1 SV=3)

HSP 1 Score: 95.9005 bits (237), Expect = 4.983e-21
Identity = 85/296 (28.72%), Postives = 135/296 (45.61%), Query Frame = 1
Query:  100 KLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRNLQLI--VSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRF-WKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKY-PKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHI---YPIDASGTPFIKKEYFE-NWNANELFKQILEISHGYLDAK--MAKIYLYDLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEEN 957
            K+ +DCDPG+DDA A+       +++++ I +V GN    KV RN QL+  ++ I   + I  G  + ++   + A   HG  G+G   + +E+               K  E  AV  +I+L   + PKT+ +   G LTNIA+A  ++P    RVKE+ +MGG     GN+ +    EFN  +DPEA  +V N       +       A  TP I +   E + N      +I++       +   MA   ++D      V+ P V+  E      I+LTG  + G  + D  N
Sbjct:    4 KIILDCDPGLDDAVAILLAHGNPEIELLAITTVVGNQTLAKVTRNAQLVADIAGIT-GVPIAAGCDKPLVRKIMTAGHIHGESGMGTVAYPAEFKN-------------KVDERHAVNLIIDLVMSHEPKTITLVPTGGLTNIAMAARLEPRIVDRVKEVVLMGGGYH-EGNATSV--AEFNIIIDPEAAHIVFNESWQVTMVGLDLTHQALATPPILQRVKEVDTNPARFMLEIMDYYTKIYQSNRYMAAAAVHDPCAVAYVIDPSVMTTERV-PVDIELTGKLTLGMTVADFRN 281          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. UniProt/SwissProt
Match: sp|Q6ZJ05|URH1_ORYSJ (Probable uridine nucleosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=URH1 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.277e-20
Identity = 87/335 (25.97%), Postives = 151/335 (45.07%), Query Frame = 1
Query:   88 LNKMKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRNLQLIVSSI-RPEIKIYKGSSQFIIEN-PVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENWNANELFKQIL-EISHGYLDAKMAK-----IYLYDLILAIIVMHPEVVLKETTKSATIDL-TGNFSRGFIIIDEE-NHYLKDHPFYYKDRSKFSSVSIIKELDEQKIIDFIK 1062
            +++ KL ID DPGIDD+  +        ++I+G+ ++ GN  ++   +N  L+      PE+ + +GS++ +    P +AD  HG DGLG  +                   K  E +A F + ++S+ +P  + I ALGPLTN+ALA   DP F  +VK+I ++GG     GN       E N   DPEA  +V         +     +   F  ++  E  N+     Q L ++   Y D          I+L+D +    ++HPE     T K   + + T     G  ++D+    +  ++P+     S +  +S+   +D   ++ F+K
Sbjct:    7 IHRDKLIIDTDPGIDDSMTILMAFRAPTVEIIGLTTIFGNTTTKNATQNALLLCERAGHPEVPVAEGSAEPLKGGEPRVADFVHGSDGLGNLF------------LPAPTSKKVDENAAEFMVNKVSQ-FPGEVSILALGPLTNVALAIKRDPSFASKVKKIVVLGGAFFAAGN--VSPAAEANIYGDPEAADIVFTSGADVDVVGINITTQVCFTDEDLLELRNSKGKHAQFLCDMCQFYRDWHAESDGFHGIFLHDPVSFTALVHPEYF---TFKKGVVRVETQGICTGHTLMDQGLKKWNSENPW-----SGYKPISVAWTVDVPNVLAFVK 318          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. UniProt/SwissProt
Match: sp|Q9SJM7|URH1_ARATH (Uridine nucleosidase 1 OS=Arabidopsis thaliana OX=3702 GN=URH1 PE=1 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 2.569e-20
Identity = 73/204 (35.78%), Postives = 101/204 (49.51%), Query Frame = 1
Query:   67 IFRNEILLNKMKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRNLQLIVS-SIRPEIKIYKGSSQFIIEN-PVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLN 672
            I   ++L    KL ID DPGIDD+ A+       +L+I+G+ +V GNV ++   RN  L+   +  P++ + +GSS+ +    P +AD  HG +GLG               +      K SE SA   L E   +YP  + I ALGPLTN+ALA   D  F  +VK+I I+GG     GN       E N   DPEA  VV  
Sbjct:   12 ISNGDVLGKHEKLIIDTDPGIDDSMAILMAFQTPELEILGLTTVFGNVSTQDATRNALLLCEIAGFPDVPVAEGSSEPLKGGIPRVADFVHGKNGLGDV-------------SLPPPSRKKSEKSAAEFLDEKVEEYPGEVTILALGPLTNLALAIKRDSSFASKVKKIVILGGAFFSLGN--VNPAAEANIYGDPEAADVVFT 200          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. TrEMBL
Match: A0A1Y1N5T1 (IU_nuc_hydro domain-containing protein OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 3.361e-40
Identity = 105/334 (31.44%), Postives = 173/334 (51.80%), Query Frame = 1
Query:  100 KLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSV---NGNVDSEKVNRN-LQLIVSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENWNANELFKQILEIS-HGYLDAKMAKI------YLYDLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDHPFYYKDRSKFSSVSIIKELDEQKIIDFIKSF 1068
            ++ ID DPG+DDA A+ + L    L++V I ++    GN   E   RN ++L+    R +I IYKG+S  ++ N V A  Y G DG+     +EY E     I         ++      L+EL  + P  L +  L PLTNIALA  ++ +F + VKE+FIMGGN RG GN       EFNF  DPEA  +VL +++CP  I P +      I      +W    L    ++++    L+ K  K+        YDL   +++++PEVV++    + T++L G F+RG +I+D               R++ S+V+I++ +D+++++  + ++
Sbjct:    5 RIVIDTDPGVDDAHAILFLLDADKLNMVKIEAIIVTKGNTTVENGCRNVIRLLKMKNRMDIPIYKGASYALLSNEVAASTYFGDDGMA---DAEYDEEPDLSI--------VNKKPGSLALLELVEQNPHELSLLCLAPLTNIALAAGLNGDFFENVKEVFIMGGNWRGQGNETEC--AEFNFHYDPEAAYMVLQKLRCPTTILPNETCMAARIDT----SWRFETLINDSIDLTFMTMLERKFFKLRDIEAWTPYDLFSVLLILYPEVVVRSAEYNVTVELHGRFTRGQMILDHL-------------RNRTSNVNIVQRIDKERVMQILLNW 308          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. TrEMBL
Match: A0A1Y1N2V7 (IU_nuc_hydro domain-containing protein OS=Photinus pyralis OX=7054 GN=PPYR_09009 PE=4 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 3.810e-40
Identity = 105/334 (31.44%), Postives = 173/334 (51.80%), Query Frame = 1
Query:  100 KLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSV---NGNVDSEKVNRN-LQLIVSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENWNANELFKQILEIS-HGYLDAKMAKI------YLYDLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDHPFYYKDRSKFSSVSIIKELDEQKIIDFIKSF 1068
            ++ ID DPG+DDA A+ + L    L++V I ++    GN   E   RN ++L+    R +I IYKG+S  ++ N V A  Y G DG+     +EY E     I         ++      L+EL  + P  L +  L PLTNIALA  ++ +F + VKE+FIMGGN RG GN       EFNF  DPEA  +VL +++CP  I P +      I      +W    L    ++++    L+ K  K+        YDL   +++++PEVV++    + T++L G F+RG +I+D               R++ S+V+I++ +D+++++  + ++
Sbjct:   11 RIVIDTDPGVDDAHAILFLLDADKLNMVKIEAIIVTKGNTTVENGCRNVIRLLKMKNRMDIPIYKGASYALLSNEVAASTYFGDDGMA---DAEYDEEPDLSI--------VNKKPGSLALLELVEQNPHELSLLCLAPLTNIALAAGLNGDFFENVKEVFIMGGNWRGQGNETEC--AEFNFHYDPEAAYMVLQKLRCPTTILPNETCMAARIDT----SWRFETLINDSIDLTFMTMLERKFFKLRDIEAWTPYDLFSVLLILYPEVVVRSAEYNVTVELHGRFTRGQMILDHL-------------RNRTSNVNIVQRIDKERVMQILLNW 314          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. TrEMBL
Match: K1R2P0 (Inosine-uridine preferring nucleoside hydrolase OS=Crassostrea gigas OX=29159 GN=CGI_10015904 PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 3.366e-38
Identity = 104/342 (30.41%), Postives = 159/342 (46.49%), Query Frame = 1
Query:   88 LNKMKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRN-LQLIVSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCP----------KHIYPIDA------SGTP------FIKKEYFENWNANELFKQILEISHGYLDAKMAKIYLYDLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDHPFYYKDRSKFSSVSIIKELDEQK 1044
            + K K+ IDCD G+DDA A+   L+R D D++GI  VNGNVD E V RN L+++       I +++G  + II +   A  YHG DG+G        +                E  AV  LI L++K+   + + A+ PLTN+A+A  +DP FG R+K + +MGGN  G GN    + +EFNF  DPE+  +VL+ + CP           ++YP +       + TP      FI K   E   ++E          GY           D     + +   +VL +    A+++L G  +RG ++ D  N              K  +V+I+ + D QK
Sbjct:    1 MTKQKIIIDCDTGVDDAQAIMMALSRPDTDVIGITCVNGNVDIENVCRNTLRVLKICDALHIPVFRGCGRPIIHHEENASFYHGVDGMGDHPHPPEVD-----------LSCIQEEHAVNALIRLTKKFNGEVKLVAMAPLTNLAVALRMDPGFGARLKSLVVMGGNMHGKGNRSASIASEFNFGTDPESAYIVLHEVTCPIVIVSWELCVDYLYPWEMVHKCINTNTPKANFLQFITKASIEVQKSSE--------QPGYRSC--------DAFAMAVAIDSSIVLDKVDIYASVELNGTLTRGMLVPDWRNKL-----------QKSLNVTIVTKTDTQK 304          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. TrEMBL
Match: A0A3M6TB49 (IU_nuc_hydro domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00008368 PE=4 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 5.521e-38
Identity = 97/295 (32.88%), Postives = 154/295 (52.20%), Query Frame = 1
Query:   94 KMKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRN-LQLIVSSIRPEIKIYKGSSQFII----ENPVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENW-----NANELFKQILEISHGYLDAKMAKIYLYDLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIID 948
            KMK+ IDCD GIDDA A+   L++ ++D++ I    GNV+ ++V +N L+++ +  R +I +YKG+ + ++    E P+    YHG DGLG                +  +     +  A   L++L  + P  +VI ALGPLTNIALA   D EF ++VKE+FI+GG   G GN   +V  EFNF  DPEA  ++LN+ +CP  +   +      +  E+FE +        E  ++I      Y +    +    D       + P+ V +ET+  AT++L    +RG ++ID
Sbjct:    2 KMKIIIDCDAGIDDAQAIMIALSQ-EVDVLAITCTCGNVNVDQVTKNVLKVLEACERTDIPVYKGAYRSLLGIAYEQPL----YHGFDGLGD-----------ATDIKDPDTSLLQQTHAAQALVQLVNENPGEIVIIALGPLTNIALASNFDAEFTKKVKEVFILGGCIHGKGNH--WVSAEFNFGADPEAAYILLNQFKCPISLVSWETCLEHPLDWEFFEQYVGAGTKRAEFMRKISTKIKEYEEKMNGEFISCDPFALCAALQPKFVQEETSVHATVELKEGLTRGQMVID 278          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. TrEMBL
Match: A0A3B3SII1 (Si:dkey-4e7.3 OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 5.584e-38
Identity = 91/317 (28.71%), Postives = 159/317 (50.16%), Query Frame = 1
Query:   97 MKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRN-LQLIVSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENW-----NANELFKQILEISHGYLDAKM--AKIYLYDLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDHPFYY---KDRSKFSSV 1014
            +K+ +D D G+DDA A+   L   ++ ++GI  VNGN   E V RN L+++ +  RPEI +++G+S+ I+ N ++A+ +HG DGLG     +                   +  AV  +I ++ ++   + + A  PLTN+ALA  +DP F +++K ++IMGG +   GN  T +  EFNF+ DPEA  +VLN   CP +I   + +    +  ++++ W           KQI + S      ++  A     D       +    V +      T++L G ++RG ++ID  ++  K+H  +     D  KF ++
Sbjct:   11 VKVLVDVDCGVDDASAIMMALADPEVQLLGITCVNGNTSVENVCRNTLRVLKACRRPEIPVFRGASRPILGNVLMAEAFHGKDGLGDVPDPD-----------APGLELIQKEGAVEAMIRIANEHAGEVSLVATAPLTNLALAVRLDPTFPKKLKGLYIMGGTTEARGN--TTMCAEFNFAADPEAAYIVLNDFPCPTYIASWEFTCMNILSWDFYDQWLDQDSEKARFMKQIFQYSRDVSQRQLGEAGFAFCDAFAMAAAIDKSFVTECEEVPVTVELAGTYTRGMMVIDRMSYLKKEHKAFILQKVDMEKFKTL 314          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Cavefish
Match: si:ch211-201h21.5 (inosine-uridine preferring nucleoside hydrolase-like [Source:NCBI gene;Acc:103040792])

HSP 1 Score: 126.331 bits (316), Expect = 5.979e-33
Identity = 95/332 (28.61%), Postives = 148/332 (44.58%), Query Frame = 1
Query:  103 LYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRN-LQLIVSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRF--------WKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENWNANE-----LFKQILEISHGYLDAKMAKIYL-----------YDLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDHP---FYYKDRSKFSSV 1014
            + ID D GIDDA A+   L    + ++G+    GN D E V +N L+++    R +I +++GS+  ++       D+ G DGLG          WK +  E                   AV  LI L  ++   + + ALGPLTN+ALA  +DP F Q++K ++IMGGN  G GN       EFNF MDPE+  +VL   QCP  I   + +    +  E+F+     +       K++   S  +  ++ A + +           YD       +   VV  +   +  ++L G   RGF+ +D  N   K H        D S+F S+
Sbjct:    6 MIIDTDCGIDDAQAIMLALAAPSVRVLGVTCCFGNTDVENVCQNVLRVLTVCQRTQIPVFRGSAGPLVGAVKPFQDHFGTDGLGDILEHRDLDIWKDQVQEE-----------------HAVNALIRLVNEHSGQVSLVALGPLTNLALAVRLDPTFPQKLKNLYIMGGNMEGKGN--VTPSAEFNFIMDPESAYIVLEEYQCPTSIATWEFTCRNKLTWEFFDELVGQDSAPARFMKRV--TSRCWAFSRDAGVGMKEAFFGPGFVPYDAYAMAACVDGSVVTGQQEYAVRVELLGELGRGFMALDPTNKLKKSHRVSVMTSCDLSRFKSM 316          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Cavefish
Match: si:dkey-4e7.3 (si:dkey-4e7.3 [Source:ZFIN;Acc:ZDB-GENE-070912-542])

HSP 1 Score: 120.553 bits (301), Expect = 7.828e-31
Identity = 90/310 (29.03%), Postives = 148/310 (47.74%), Query Frame = 1
Query:  100 KLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRNLQLIV---SSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGN-SRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENWNANE---------LFKQILEISHG-----YLDAKMAKIYLYDLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDH 975
            KL +D D G+DDA A+   L   D++I+G+  V+GN   E V +N+  ++     +  +I +YKG S+ ++   + A  +HG DGLG     +                   +  AV  +I +  + P  + + A  PLTN+A+A  +DP   Q++K ++IMGGN  RG     T +  EFNF+ DPEA  +VLN   CP +I   + +    +  E+ ++W A +         +FK  ++  +       L A    I      +A  +     +L+   K+ T++LTG  SRG +I+D      K H
Sbjct:    2 KLLVDVDCGVDDAQAIMMALAVPDVEILGVTCVHGNTCVENVCKNVLRVLKFCGRLELQIPVYKGVSKPLLGFVLDAGHFHGEDGLGNAPDPD-----------APGLDLVQKEGAVSAIIRIINENPGEVSLVATAPLTNLAMAVKLDPTIPQKLKGLYIMGGNVDRGN----TTICGEFNFAADPEAAYIVLNEYLCPTYIASWEFTCHSKLPWEFCDDWLAQDTDKARFMKKIFKHSMDSCYSERIEKELVAGQGFISCDSYAMAAAI-DDAFILESDYKAVTVELTGTHSRGMMIVDHLEILNKTH 295          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Yeast
Match: URH1 (Uridine nucleosidase (uridine-cytidine N-ribohydrolase); cleaves N-glycosidic bonds in nucleosides; involved in the pyrimidine salvage and nicotinamide riboside salvage pathways [Source:SGD;Acc:S000002808])

HSP 1 Score: 71.2478 bits (173), Expect = 2.536e-14
Identity = 55/200 (27.50%), Postives = 89/200 (44.50%), Query Frame = 1
Query:   82 ILLNKMKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRNLQLIVSSI--RPEIKIYKGSSQFIIENPVIADDYHGPDGL--GRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVL 669
            + ++K+ +++DCDPG DDA A+         +++GI +  GN   E  + N + +++++     I +YKG+ +     P  A D HG  GL          +EA   K          + I A+ E I  +      +   + G LT +A      P   + VK I IMGG   G GN    +  EFN  +DP+A   + 
Sbjct:    1 MTVSKIPIWLDCDPGHDDAIAILLGCFHPAFNLLGISTCFGNAPPENTDYNARSLLTAMGKAQAIPVYKGAQRPWKREPHYAPDIHGISGLDGTSLLPKPTFEARTDK----------TYIEAIEEAILANN---GEISFVSTGALTTLATVFRCKPYLKKSVKYISIMGGGLHGLGNCNPNLSAEFNVWIDPDAANYIF 187          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Nematostella
Match: EDO42061 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2K9])

HSP 1 Score: 142.124 bits (357), Expect = 2.305e-39
Identity = 99/335 (29.55%), Postives = 166/335 (49.55%), Query Frame = 1
Query:   94 KMKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRN-LQLIVSSIRPEIKIYKGSSQ-FIIENPVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENW-----NANELFKQILEISHG-YLDAKMAKIYLY---DLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDHPFYYKDRSKFSSVSIIKELDEQKIIDFIKS 1065
            K KL IDCD G+DDAFA+   L+R+D +++ I  V GN   ++V  N ++ +    R +I ++KG+ +  I ++   A  +HG DGLG                +  +     +  AV  LI L+      + + ALGPLTN+ALA  +DP+F +R+++  IMGGN    GN       EFNF  DPEA  V LN  +CP  +   +     + + E+FE       N ++  K I ++S   Y   K    Y Y   DL+   + + P++V ++    AT++L G+++ G + +D           +    S+  ++ +++E+D  K  + + S
Sbjct:    3 KRKLIIDCDAGVDDAFAIMLALSREDTEVIAITCVGGNTSLDQVCINVMKTLECCQRTDIPVFKGAGKPLIAKHEPSASHFHGYDGLG-----------DSSNLKTPDMSLLQKEHAVDALIRLAND---DVTLVALGPLTNLALASRLDPDFSKRLRKTVIMGGNCEAKGNDGKPC-AEFNFHSDPEAAFVTLNEFECPLSLVTWEICLKHYFEWEFFEKLTSQASNKSKFLKSISKLSADFYKQRKDGFGYHYVCCDLLAMGVAVQPDIVTRQALVHATVELNGHYTTGQMAVD-----------WLGALSRPPTMKLVQEVDMAKYSEMVMS 311          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Nematostella
Match: EDO33492 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS26])

HSP 1 Score: 114.005 bits (284), Expect = 8.415e-29
Identity = 85/291 (29.21%), Postives = 138/291 (47.42%), Query Frame = 1
Query:  109 IDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEK-VNRNLQLIVSSIRPEIKIYKGSSQFIIENP--VIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYP------KTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENWNANELFKQ--ILEISHGYLDAKMAKIYLYDLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIID 948
            IDCD G+DDA A+   L++  ++I+ I +V GN ++E+  N  L+++       I +YKG ++ +      V    YHG DGLG             +     ++    +  AV  +I+L +  P        + I AL PLTN+A+A  +DP F   VK + +MGGN    GN L  V  EFNF  DPEA  +VLN  +C   +   + +    +   +F+ + A    K   I  I+    +     I      +A +V  P+++ K      T++L G  +RG +++D
Sbjct:    4 IDCDVGVDDAQAIMIALSQDSIEILAITTVTGNQNTEQATNNTLKVLDYCGERNIPVYKGITEGLTGRCDFVELSAYHGQDGLG-----------DAQGLREPDRTPLKDKHAVLAMIDLVKANPGEASIWNKISILALAPLTNLAIAGRLDPTFLTNVKAVHMMGGNKHAVGNHL--VTAEFNFGADPEAAHIVLNEFKCNMSLITWEFTLENPMTWAWFDEYAAVNTTKGRFIYNITRHTFENGGPYITCDPFTVA-VVARPDIITKSKMVYLTVELDGRITRGQVVVD 280          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Nematostella
Match: EDO26622 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBI4])

HSP 1 Score: 70.8626 bits (172), Expect = 3.887e-15
Identity = 34/66 (51.52%), Postives = 41/66 (62.12%), Query Frame = 1
Query:  487 IAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQC 684
            I AL PLTN+A+A  +DP F   VK + +MGGN    GN L  V  EFNF  DPEA  +VLN  +C
Sbjct:    3 ILALAPLTNLAIAGRLDPTFLTNVKAVHMMGGNKHAVGNHL--VTAEFNFGADPEAAHIVLNEFKC 66          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Medaka
Match: ENSORLT00000032728.1 (inosine-uridine preferring nucleoside hydrolase [Source:NCBI gene;Acc:101157039])

HSP 1 Score: 129.798 bits (325), Expect = 2.399e-34
Identity = 96/340 (28.24%), Postives = 157/340 (46.18%), Query Frame = 1
Query:   94 KMKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRN-LQLIVSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENW--NANELFKQILEISHGYLDAKMAKIYLY-------------DLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDHPFYYKDRSKFSSVSIIKELDEQKIIDFIKS 1065
            K KL ID D G+DDA ++   L   D++++GI   +GN   E V +N L+++    R +I +++G  + ++     A DYHG DGLG                   +     + +AV  +I+++++    + + A  PLTN+A+A  +DP F + +K ++IMGGN+   GN  T V  EFNF  DPEA  +VL+R  CP  I   +      +   + + W     E  K + EIS   L  K A+   Y             DL      +    + +    + T++L G  +RG +++D           Y +   K    SIIK +D +K+   + S
Sbjct:    2 KRKLLIDVDTGVDDAQSIMLALASPDVEVLGITCCHGNTKLENVLKNTLRVLKVCNRLDIPVFRGCEKPLLAKKRSAADYHGADGLGEV-----------PDPNAPSLELLQKKNAVNAMIKIAKENSGEVTLVATAPLTNLAVAVELDPSFPKHLKALYIMGGNTESRGN--TTVCGEFNFVADPEAAHIVLDRFTCPISIACWEFCCMRSLPWSFVDEWFSRKTEKAKFLKEIS--ALSMKKARSPEYEKEITAGKGFNPCDLFAMAAAVDDTFITESEQVAVTVELMGAHTRGMMVLD-----------YMELLEKKHKASIIKNVDSEKLKKMLMS 315          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Medaka
Match: si:dkey-4e7.3 (inosine-uridine preferring nucleoside hydrolase [Source:NCBI gene;Acc:101168254])

HSP 1 Score: 125.946 bits (315), Expect = 8.431e-33
Identity = 93/347 (26.80%), Postives = 162/347 (46.69%), Query Frame = 1
Query:  100 KLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRN-LQLIVSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENWNANE---------LFKQILEISHG-----YLDAKMAKIYLYDLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDHPFYYKDRSKFSSVSIIKELDEQKIIDFIKSF*QFLEAVFK 1095
            KL +D D G+DDA A+   L   ++ ++GI  V+GN   E V +N L+++ +  + EI ++KG+ + ++ + + A  +HG DGLG    S                    E  AV  +I +  +    + + A GPLTN+ALA  +DP    +++ ++IMGGN+   GN  T V  EFNF+ DPEA  +VL   QCP ++   + +    +  ++ E W A +         +F+  ++ S          A    I      +A  V     +++      +++LTG+ +RG +++D+     K H  +           I+K++D +K       F Q + A  K
Sbjct:    4 KLLVDVDCGVDDAQAIMLALAAPNVQLLGITCVHGNTSVENVCKNSLRVLQACNKLEIPVFKGADRPLLGDSIDAGHFHGEDGLGDAPDSN-----------APTLDLLQEQEAVSAMIRIVNENAGEVSLVATGPLTNLALAVRLDPSLPSKLRGLYIMGGNTESRGN--TTVCGEFNFTADPEAAYIVLKDYQCPTYLACWEFTCYNKLSWDFCEAWLAQDSHKARFMETIFRHSIQASKSERFEKECVAGTGFISCDSYAMAAAV-DDSFIIESDCYPVSVELTGSHTRGMMVVDKLGFLKKSHTAF-----------IMKKVDMEK-------FKQMMMAALK 318          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Medaka
Match: si:dkey-4e7.3 (inosine-uridine preferring nucleoside hydrolase [Source:NCBI gene;Acc:101168254])

HSP 1 Score: 125.946 bits (315), Expect = 1.935e-32
Identity = 93/347 (26.80%), Postives = 162/347 (46.69%), Query Frame = 1
Query:  100 KLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRN-LQLIVSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENWNANE---------LFKQILEISHG-----YLDAKMAKIYLYDLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDHPFYYKDRSKFSSVSIIKELDEQKIIDFIKSF*QFLEAVFK 1095
            KL +D D G+DDA A+   L   ++ ++GI  V+GN   E V +N L+++ +  + EI ++KG+ + ++ + + A  +HG DGLG    S                    E  AV  +I +  +    + + A GPLTN+ALA  +DP    +++ ++IMGGN+   GN  T V  EFNF+ DPEA  +VL   QCP ++   + +    +  ++ E W A +         +F+  ++ S          A    I      +A  V     +++      +++LTG+ +RG +++D+     K H  +           I+K++D +K       F Q + A  K
Sbjct:   49 KLLVDVDCGVDDAQAIMLALAAPNVQLLGITCVHGNTSVENVCKNSLRVLQACNKLEIPVFKGADRPLLGDSIDAGHFHGEDGLGDAPDSN-----------APTLDLLQEQEAVSAMIRIVNENAGEVSLVATGPLTNLALAVRLDPSLPSKLRGLYIMGGNTESRGN--TTVCGEFNFTADPEAAYIVLKDYQCPTYLACWEFTCYNKLSWDFCEAWLAQDSHKARFMETIFRHSIQASKSERFEKECVAGTGFISCDSYAMAAAV-DDSFIIESDCYPVSVELTGSHTRGMMVVDKLGFLKKSHTAF-----------IMKKVDMEK-------FKQMMMAALK 363          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Medaka
Match: si:dkey-4e7.3 (inosine-uridine preferring nucleoside hydrolase-like [Source:NCBI gene;Acc:101168504])

HSP 1 Score: 124.02 bits (310), Expect = 4.305e-32
Identity = 90/349 (25.79%), Postives = 160/349 (45.85%), Query Frame = 1
Query:  100 KLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRN-LQLIVSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENWNANE---------LFKQILEISHG-------YLDAKMAKIYLYDLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDHPFYYKDRSKFSSVSIIKELDEQKIIDFIKSF*QFLEAVFK 1095
            KL +D D G+DDA A+   L   ++ ++GI  V+GN   E V +N L+++ +  + EI ++KG+ + ++ + + A  +HG DG G    S                    E  AV  +I +  +    + + A GPLTN+ALA  +DP    +++ ++IMGGN+   GN  T V  EFNF  DPEA  +VL   QCP ++   + +    +  ++ E W A +         +F+  ++ S         +    +     Y +  A+       +++      +++LTG+ +RG +++D      K H  +           I+K++D +K       F Q + A  K
Sbjct:    4 KLLVDVDCGVDDAQAIMLALAAPNVQLLGITCVHGNTSVENVCKNSLRVLQACNKLEIPVFKGADRPLLGDSIDAGHFHGEDGFGDAPDSN-----------APTLDLLQEQEAVSAMIRIVNENAGEVSLVATGPLTNLALAVRLDPSLPSKLRGLYIMGGNTESRGN--TRVCGEFNFIADPEAAYIVLKDYQCPTYLACWEFTCYNKLSWDFCEAWLAQDSHKARFMETIFRHSIQASKSKRFEKVFFAGTGLTSCDSYAMAAAV---DDSFIIESDCYPVSVELTGSHTRGMMVVDTLGFLKKSHTAF-----------IMKKVDMEK-------FKQMMMAALK 318          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Planmine SMEST
Match: SMESG000051886.1 (SMESG000051886.1)

HSP 1 Score: 379.022 bits (972), Expect = 2.177e-132
Identity = 201/214 (93.93%), Postives = 204/214 (95.33%), Query Frame = 1
Query:   97 MKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRNLQLIVSSIRPEIKIYKGSSQFIIENPVIA-DDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHIYPIDASGTPFIKK 735
            MKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRNLQLIVSSIRPEIKIYKGSSQFIIENPVIA + YHGPDGLGRFWKSEYYEANKKKINEIINKCKFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSR  GNS TYV TEFNFSMDPE+VQVVLNRMQCPK IYPIDASG P + K
Sbjct:    1 MKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRNLQLIVSSIRPEIKIYKGSSQFIIENPVIAAEHYHGPDGLGRFWKSEYYEANKKKINEIINKCKFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRETGNSNTYVETEFNFSMDPESVQVVLNRMQCPKRIYPIDASGNPLLMK 214          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Planmine SMEST
Match: SMESG000051820.1 (SMESG000051820.1)

HSP 1 Score: 307.375 bits (786), Expect = 5.056e-105
Identity = 166/166 (100.00%), Postives = 166/166 (100.00%), Query Frame = 1
Query:   97 MKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRNLQLIVSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRG 594
            MKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRNLQLIVSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRFWKSEYYEANKKKINEIINKCKFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRG
Sbjct:    1 MKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRNLQLIVSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRFWKSEYYEANKKKINEIINKCKFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRG 166          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Planmine SMEST
Match: SMESG000051775.1 (SMESG000051775.1)

HSP 1 Score: 297.36 bits (760), Expect = 4.657e-101
Identity = 163/167 (97.60%), Postives = 164/167 (98.20%), Query Frame = 1
Query:   97 MKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRNLQLIVSSIRPEIKIYKGSSQFIIENPVI-ADDYHGPDGLGRFWKSEYYEAXXXXXXXXXXXXXFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRG 594
            MKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRNLQLIVSSIRPEIKIYKGSSQFIIENPVI A+ YHGPDGLGRFWKSEYYEANKKKINEIINKCKFSEISAVFELIELSRKYPKTLVI ALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRG
Sbjct:    1 MKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRNLQLIVSSIRPEIKIYKGSSQFIIENPVIAAEHYHGPDGLGRFWKSEYYEANKKKINEIINKCKFSEISAVFELIELSRKYPKTLVIVALGPLTNIALAQLIDPEFGQRVKEIFIMGGNSRG 167          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Planmine SMEST
Match: SMESG000051808.1 (SMESG000051808.1)

HSP 1 Score: 288.115 bits (736), Expect = 4.929e-98
Identity = 139/143 (97.20%), Postives = 142/143 (99.30%), Query Frame = 1
Query:  640 MDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENWNANELFKQILEISHGYLDAKMAKIYLYDLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDHPFYYKDRSKFSSVSIIKELDEQKIIDFIKSF 1068
            MDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENWNANELFKQILEISHGYLDAKMAKIYL+DLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKD PFYYKDRSKFSSVSII+ELD+QKIIDFIKSF
Sbjct:    1 MDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENWNANELFKQILEISHGYLDAKMAKIYLFDLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDQPFYYKDRSKFSSVSIIEELDKQKIIDFIKSF 143          
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Planmine SMEST
Match: SMESG000051742.1 (SMESG000051742.1)

HSP 1 Score: 251.136 bits (640), Expect = 2.122e-83
Identity = 119/143 (83.22%), Postives = 129/143 (90.21%), Query Frame = 1
Query:  640 MDPEAVQVVLNRMQCPKHIYPIDASGTPFIKKEYFENWNANELFKQILEISHGYLDAKMAKIYLYDLILAIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDHPFYYKDRSKFSSVSIIKELDEQKIIDFIKSF 1068
            MDPEAVQVVLNRMQCPK IYP DASGTP IKKEYF+ WNANELFKQI  ISHGY+ AK   I+ YDL+LAIIVMHPEVVLKET KSATIDLTGNFSRGF+IIDE+NHYLKD+P Y+KDRSKFS VS+I+ELDEQKIIDFIKSF
Sbjct:    1 MDPEAVQVVLNRMQCPKRIYPTDASGTPLIKKEYFDKWNANELFKQIFLISHGYISAKFPNIHFYDLVLAIIVMHPEVVLKETKKSATIDLTGNFSRGFLIIDEQNHYLKDNPLYFKDRSKFSPVSLIEELDEQKIIDFIKSF 143          
The following BLAST results are available for this feature:
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
F13H8.31.339e-2328.01pep chromosome:WBcel235:II:6264050:6265496:1 gene:... [more]
F13H8.31.339e-2328.01pep chromosome:WBcel235:II:6264050:6265502:1 gene:... [more]
Y43F8C.133.978e-2031.92pep chromosome:WBcel235:V:19693896:19697398:-1 gen... [more]
back to top
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG121771.902e-2728.97gene:FBgn0030510 transcript:FBtr0340399[more]
CG121771.902e-2728.97gene:FBgn0030510 transcript:FBtr0346119[more]
CG121771.902e-2728.97gene:FBgn0030510 transcript:FBtr0073846[more]
CG54181.278e-1927.11gene:FBgn0032436 transcript:FBtr0080382[more]
CG111581.430e-1926.54gene:FBgn0030511 transcript:FBtr0073812[more]
back to top
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:dkey-4e7.38.488e-3629.64si:dkey-4e7.3 [Source:ZFIN;Acc:ZDB-GENE-070912-542... [more]
si:ch211-201h21.53.279e-3128.27si:ch211-201h21.5 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
si:ch211-201h21.53.279e-3128.27si:ch211-201h21.5 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
si:dkey-4e7.32.000e-3033.33si:dkey-4e7.3 [Source:ZFIN;Acc:ZDB-GENE-070912-542... [more]
back to top
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000048559.11.142e-3427.96novel protein containing an Inosine-uridine prefer... [more]
ENSXETT00000022763.11.508e-2926.90pyrimidine-specific ribonucleoside hydrolase rihA ... [more]
elof11.903e-2729.58ELF1 homolog, elongation factor 1 [Source:Xenbase;... [more]
elof17.154e-1632.57ELF1 homolog, elongation factor 1 [Source:Xenbase;... [more]
ENSXETT00000035956.12.856e-1223.76pyrimidine-specific ribonucleoside hydrolase rihA ... [more]
back to top
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Non-specific ribonucleoside hydrolase RihC vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q652Q8|URH2_ORYSJ9.960e-2227.84Probable uridine nucleosidase 2 OS=Oryza sativa su... [more]
sp|Q9P6J4|YHD6_SCHPO1.389e-2133.98Uncharacterized protein C1683.06c OS=Schizosacchar... [more]
sp|Q27546|IUNH_CRIFA4.983e-2128.72Inosine-uridine preferring nucleoside hydrolase OS... [more]
sp|Q6ZJ05|URH1_ORYSJ2.277e-2025.97Probable uridine nucleosidase 1 OS=Oryza sativa su... [more]
sp|Q9SJM7|URH1_ARATH2.569e-2035.78Uridine nucleosidase 1 OS=Arabidopsis thaliana OX=... [more]
back to top
BLAST of Non-specific ribonucleoside hydrolase RihC vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Y1N5T13.361e-4031.44IU_nuc_hydro domain-containing protein OS=Photinus... [more]
A0A1Y1N2V73.810e-4031.44IU_nuc_hydro domain-containing protein OS=Photinus... [more]
K1R2P03.366e-3830.41Inosine-uridine preferring nucleoside hydrolase OS... [more]
A0A3M6TB495.521e-3832.88IU_nuc_hydro domain-containing protein OS=Pocillop... [more]
A0A3B3SII15.584e-3828.71Si:dkey-4e7.3 OS=Paramormyrops kingsleyae OX=16769... [more]
back to top
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-201h21.55.979e-3328.61inosine-uridine preferring nucleoside hydrolase-li... [more]
si:dkey-4e7.37.828e-3129.03si:dkey-4e7.3 [Source:ZFIN;Acc:ZDB-GENE-070912-542... [more]
back to top
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
URH12.536e-1427.50Uridine nucleosidase (uridine-cytidine N-ribohydro... [more]
back to top
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO420612.305e-3929.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334928.415e-2929.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO266223.887e-1551.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000032728.12.399e-3428.24inosine-uridine preferring nucleoside hydrolase [S... [more]
si:dkey-4e7.38.431e-3326.80inosine-uridine preferring nucleoside hydrolase [S... [more]
si:dkey-4e7.31.935e-3226.80inosine-uridine preferring nucleoside hydrolase [S... [more]
si:dkey-4e7.34.305e-3225.79inosine-uridine preferring nucleoside hydrolase-li... [more]
back to top
BLAST of Non-specific ribonucleoside hydrolase RihC vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051886.12.177e-13293.93SMESG000051886.1[more]
SMESG000051820.15.056e-105100.00SMESG000051820.1[more]
SMESG000051775.14.657e-10197.60SMESG000051775.1[more]
SMESG000051808.14.929e-9897.20SMESG000051808.1[more]
SMESG000051742.12.122e-8383.22SMESG000051742.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004055 ID=SMED30004055|Name=Non-specific ribonucleoside hydrolase RihC|organism=Schmidtea mediterranea sexual|type=transcript|length=1150bp
CTTCACGACTATCGCATTCATTAATTTGATTTATTTTTCATTACTTTATT
TAGTTTTAAATTTAAAATCTTCCGAAACGAAATTTTGCTCAATAAAATGA
AATTATACATTGACTGTGATCCTGGAATTGATGATGCGTTCGCATTGGGT
TACTTTTTAACTCGAAAAGATTTAGACATTGTTGGAATTGGATCAGTCAA
TGGAAATGTGGATTCAGAAAAAGTGAATAGAAATTTACAACTAATCGTGT
CATCTATTAGACCAGAAATTAAAATATATAAAGGATCGTCTCAATTTATA
ATTGAAAATCCCGTTATTGCTGACGATTATCATGGGCCAGATGGGCTTGG
CCGTTTCTGGAAATCTGAATATTATGAAGCCAACAAAAAGAAAATCAACG
AAATAATAAACAAATGTAAATTCAGTGAAATTTCTGCGGTTTTTGAGTTG
ATTGAACTGTCGAGAAAATATCCTAAAACTCTAGTGATTGCTGCACTGGG
ACCGCTGACAAATATTGCGCTCGCCCAGCTCATTGATCCAGAGTTCGGAC
AACGAGTTAAGGAGATTTTTATCATGGGAGGCAATTCGAGAGGACCTGGC
AACTCACTTACTTATGTAAGAACCGAATTCAATTTCAGCATGGATCCGGA
AGCAGTTCAAGTTGTTTTAAACAGAATGCAGTGTCCGAAGCACATTTACC
CAATCGACGCTTCTGGTACCCCCTTTATAAAAAAAGAATACTTTGAAAAT
TGGAATGCAAATGAGTTATTCAAACAAATATTAGAAATTTCCCATGGCTA
TCTCGATGCAAAAATGGCAAAAATTTATTTATATGATTTAATTCTAGCGA
TTATTGTTATGCACCCTGAAGTGGTATTGAAGGAGACCACTAAAAGTGCA
ACAATTGATCTTACTGGGAACTTTAGTCGAGGATTCATTATAATTGACGA
GGAGAATCATTATCTGAAAGACCACCCCTTCTACTACAAGGACCGTTCCA
AGTTCTCGTCTGTTTCTATAATTAAGGAACTGGATGAACAAAAAATTATT
GATTTCATCAAATCTTTTTAACAATTTTTAGAAGCAGTTTTTAAGATTCT
TTAATATAATTTTGTTTTTTAATAATAAACTTTAGGACTTTTAAAAAAAA
back to top

protein sequence of SMED30004055-orf-1

>SMED30004055-orf-1 ID=SMED30004055-orf-1|Name=SMED30004055-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=325bp
MKLYIDCDPGIDDAFALGYFLTRKDLDIVGIGSVNGNVDSEKVNRNLQLI
VSSIRPEIKIYKGSSQFIIENPVIADDYHGPDGLGRFWKSEYYEANKKKI
NEIINKCKFSEISAVFELIELSRKYPKTLVIAALGPLTNIALAQLIDPEF
GQRVKEIFIMGGNSRGPGNSLTYVRTEFNFSMDPEAVQVVLNRMQCPKHI
YPIDASGTPFIKKEYFENWNANELFKQILEISHGYLDAKMAKIYLYDLIL
AIIVMHPEVVLKETTKSATIDLTGNFSRGFIIIDEENHYLKDHPFYYKDR
SKFSSVSIIKELDEQKIIDFIKSF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006144purine nucleobase metabolic process
GO:0006206pyrimidine nucleobase metabolic process
GO:0008152metabolic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis
Vocabulary: INTERPRO
TermDefinition
IPR036452Ribo_hydro-like
IPR001910Inosine/uridine_hydrolase_dom
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0016798hydrolase activity, acting on glycosyl bonds
GO:0016799hydrolase activity, hydrolyzing N-glycosyl compounds
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001910Inosine/uridine-preferring nucleoside hydrolase domainPFAMPF01156IU_nuc_hydrocoord: 2..318
e-value: 3.5E-57
score: 194.3
IPR036452Ribonucleoside hydrolase-likeGENE3DG3DSA:3.90.245.10coord: 1..324
e-value: 5.1E-68
score: 231.7
IPR036452Ribonucleoside hydrolase-likeSUPERFAMILYSSF53590Nucleoside hydrolasecoord: 2..287
NoneNo IPR availablePANTHERPTHR46190FAMILY NOT NAMEDcoord: 2..321