Forkhead box protein

Overview
NameForkhead box protein
Smed IDSMED30004053
Length (bp)2651
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Forkhead box protein (SMED30004053) t-SNE clustered cells

Violin plots show distribution of expression levels for Forkhead box protein (SMED30004053) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Forkhead box protein (SMED30004053) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Forkhead box protein (SMED30004053) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004053

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30004053h1SMcG0008886 BK013032smed_ncbi_20240424PMID:33536473
Pascual-Carreras et al., 2021
whole organism asexual adult single-cell RNA-sequencing evidence
central nervous systemSMED30004053h1SMcG0008886 BK013032smed_ncbi_20240424PMID:33536473
Pascual-Carreras et al., 2021
whole organism asexual adult colorimetric in situ hybridization evidence
secretory cellSMED30004053h1SMcG0008886 BK013032smed_ncbi_20240424PMID:33536473
Pascual-Carreras et al., 2021
whole organism asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30004053h1SMcG0008886 BK013032smed_ncbi_20240424PMID:33536473
Pascual-Carreras et al., 2021
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004053h1SMcG0008886 BK013032smed_ncbi_20240424PMID:33536473
Pascual-Carreras et al., 2021
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004053h1SMcG0008886 dd_Smed_v4_5767_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Forkhead box protein vs. Ensembl Human
Match: FOXK2 (forkhead box K2 [Source:HGNC Symbol;Acc:HGNC:6036])

HSP 1 Score: 173.326 bits (438), Expect = 3.090e-49
Identity = 76/103 (73.79%), Postives = 89/103 (86.41%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC 1455
            D  KPPYSYAQLIVQA++ + D+QLTLNGIY +I+K+YPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D A ESKLI QAFRKRR R   C
Sbjct:   66 DDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKRRPRGVPC 168          
BLAST of Forkhead box protein vs. Ensembl Human
Match: FOXK2 (forkhead box K2 [Source:HGNC Symbol;Acc:HGNC:6036])

HSP 1 Score: 176.407 bits (446), Expect = 3.093e-49
Identity = 79/119 (66.39%), Postives = 96/119 (80.67%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC-----GSICSENIPSA 1488
            D  KPPYSYAQLIVQA++ + D+QLTLNGIY +I+K+YPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D A ESKLI QAFRKRR R   C     G + S + P++
Sbjct:  135 DDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKRRPRGVPCFRTPLGPLSSRSAPAS 253          
BLAST of Forkhead box protein vs. Ensembl Human
Match: FOXK1 (forkhead box K1 [Source:HGNC Symbol;Acc:HGNC:23480])

HSP 1 Score: 187.578 bits (475), Expect = 4.362e-49
Identity = 84/133 (63.16%), Postives = 105/133 (78.95%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC-----GSICSENIPSASRVFSLSSGRAGSL 1530
            D  KPP+SYAQLIVQA+SS++DRQLTL+GIY +I+KHYPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D A E+KL+ QAFRKRR R  +C     G + S + P++     L S R+G L
Sbjct:  302 DESKPPFSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPASPTHPGLMSPRSGGL 434          

HSP 2 Score: 98.2117 bits (243), Expect = 2.448e-20
Identity = 38/105 (36.19%), Postives = 65/105 (61.90%), Query Frame = 1
Query:  190 GNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLVGRKSGKCNSM 504
            G E  + M+   +TIGRNS+ G+VD+ +G  +F+SR+HL++ +      ++CLGKNG+F+D  F+   A   +LP +CT RFPST +++    L  ++    + +
Sbjct:  111 GREFEFLMRQPSVTIGRNSSQGSVDLSMGLSSFISRRHLQLSFQEPHFYLRCLGKNGVFVDGAFQRRGAPALQLPKQCTFRFPSTAIKIQFTSLYHKEEAPASPL 215          
BLAST of Forkhead box protein vs. Ensembl Human
Match: FOXK2 (forkhead box K2 [Source:HGNC Symbol;Acc:HGNC:6036])

HSP 1 Score: 180.259 bits (456), Expect = 6.987e-47
Identity = 85/132 (64.39%), Postives = 100/132 (75.76%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNCGSICSENIPSASRVFSLSSGRAGSLCAVS 1542
            D  KPPYSYAQLIVQA++ + D+QLTLNGIY +I+K+YPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D A ESKLI QAFRKRR R   C    +   P +SR    S   AG L A S
Sbjct:  255 DDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKRRPRGVPC--FRTPLGPLSSRSAPASPNHAGVLSAHS 384          

HSP 2 Score: 95.9005 bits (237), Expect = 1.038e-19
Identity = 48/133 (36.09%), Postives = 67/133 (50.38%), Query Frame = 1
Query:  190 GNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYKKLK----------------------IKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLVGRKSGKCNSMESDNDA 522
            G E  Y MK   +TIGRNS+ G+VD+ +G  +F+SR+HLE+                              ++CLGKNG+F+D  F+   A P +LP  CT RFPSTN+++    L   K  K  + ES   A
Sbjct:   42 GREFEYLMKKRSVTIGRNSSQGSVDVSMGHSSFISRRHLEIFTPPGGGGHGGAAPELPPAQPRPDAGGDFYLRCLGKNGVFVDGVFQRRGAPPLQLPRVCTFRFPSTNIKITFTALSSEKREKQEASESPVKA 174          
BLAST of Forkhead box protein vs. Ensembl Human
Match: FOXK2 (forkhead box K2 [Source:HGNC Symbol;Acc:HGNC:6036])

HSP 1 Score: 178.718 bits (452), Expect = 9.984e-47
Identity = 85/132 (64.39%), Postives = 100/132 (75.76%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNCGSICSENIPSASRVFSLSSGRAGSLCAVS 1542
            D  KPPYSYAQLIVQA++ + D+QLTLNGIY +I+K+YPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D A ESKLI QAFRKRR R   C    +   P +SR    S   AG L A S
Sbjct:  255 DDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKRRPRGVPC--FRTPLGPLSSRSAPASPNHAGVLSAHS 384          

HSP 2 Score: 95.9005 bits (237), Expect = 1.018e-19
Identity = 48/133 (36.09%), Postives = 67/133 (50.38%), Query Frame = 1
Query:  190 GNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYKKLK----------------------IKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLVGRKSGKCNSMESDNDA 522
            G E  Y MK   +TIGRNS+ G+VD+ +G  +F+SR+HLE+                              ++CLGKNG+F+D  F+   A P +LP  CT RFPSTN+++    L   K  K  + ES   A
Sbjct:   42 GREFEYLMKKRSVTIGRNSSQGSVDVSMGHSSFISRRHLEIFTPPGGGGHGGAAPELPPAQPRPDAGGDFYLRCLGKNGVFVDGVFQRRGAPPLQLPRVCTFRFPSTNIKITFTALSSEKREKQEASESPVKA 174          
BLAST of Forkhead box protein vs. Ensembl Celegans
Match: fkh-2 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:Q95QA9])

HSP 1 Score: 111.694 bits (278), Expect = 5.015e-27
Identity = 49/97 (50.52%), Postives = 70/97 (72.16%), Query Frame = 1
Query: 1156 KPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKL-IAQAFRKRRLR 1443
            KPP+SY  LI+ A+  S +++LTL GIY YI  +YP+++ + +GWQNS+RHNLSLN+ F+KVPR  D+PGKG++W +D   E ++ I  A  K R R
Sbjct:   93 KPPFSYNALIMMAIKDSPEKRLTLAGIYEYIVTNYPFYRDNKQGWQNSIRHNLSLNKCFVKVPRNFDDPGKGNYWMLDATAEDEVFIGGATGKLRRR 189          
BLAST of Forkhead box protein vs. Ensembl Celegans
Match: lin-31 (pep chromosome:WBcel235:II:3982549:3986944:1 gene:WBGene00003017.1 transcript:K10G6.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-31)

HSP 1 Score: 96.6709 bits (239), Expect = 3.685e-22
Identity = 42/80 (52.50%), Postives = 53/80 (66.25%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRV 1386
            D QKPPYSY  L   A+  S D+ L L  IY YI   +P+++ + + WQNS+RHNLS N  FIK+PR  D PGKGS+W V
Sbjct:   10 DEQKPPYSYIWLTYMAIQDSDDKMLPLTEIYKYIMDRFPFYRKNTQRWQNSLRHNLSFNDCFIKIPRRADRPGKGSYWAV 89          
BLAST of Forkhead box protein vs. Ensembl Celegans
Match: fkh-2 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:Q95QA9])

HSP 1 Score: 94.3597 bits (233), Expect = 3.765e-22
Identity = 42/91 (46.15%), Postives = 64/91 (70.33%), Query Frame = 1
Query: 1186 VQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKL-IAQAFRKRRLRSNNC 1455
            + A+  S +++LTL GIY YI  +YP+++ + +GWQNS+RHNLSLN+ F+KVPR  D+PGKG++W +D   E ++ I  A  K R R ++ 
Sbjct:    1 MMAIKDSPEKRLTLAGIYEYIVTNYPFYRDNKQGWQNSIRHNLSLNKCFVKVPRNFDDPGKGNYWMLDATAEDEVFIGGATGKLRRRPSSL 91          
BLAST of Forkhead box protein vs. Ensembl Celegans
Match: fkh-2 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:Q95QA9])

HSP 1 Score: 94.3597 bits (233), Expect = 3.765e-22
Identity = 42/91 (46.15%), Postives = 64/91 (70.33%), Query Frame = 1
Query: 1186 VQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKL-IAQAFRKRRLRSNNC 1455
            + A+  S +++LTL GIY YI  +YP+++ + +GWQNS+RHNLSLN+ F+KVPR  D+PGKG++W +D   E ++ I  A  K R R ++ 
Sbjct:    1 MMAIKDSPEKRLTLAGIYEYIVTNYPFYRDNKQGWQNSIRHNLSLNKCFVKVPRNFDDPGKGNYWMLDATAEDEVFIGGATGKLRRRPSSL 91          
BLAST of Forkhead box protein vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 98.2117 bits (243), Expect = 2.311e-21
Identity = 45/84 (53.57%), Postives = 60/84 (71.43%), Query Frame = 1
Query: 1138 YGTDTQ-KPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRV 1386
            +GT  Q KPPYSY  LI  A+  S  RQLTL+ IYN+I   +PY++++ + WQNS+RH+LS N  F+KV R  D+PGKGSFW +
Sbjct:  165 HGTYGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTL 248          
BLAST of Forkhead box protein vs. Ensembl Fly
Match: FoxK (gene:FBgn0036134 transcript:FBtr0332653)

HSP 1 Score: 154.836 bits (390), Expect = 1.543e-38
Identity = 69/100 (69.00%), Postives = 86/100 (86.00%), Query Frame = 1
Query: 1153 QKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYF-KSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSN 1449
            +KPPYSYAQLIVQA+S++ D+QLTL+GIY++I KHYPY+ K  +KGWQNS+RHNLSLNRYFIKV R QDEPGKGSFWR+D    +KLI  +++KRR RS+
Sbjct:  451 EKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSS 550          

HSP 2 Score: 72.0182 bits (175), Expect = 1.878e-12
Identity = 36/104 (34.62%), Postives = 56/104 (53.85%), Query Frame = 1
Query:  172 YARITFGNENAYFMKTEKIT-IGRNSADGTVDIDVGPHTFVSRKHLEMMY--SYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLV 474
            Y  + F  E      T+ +T IGRNS+   V  +V  +  VSRKH +++Y    +   ++CL KNGIF+D++ +  +  P  LP  C  RFPST + +  +  V
Sbjct:  154 YGELRFNQE--VLPITDAVTVIGRNSSTSLVHFNVAENNLVSRKHFQVLYDVELRAFFVQCLSKNGIFVDDFLQRRNVDPLRLPQRCYFRFPSTEIRIEFESYV 255          
BLAST of Forkhead box protein vs. Ensembl Fly
Match: FoxK (gene:FBgn0036134 transcript:FBtr0300783)

HSP 1 Score: 154.836 bits (390), Expect = 1.553e-38
Identity = 69/100 (69.00%), Postives = 86/100 (86.00%), Query Frame = 1
Query: 1153 QKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYF-KSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSN 1449
            +KPPYSYAQLIVQA+S++ D+QLTL+GIY++I KHYPY+ K  +KGWQNS+RHNLSLNRYFIKV R QDEPGKGSFWR+D    +KLI  +++KRR RS+
Sbjct:  452 EKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSS 551          

HSP 2 Score: 72.0182 bits (175), Expect = 1.880e-12
Identity = 36/104 (34.62%), Postives = 56/104 (53.85%), Query Frame = 1
Query:  172 YARITFGNENAYFMKTEKIT-IGRNSADGTVDIDVGPHTFVSRKHLEMMY--SYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLV 474
            Y  + F  E      T+ +T IGRNS+   V  +V  +  VSRKH +++Y    +   ++CL KNGIF+D++ +  +  P  LP  C  RFPST + +  +  V
Sbjct:  154 YGELRFNQE--VLPITDAVTVIGRNSSTSLVHFNVAENNLVSRKHFQVLYDVELRAFFVQCLSKNGIFVDDFLQRRNVDPLRLPQRCYFRFPSTEIRIEFESYV 255          
BLAST of Forkhead box protein vs. Ensembl Fly
Match: FoxK (gene:FBgn0036134 transcript:FBtr0300784)

HSP 1 Score: 154.836 bits (390), Expect = 1.553e-38
Identity = 69/100 (69.00%), Postives = 86/100 (86.00%), Query Frame = 1
Query: 1153 QKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYF-KSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSN 1449
            +KPPYSYAQLIVQA+S++ D+QLTL+GIY++I KHYPY+ K  +KGWQNS+RHNLSLNRYFIKV R QDEPGKGSFWR+D    +KLI  +++KRR RS+
Sbjct:  452 EKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSS 551          

HSP 2 Score: 72.0182 bits (175), Expect = 1.880e-12
Identity = 36/104 (34.62%), Postives = 56/104 (53.85%), Query Frame = 1
Query:  172 YARITFGNENAYFMKTEKIT-IGRNSADGTVDIDVGPHTFVSRKHLEMMY--SYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLV 474
            Y  + F  E      T+ +T IGRNS+   V  +V  +  VSRKH +++Y    +   ++CL KNGIF+D++ +  +  P  LP  C  RFPST + +  +  V
Sbjct:  154 YGELRFNQE--VLPITDAVTVIGRNSSTSLVHFNVAENNLVSRKHFQVLYDVELRAFFVQCLSKNGIFVDDFLQRRNVDPLRLPQRCYFRFPSTEIRIEFESYV 255          
BLAST of Forkhead box protein vs. Ensembl Fly
Match: FoxK (gene:FBgn0036134 transcript:FBtr0300786)

HSP 1 Score: 154.836 bits (390), Expect = 1.553e-38
Identity = 69/100 (69.00%), Postives = 86/100 (86.00%), Query Frame = 1
Query: 1153 QKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYF-KSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSN 1449
            +KPPYSYAQLIVQA+S++ D+QLTL+GIY++I KHYPY+ K  +KGWQNS+RHNLSLNRYFIKV R QDEPGKGSFWR+D    +KLI  +++KRR RS+
Sbjct:  452 EKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSS 551          

HSP 2 Score: 72.0182 bits (175), Expect = 1.880e-12
Identity = 36/104 (34.62%), Postives = 56/104 (53.85%), Query Frame = 1
Query:  172 YARITFGNENAYFMKTEKIT-IGRNSADGTVDIDVGPHTFVSRKHLEMMY--SYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLV 474
            Y  + F  E      T+ +T IGRNS+   V  +V  +  VSRKH +++Y    +   ++CL KNGIF+D++ +  +  P  LP  C  RFPST + +  +  V
Sbjct:  154 YGELRFNQE--VLPITDAVTVIGRNSSTSLVHFNVAENNLVSRKHFQVLYDVELRAFFVQCLSKNGIFVDDFLQRRNVDPLRLPQRCYFRFPSTEIRIEFESYV 255          
BLAST of Forkhead box protein vs. Ensembl Fly
Match: FoxK (gene:FBgn0036134 transcript:FBtr0300785)

HSP 1 Score: 154.836 bits (390), Expect = 1.553e-38
Identity = 69/100 (69.00%), Postives = 86/100 (86.00%), Query Frame = 1
Query: 1153 QKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYF-KSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSN 1449
            +KPPYSYAQLIVQA+S++ D+QLTL+GIY++I KHYPY+ K  +KGWQNS+RHNLSLNRYFIKV R QDEPGKGSFWR+D    +KLI  +++KRR RS+
Sbjct:  452 EKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSS 551          

HSP 2 Score: 72.0182 bits (175), Expect = 1.880e-12
Identity = 36/104 (34.62%), Postives = 56/104 (53.85%), Query Frame = 1
Query:  172 YARITFGNENAYFMKTEKIT-IGRNSADGTVDIDVGPHTFVSRKHLEMMY--SYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLV 474
            Y  + F  E      T+ +T IGRNS+   V  +V  +  VSRKH +++Y    +   ++CL KNGIF+D++ +  +  P  LP  C  RFPST + +  +  V
Sbjct:  154 YGELRFNQE--VLPITDAVTVIGRNSSTSLVHFNVAENNLVSRKHFQVLYDVELRAFFVQCLSKNGIFVDDFLQRRNVDPLRLPQRCYFRFPSTEIRIEFESYV 255          
BLAST of Forkhead box protein vs. Ensembl Zebrafish
Match: foxk1 (forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6402])

HSP 1 Score: 183.726 bits (465), Expect = 2.187e-48
Identity = 80/119 (67.23%), Postives = 99/119 (83.19%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC-----GSICSENIPSA 1488
            D  KPPYSYAQLIVQA+SS++DRQLTL+GIY +I+KHYPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWRVD + E+KL+ QAFRKRR R  +C     G + S + P++
Sbjct:  255 DESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRVDPSSEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPAS 373          

HSP 2 Score: 100.138 bits (248), Expect = 3.075e-21
Identity = 39/101 (38.61%), Postives = 66/101 (65.35%), Query Frame = 1
Query:  190 GNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLVGRKSGK 492
            G +  + M+   +T+GRNS+ G+VD+++G  +F+SR+HL++ +      ++CLGKNG+F+D  F+   A P  LP ECT RFPST +++    L  +++ K
Sbjct:   60 GRDFEFVMRQRTVTVGRNSSHGSVDVNMGHSSFISRRHLQIAFEEPHFYLRCLGKNGVFVDGVFQRRGAPPLALPRECTFRFPSTVIKIQFTSLYHKETQK 160          
BLAST of Forkhead box protein vs. Ensembl Zebrafish
Match: FOXK2 (si:ch211-262e15.1 [Source:ZFIN;Acc:ZDB-GENE-030131-5310])

HSP 1 Score: 175.637 bits (444), Expect = 5.849e-46
Identity = 76/119 (63.87%), Postives = 95/119 (79.83%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC-----GSICSENIPSA 1488
            D  KPPYSYAQLIVQA++ + D+QLTLNGIY +I+K+YPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D + E KL+ QAFRKRR R   C     G + S + P++
Sbjct:  208 DDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPSSEGKLVEQAFRKRRPRGVPCFRTPLGPLSSRSAPAS 326          

HSP 2 Score: 96.2857 bits (238), Expect = 4.100e-20
Identity = 44/111 (39.64%), Postives = 64/111 (57.66%), Query Frame = 1
Query:  190 GNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYKK----------LKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLVGRKSGK 492
            G E  Y MK   +T+GRNS+ G+VD+ +G  +F+SR+HLE+  +  +            ++CLGKNG+F+D  F    A P +LP  CT RFPSTN+++    L   K  K
Sbjct:    9 GREFEYVMKKRSVTVGRNSSQGSVDVSMGHSSFISRRHLEIFTAAAEDTGSGPGGGDFYLRCLGKNGVFVDGVFLRRGAPPLQLPRVCTFRFPSTNIKITFTALASVKREK 119          
BLAST of Forkhead box protein vs. Ensembl Zebrafish
Match: foxk2 (forkhead box K2 [Source:ZFIN;Acc:ZDB-GENE-030131-2861])

HSP 1 Score: 170.244 bits (430), Expect = 2.060e-44
Identity = 93/199 (46.73%), Postives = 120/199 (60.30%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC-----GSICSENIP-SASRVFSLSSGRAGSLCAVSDRNAKLNNIFTLRRAGDQKAPTTYVFRKMSDTQQLTENVFGSAAKLISKQSDVNNSSNTIS 1725
            D  KPPYSYAQLIVQA++ + D+QLTLNGIY +I+K+YPY+++ DKGWQNS+RHNLSLNRYFIKV R Q+EPGKGSFWR+D + E KL+ QAFRKRR R   C     G + S + P S +    LS+  +G     S R      +     A     P   V ++       T+N  GS   LI+ Q  +  S   +S
Sbjct:  201 DDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVARSQEEPGKGSFWRIDPSSEGKLMDQAFRKRRPRGVPCFRTPLGPLSSRSAPASPTHTGVLSAHSSGVQTPDSSREGSPLPLEPEPSAAAAPQPKLAVIQESC----FTQNTPGSPV-LIAVQQPLQQSLKPVS 394          

HSP 2 Score: 103.219 bits (256), Expect = 2.154e-22
Identity = 43/98 (43.88%), Postives = 66/98 (67.35%), Query Frame = 1
Query:  190 GNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYK----KLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQL 471
            G E  Y MK   +T+GRNS+ G+VD+ +G  +F+SR+HLE+  + +    +  ++CLGKNG+F+D  F+   A P +LP  CTLRFPSTN++++   L
Sbjct:   11 GREFEYLMKKRSVTVGRNSSQGSVDVSMGHSSFISRRHLEIFSAGEDGAGEFYLRCLGKNGVFVDGAFQRRGAPPLQLPRACTLRFPSTNIKISFTAL 108          
BLAST of Forkhead box protein vs. Ensembl Zebrafish
Match: foxj1a (forkhead box J1a [Source:NCBI gene;Acc:767737])

HSP 1 Score: 124.79 bits (312), Expect = 9.437e-30
Identity = 52/95 (54.74%), Postives = 72/95 (75.79%), Query Frame = 1
Query: 1156 KPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRL 1440
            KPPYSYA LI  A+ +S+  ++TL+ IY +I+ ++ YF+  D  WQNS+RHNLSLN+ FIKVPR +DEPGKG FW++D  Y  +L+  A++KRRL
Sbjct:  142 KPPYSYATLICMAMQASKKTKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAERLLNGAYKKRRL 236          
BLAST of Forkhead box protein vs. Ensembl Zebrafish
Match: foxj1a (forkhead box J1a [Source:NCBI gene;Acc:767737])

HSP 1 Score: 124.79 bits (312), Expect = 9.437e-30
Identity = 52/95 (54.74%), Postives = 72/95 (75.79%), Query Frame = 1
Query: 1156 KPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRL 1440
            KPPYSYA LI  A+ +S+  ++TL+ IY +I+ ++ YF+  D  WQNS+RHNLSLN+ FIKVPR +DEPGKG FW++D  Y  +L+  A++KRRL
Sbjct:  142 KPPYSYATLICMAMQASKKTKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAERLLNGAYKKRRL 236          
BLAST of Forkhead box protein vs. Ensembl Xenopus
Match: foxk2 (forkhead box K2 [Source:NCBI gene;Acc:100216193])

HSP 1 Score: 181.03 bits (458), Expect = 4.565e-48
Identity = 87/148 (58.78%), Postives = 106/148 (71.62%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNCGSICSENIPSASRVFSLSSGRAGSLCAVSDRNAKLNNIFTLRRAG 1590
            D  KPPYSYAQLIVQA++ + D+QLTLNGIY +I+K+YPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D A ESKL+ QAFRKRR R   C    +   P +SR    S   AG L A    ++ L    +L R G
Sbjct:  123 DDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLVEQAFRKRRPRGVPC--FRTPLGPLSSRSAPASPNHAGVLSA---HSSGLQTPESLSREG 265          
BLAST of Forkhead box protein vs. Ensembl Xenopus
Match: foxk2 (forkhead box K2 [Source:NCBI gene;Acc:100216193])

HSP 1 Score: 179.104 bits (453), Expect = 4.195e-47
Identity = 87/148 (58.78%), Postives = 106/148 (71.62%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNCGSICSENIPSASRVFSLSSGRAGSLCAVSDRNAKLNNIFTLRRAG 1590
            D  KPPYSYAQLIVQA++ + D+QLTLNGIY +I+K+YPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D A ESKL+ QAFRKRR R   C    +   P +SR    S   AG L A    ++ L    +L R G
Sbjct:  155 DDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLVEQAFRKRRPRGVPC--FRTPLGPLSSRSAPASPNHAGVLSA---HSSGLQTPESLSREG 297          
BLAST of Forkhead box protein vs. Ensembl Xenopus
Match: foxk2 (forkhead box K2 [Source:NCBI gene;Acc:100216193])

HSP 1 Score: 178.333 bits (451), Expect = 1.143e-46
Identity = 87/148 (58.78%), Postives = 106/148 (71.62%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNCGSICSENIPSASRVFSLSSGRAGSLCAVSDRNAKLNNIFTLRRAG 1590
            D  KPPYSYAQLIVQA++ + D+QLTLNGIY +I+K+YPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D A ESKL+ QAFRKRR R   C    +   P +SR    S   AG L A    ++ L    +L R G
Sbjct:  175 DDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLVEQAFRKRRPRGVPC--FRTPLGPLSSRSAPASPNHAGVLSA---HSSGLQTPESLSREG 317          
BLAST of Forkhead box protein vs. Ensembl Xenopus
Match: prss2 (serine protease 2 [Source:Xenbase;Acc:XB-GENE-6065254])

HSP 1 Score: 122.479 bits (306), Expect = 2.316e-29
Identity = 51/108 (47.22%), Postives = 80/108 (74.07%), Query Frame = 1
Query: 1132 IEYGTDTQ-KPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNN 1452
            ++Y T+   KPPYSYA LI  A+ +S+ R+LTL+ IY++I++++ Y++  D  WQNS+RHNLSLN+ F+KVPRG+DEPGKG FW++D  Y    +    ++RR+ +++
Sbjct:  100 VDYRTNANIKPPYSYATLICMAMEASQQRKLTLSAIYSWITQNFCYYRHADPSWQNSIRHNLSLNKCFMKVPRGKDEPGKGGFWQMDPRYADMFVNGVLKRRRMPASH 207          
BLAST of Forkhead box protein vs. Ensembl Xenopus
Match: foxj1 (forkhead box J1 [Source:NCBI gene;Acc:496834])

HSP 1 Score: 124.02 bits (310), Expect = 4.295e-29
Identity = 55/104 (52.88%), Postives = 76/104 (73.08%), Query Frame = 1
Query: 1132 IEYGTDTQ-KPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRL 1440
            I+Y T+   KPPYSYA LI  A+ +S+  ++TL+ IY +I+ ++ YF+  D  WQNS+RHNLSLN+ FIKVPR +DEPGKG FW++D  Y  +L+  A +KRRL
Sbjct:  175 IDYKTNPHVKPPYSYATLICMAMQASKKTKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWKIDPQYADRLMNGAMKKRRL 278          
BLAST of Forkhead box protein vs. Ensembl Mouse
Match: Foxk1 (forkhead box K1 [Source:MGI Symbol;Acc:MGI:1347488])

HSP 1 Score: 186.422 bits (472), Expect = 7.178e-49
Identity = 84/133 (63.16%), Postives = 104/133 (78.20%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC-----GSICSENIPSASRVFSLSSGRAGSL 1530
            D  KPPYSYAQLIVQA+SS++DRQLTL+GIY +I+KHYPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D A E+KL+ QAFRKRR R  +C     G + S + P++     L S R+  L
Sbjct:  288 DESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPASPTHPGLMSPRSSGL 420          

HSP 2 Score: 98.5969 bits (244), Expect = 1.120e-20
Identity = 38/105 (36.19%), Postives = 65/105 (61.90%), Query Frame = 1
Query:  190 GNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLVGRKSGKCNSM 504
            G E  + M+   +TIGRNS+ G+VD+ +G  +F+SR+HL++ +      ++CLGKNG+F+D  F+   A   +LP +CT RFPST +++    L  ++    + +
Sbjct:   97 GREFEFLMRQPSVTIGRNSSQGSVDLSMGLSSFISRRHLQLSFQEPHFYLRCLGKNGVFVDGAFQRRGAPALQLPQQCTFRFPSTAIKIQFTSLYHKEEAPASPL 201          
BLAST of Forkhead box protein vs. Ensembl Mouse
Match: Foxk2 (forkhead box K2 [Source:MGI Symbol;Acc:MGI:1916087])

HSP 1 Score: 179.104 bits (453), Expect = 8.400e-47
Identity = 84/132 (63.64%), Postives = 100/132 (75.76%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNCGSICSENIPSASRVFSLSSGRAGSLCAVS 1542
            D  KPPYSYAQLIVQA++ + D+QLTLNGIY +I+K+YPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D A ESKL+ QAFRKRR R   C    +   P +SR    S   AG L A S
Sbjct:  246 DDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLVEQAFRKRRPRGVPC--FRTPLGPLSSRSAPASPNHAGVLSAHS 375          

HSP 2 Score: 96.6709 bits (239), Expect = 4.513e-20
Identity = 47/126 (37.30%), Postives = 67/126 (53.17%), Query Frame = 1
Query:  190 GNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMY-------------------SYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLVGRKSGKCNSMES 510
            G E  Y MK   +TIGRNS+ G+VD+ +G  +F+SR+HLE+                     +     ++CLGKNG+F+D  F+   A P +LP  CT RFPSTN+++    L   K  K  + ES
Sbjct:   36 GREFEYLMKKRSVTIGRNSSQGSVDVSMGHSSFISRRHLEIFTPPGGGHSAAAPEPAQPRPDAGGDFYLRCLGKNGVFVDGVFQRRGAPPLQLPRVCTFRFPSTNIKITFTALSSEKREKQEAPES 161          
BLAST of Forkhead box protein vs. Ensembl Mouse
Match: Foxj1 (forkhead box J1 [Source:MGI Symbol;Acc:MGI:1347474])

HSP 1 Score: 129.413 bits (324), Expect = 1.605e-31
Identity = 56/104 (53.85%), Postives = 78/104 (75.00%), Query Frame = 1
Query: 1132 IEYGTDTQ-KPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRL 1440
            ++Y T+   KPPYSYA LI  A+ +S+  ++TL+ IY +I+ ++ YF+  D  WQNS+RHNLSLN+ FIKVPR +DEPGKG FWR+D  Y  +L++ AF+KRRL
Sbjct:  112 VDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRL 215          
BLAST of Forkhead box protein vs. Ensembl Mouse
Match: Foxg1 (forkhead box G1 [Source:MGI Symbol;Acc:MGI:1347464])

HSP 1 Score: 115.931 bits (289), Expect = 9.820e-27
Identity = 49/98 (50.00%), Postives = 72/98 (73.47%), Query Frame = 1
Query: 1153 QKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRS 1446
            +KPP+SY  LI+ A+  S +++LTLNGIY +I K++PY++ + +GWQNS+RHNLSLN+ F+KVPR  D+PGKG++W +D + +   I     K R RS
Sbjct:  172 EKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRS 269          
BLAST of Forkhead box protein vs. Ensembl Mouse
Match: Foxg1 (forkhead box G1 [Source:MGI Symbol;Acc:MGI:1347464])

HSP 1 Score: 115.931 bits (289), Expect = 9.820e-27
Identity = 49/98 (50.00%), Postives = 72/98 (73.47%), Query Frame = 1
Query: 1153 QKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRS 1446
            +KPP+SY  LI+ A+  S +++LTLNGIY +I K++PY++ + +GWQNS+RHNLSLN+ F+KVPR  D+PGKG++W +D + +   I     K R RS
Sbjct:  172 EKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRS 269          
BLAST of Forkhead box protein vs. UniProt/SwissProt
Match: sp|P85037|FOXK1_HUMAN (Forkhead box protein K1 OS=Homo sapiens OX=9606 GN=FOXK1 PE=1 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 2.095e-48
Identity = 84/133 (63.16%), Postives = 105/133 (78.95%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC-----GSICSENIPSASRVFSLSSGRAGSL 1530
            D  KPP+SYAQLIVQA+SS++DRQLTL+GIY +I+KHYPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D A E+KL+ QAFRKRR R  +C     G + S + P++     L S R+G L
Sbjct:  302 DESKPPFSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPASPTHPGLMSPRSGGL 434          

HSP 2 Score: 98.2117 bits (243), Expect = 1.176e-19
Identity = 38/105 (36.19%), Postives = 65/105 (61.90%), Query Frame = 1
Query:  190 GNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLVGRKSGKCNSM 504
            G E  + M+   +TIGRNS+ G+VD+ +G  +F+SR+HL++ +      ++CLGKNG+F+D  F+   A   +LP +CT RFPST +++    L  ++    + +
Sbjct:  111 GREFEFLMRQPSVTIGRNSSQGSVDLSMGLSSFISRRHLQLSFQEPHFYLRCLGKNGVFVDGAFQRRGAPALQLPKQCTFRFPSTAIKIQFTSLYHKEEAPASPL 215          
BLAST of Forkhead box protein vs. UniProt/SwissProt
Match: sp|P42128|FOXK1_MOUSE (Forkhead box protein K1 OS=Mus musculus OX=10090 GN=Foxk1 PE=1 SV=2)

HSP 1 Score: 186.422 bits (472), Expect = 5.021e-48
Identity = 84/133 (63.16%), Postives = 104/133 (78.20%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC-----GSICSENIPSASRVFSLSSGRAGSL 1530
            D  KPPYSYAQLIVQA+SS++DRQLTL+GIY +I+KHYPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D A E+KL+ QAFRKRR R  +C     G + S + P++     L S R+  L
Sbjct:  288 DESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPASPTHPGLMSPRSSGL 420          

HSP 2 Score: 98.5969 bits (244), Expect = 7.831e-20
Identity = 38/105 (36.19%), Postives = 65/105 (61.90%), Query Frame = 1
Query:  190 GNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLVGRKSGKCNSM 504
            G E  + M+   +TIGRNS+ G+VD+ +G  +F+SR+HL++ +      ++CLGKNG+F+D  F+   A   +LP +CT RFPST +++    L  ++    + +
Sbjct:   97 GREFEFLMRQPSVTIGRNSSQGSVDLSMGLSSFISRRHLQLSFQEPHFYLRCLGKNGVFVDGAFQRRGAPALQLPQQCTFRFPSTAIKIQFTSLYHKEEAPASPL 201          
BLAST of Forkhead box protein vs. UniProt/SwissProt
Match: sp|Q01167|FOXK2_HUMAN (Forkhead box protein K2 OS=Homo sapiens OX=9606 GN=FOXK2 PE=1 SV=3)

HSP 1 Score: 180.259 bits (456), Expect = 3.355e-46
Identity = 85/132 (64.39%), Postives = 100/132 (75.76%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNCGSICSENIPSASRVFSLSSGRAGSLCAVS 1542
            D  KPPYSYAQLIVQA++ + D+QLTLNGIY +I+K+YPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D A ESKLI QAFRKRR R   C    +   P +SR    S   AG L A S
Sbjct:  255 DDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKRRPRGVPC--FRTPLGPLSSRSAPASPNHAGVLSAHS 384          

HSP 2 Score: 95.9005 bits (237), Expect = 4.983e-19
Identity = 48/133 (36.09%), Postives = 67/133 (50.38%), Query Frame = 1
Query:  190 GNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYKKLK----------------------IKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLVGRKSGKCNSMESDNDA 522
            G E  Y MK   +TIGRNS+ G+VD+ +G  +F+SR+HLE+                              ++CLGKNG+F+D  F+   A P +LP  CT RFPSTN+++    L   K  K  + ES   A
Sbjct:   42 GREFEYLMKKRSVTIGRNSSQGSVDVSMGHSSFISRRHLEIFTPPGGGGHGGAAPELPPAQPRPDAGGDFYLRCLGKNGVFVDGVFQRRGAPPLQLPRVCTFRFPSTNIKITFTALSSEKREKQEASESPVKA 174          
BLAST of Forkhead box protein vs. UniProt/SwissProt
Match: sp|Q7ZX03|FOXK2_XENLA (Forkhead box protein K2 OS=Xenopus laevis OX=8355 GN=foxk2 PE=2 SV=2)

HSP 1 Score: 179.874 bits (455), Expect = 3.468e-46
Identity = 83/130 (63.85%), Postives = 101/130 (77.69%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC-----GSICSENIPSA---SRVFSLSS 1512
            D  KPPYSYAQLIVQA++ + D+QLTLNGIY +I+K+YPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D A ESKL+ QAFRKRR R   C     G + S + P++   S VFS  S
Sbjct:  216 DDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLVEQAFRKRRPRGVPCFRTPLGPLSSRSAPASPNHSGVFSAHS 345          

HSP 2 Score: 100.523 bits (249), Expect = 2.002e-20
Identity = 47/116 (40.52%), Postives = 65/116 (56.03%), Query Frame = 1
Query:  190 GNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYKKLK---------IKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLVGRKSGKCNSMES 510
            G E  Y MK   +TIGRNS+ G VD+ +G  +F+SR+HLE+                 ++CLGKNG+F+D  F+   A P +LP  CT RFPSTN+++    L   K  K  + ES
Sbjct:   18 GREFEYLMKKRSVTIGRNSSQGCVDVSMGHSSFISRRHLEIFIGGSGDGDDADVGDFYLRCLGKNGVFVDGVFQRRGAPPLQLPRVCTFRFPSTNIKITFTALAIDKKQKLEAPES 133          
BLAST of Forkhead box protein vs. UniProt/SwissProt
Match: sp|Q3UCQ1|FOXK2_MOUSE (Forkhead box protein K2 OS=Mus musculus OX=10090 GN=Foxk2 PE=1 SV=3)

HSP 1 Score: 179.104 bits (453), Expect = 5.876e-46
Identity = 84/132 (63.64%), Postives = 100/132 (75.76%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNCGSICSENIPSASRVFSLSSGRAGSLCAVS 1542
            D  KPPYSYAQLIVQA++ + D+QLTLNGIY +I+K+YPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D A ESKL+ QAFRKRR R   C    +   P +SR    S   AG L A S
Sbjct:  246 DDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLVEQAFRKRRPRGVPC--FRTPLGPLSSRSAPASPNHAGVLSAHS 375          

HSP 2 Score: 96.6709 bits (239), Expect = 3.157e-19
Identity = 47/126 (37.30%), Postives = 67/126 (53.17%), Query Frame = 1
Query:  190 GNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMY-------------------SYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLVGRKSGKCNSMES 510
            G E  Y MK   +TIGRNS+ G+VD+ +G  +F+SR+HLE+                     +     ++CLGKNG+F+D  F+   A P +LP  CT RFPSTN+++    L   K  K  + ES
Sbjct:   36 GREFEYLMKKRSVTIGRNSSQGSVDVSMGHSSFISRRHLEIFTPPGGGHSAAAPEPAQPRPDAGGDFYLRCLGKNGVFVDGVFQRRGAPPLQLPRVCTFRFPSTNIKITFTALSSEKREKQEAPES 161          
BLAST of Forkhead box protein vs. TrEMBL
Match: B3KV39 (cDNA FLJ16099 fis, clone TESTI2008278, highly similar to Homo sapiens forkhead box K1 (FOXK1), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 5.200e-48
Identity = 84/133 (63.16%), Postives = 105/133 (78.95%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC-----GSICSENIPSASRVFSLSSGRAGSL 1530
            D  KPP+SYAQLIVQA+SS++DRQLTL+GIY +I+KHYPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D A E+KL+ QAFRKRR R  +C     G + S + P++     L S R+G L
Sbjct:   66 DESKPPFSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPASPTHPGLMSPRSGGL 198          
BLAST of Forkhead box protein vs. TrEMBL
Match: A0A4U1ETS3 (Fork-head domain-containing protein (Fragment) OS=Monodon monoceros OX=40151 GN=EI555_015332 PE=4 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 7.764e-48
Identity = 84/133 (63.16%), Postives = 104/133 (78.20%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC-----GSICSENIPSASRVFSLSSGRAGSL 1530
            D  KPPYSYAQLIVQA+SS++DRQLTL+GIY +I+KHYPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D A E+KL+ QAFRKRR R  +C     G + S + P++     L S R+  L
Sbjct:   53 DESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPASPTHPGLMSPRSSGL 185          
BLAST of Forkhead box protein vs. TrEMBL
Match: A0A5J5MRY4 (Fork-head domain-containing protein (Fragment) OS=Muntiacus reevesi OX=9886 GN=FD755_004812 PE=4 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 2.002e-47
Identity = 84/133 (63.16%), Postives = 104/133 (78.20%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC-----GSICSENIPSASRVFSLSSGRAGSL 1530
            D  KPPYSYAQLIVQA+SS++DRQLTL+GIY +I+KHYPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D A E+KL+ QAFRKRR R  +C     G + S + P++     L S R+  L
Sbjct:  133 DESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASETKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPASPTHPGLMSPRSSGL 265          
BLAST of Forkhead box protein vs. TrEMBL
Match: M1ER36 (Forkhead box K1 (Fragment) OS=Mustela putorius furo OX=9669 PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 2.028e-47
Identity = 84/133 (63.16%), Postives = 104/133 (78.20%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC-----GSICSENIPSASRVFSLSSGRAGSL 1530
            D  KPPYSYAQLIVQA+SS++DRQLTL+GIY +I+KHYPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D A E+KL+ QAFRKRR R  +C     G + S + P++     L S R+  L
Sbjct:  170 DESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPASPTHPGLMSPRSSGL 302          

HSP 2 Score: 75.0998 bits (183), Expect = 1.929e-10
Identity = 28/72 (38.89%), Postives = 47/72 (65.28%), Query Frame = 1
Query:  256 TVDIDVGPHTFVSRKHLEMMYSYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQL 471
            +VD+ +G  +F+SR+HL++ +      ++CLGKNG+F+D  F+   A   +LP +CT RFPST +++    L
Sbjct:    1 SVDLSMGLSSFISRRHLQLTFQEPHFYLRCLGKNGVFVDGAFQRRGAPALQLPKQCTFRFPSTAIKIQFTSL 72          
BLAST of Forkhead box protein vs. TrEMBL
Match: A0A3L7HQR4 (FOXK1 (Fragment) OS=Cricetulus griseus OX=10029 GN=CgPICR_011690 PE=4 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 2.834e-47
Identity = 84/133 (63.16%), Postives = 104/133 (78.20%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC-----GSICSENIPSASRVFSLSSGRAGSL 1530
            D  KPPYSYAQLIVQA+SS++DRQLTL+GIY +I+KHYPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D A E+KL+ QAFRKRR R  +C     G + S + P++     L S R+  L
Sbjct:   53 DESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPASPTHPGLMSPRSSGL 185          
BLAST of Forkhead box protein vs. Ensembl Cavefish
Match: foxk1 (forkhead box K1 [Source:NCBI gene;Acc:103029597])

HSP 1 Score: 183.726 bits (465), Expect = 2.032e-48
Identity = 80/119 (67.23%), Postives = 99/119 (83.19%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC-----GSICSENIPSA 1488
            D  KPPYSYAQLIVQA+SS++DRQLTL+GIY +I+KHYPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWRVD + E+KL+ QAFRKRR R  +C     G + S + P++
Sbjct:  254 DESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRVDPSSEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPAS 372          

HSP 2 Score: 99.7525 bits (247), Expect = 3.903e-21
Identity = 38/94 (40.43%), Postives = 63/94 (67.02%), Query Frame = 1
Query:  190 GNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQL 471
            G +  + M+   +T+GRNS+ G+VD+++G  +F+SR+HL++ +      ++CLGKNG+F+D  F+   A P +LP ECT RFPST +++    L
Sbjct:   58 GRDFEFVMRQRTVTVGRNSSHGSVDVNMGHSSFISRRHLQITFEEPNFYLRCLGKNGVFVDGVFQRRGAPPIQLPRECTFRFPSTIIKIQFTAL 151          
BLAST of Forkhead box protein vs. Ensembl Cavefish
Match: foxk2 (forkhead box K2 [Source:ZFIN;Acc:ZDB-GENE-030131-2861])

HSP 1 Score: 175.637 bits (444), Expect = 6.689e-46
Identity = 77/119 (64.71%), Postives = 96/119 (80.67%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC-----GSICSENIPSA 1488
            D  KPPYSYAQLIVQA++ + D+QLTLNGIY +I+K+YPY+++ DKGWQNS+RHNLSLNRYFIKVPR Q+EPGKGSFWR+D + ESKL+ QAFRKRR R   C     G + S + P++
Sbjct:  211 DDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPSTESKLMDQAFRKRRPRGVPCFRTPLGPLSSRSAPAS 329          

HSP 2 Score: 102.064 bits (253), Expect = 6.793e-22
Identity = 46/113 (40.71%), Postives = 69/113 (61.06%), Query Frame = 1
Query:  190 GNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYKKLK------IKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLVGRKSGKCNSMES 510
            G E  Y MK   +T+GRNS+ G+VD+ +G  +F+SR+HLE+  + +         ++CLGKNG+F+D  F+   A P +LP  CT RFPSTN+++    L   K  + N+ ES
Sbjct:   16 GREFEYLMKKRSVTVGRNSSQGSVDVSMGHSSFISRRHLEIFTAGEDGAGGGDFYLRCLGKNGVFVDGVFQRRGAPPLQLPRVCTFRFPSTNIKITFTALSSGKKDRRNAPES 128          
BLAST of Forkhead box protein vs. Ensembl Cavefish
Match: ENSAMXT00000049290.1 (forkhead box J1 [Source:NCBI gene;Acc:103028087])

HSP 1 Score: 124.79 bits (312), Expect = 7.898e-30
Identity = 53/103 (51.46%), Postives = 77/103 (74.76%), Query Frame = 1
Query: 1132 IEYGTDTQ-KPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRR 1437
            ++Y T+   KPPYSYA LI  A+ +S+  ++TL+ IY +I+ ++ YF+  D  WQNS+RHNLSLN+ FIKVPR +DEPGKG FW++D  Y  +L++ A++KRR
Sbjct:  138 VDYKTNPHIKPPYSYATLICMAMQASKKSKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAERLLSGAYKKRR 240          
BLAST of Forkhead box protein vs. Ensembl Cavefish
Match: ENSAMXT00000057506.1 (pep primary_assembly:Astyanax_mexicanus-2.0:21:20135586:20141570:1 gene:ENSAMXG00000040101.1 transcript:ENSAMXT00000057506.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.242 bits (295), Expect = 1.164e-28
Identity = 50/98 (51.02%), Postives = 72/98 (73.47%), Query Frame = 1
Query: 1153 QKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRS 1446
            +KPP+SY  LI+ A+  S +++LTLNGIY +I K++PY++ H +GWQNS+RHNLSLN+ F+KVPR  D+PGKG++W +D + +   I     K R RS
Sbjct:   51 EKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYREHKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRS 148          
BLAST of Forkhead box protein vs. Ensembl Cavefish
Match: foxg1b (forkhead box G1b [Source:ZFIN;Acc:ZDB-GENE-040426-2437])

HSP 1 Score: 117.472 bits (293), Expect = 2.166e-28
Identity = 51/102 (50.00%), Postives = 72/102 (70.59%), Query Frame = 1
Query: 1141 GTDTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRS 1446
            G    KPP+SY  LI+ A+  S +++LTLNGIY +I K++PY++ H +GWQNS+RHNLSLN+ F+KVPR  D+PGKG++W +D + +   I     K R RS
Sbjct:   58 GGKHDKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYREHKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRS 159          
BLAST of Forkhead box protein vs. Ensembl Sea Lamprey
Match: foxk1 (forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6402])

HSP 1 Score: 170.629 bits (431), Expect = 2.418e-48
Identity = 73/103 (70.87%), Postives = 87/103 (84.47%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC 1455
            D  KPPYSYAQLIVQA++S+ D+QLTL+GIY +I+KHYPY+++ DKGWQNS+RHNLSLNRYF+KVPR Q+EPGKGSFWR+D   E KL  QAFRKRR R   C
Sbjct:  124 DESKPPYSYAQLIVQAITSALDKQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFVKVPRSQEEPGKGSFWRIDPPSEGKLAEQAFRKRRQRGVPC 226          
BLAST of Forkhead box protein vs. Ensembl Sea Lamprey
Match: foxk1 (forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6402])

HSP 1 Score: 173.326 bits (438), Expect = 3.166e-46
Identity = 73/103 (70.87%), Postives = 87/103 (84.47%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC 1455
            D  KPPYSYAQLIVQA++S+  +QLTL+GIY YISKHYPY+++ DKGWQNS+RHNLSLNRYF+KVPR Q++PGKGSFWR+D A E KL  QA+RKRR R   C
Sbjct:  196 DESKPPYSYAQLIVQAITSAASKQLTLSGIYAYISKHYPYYRASDKGWQNSIRHNLSLNRYFVKVPRSQEDPGKGSFWRIDPASEGKLAEQAYRKRRARGVPC 298          

HSP 2 Score: 92.0485 bits (227), Expect = 1.362e-19
Identity = 37/90 (41.11%), Postives = 55/90 (61.11%), Query Frame = 1
Query:  205 YFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLV 474
            Y ++   +T+GR+S+ G VD+D+G  +F+SR HLE+        ++CLGKNG+F+D  F+   A    LP  C LRFPST + +    LV
Sbjct:   11 YVVRKRTVTVGRDSSQGAVDVDMGRSSFISRVHLEIALEGPHFMLRCLGKNGVFVDGVFQRRGAAALRLPKTCVLRFPSTTIRLRFTSLV 100          
BLAST of Forkhead box protein vs. Ensembl Sea Lamprey
Match: foxk1 (forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6402])

HSP 1 Score: 173.326 bits (438), Expect = 3.458e-46
Identity = 73/103 (70.87%), Postives = 87/103 (84.47%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC 1455
            D  KPPYSYAQLIVQA++S+  +QLTL+GIY YISKHYPY+++ DKGWQNS+RHNLSLNRYF+KVPR Q++PGKGSFWR+D A E KL  QA+RKRR R   C
Sbjct:  196 DESKPPYSYAQLIVQAITSAASKQLTLSGIYAYISKHYPYYRASDKGWQNSIRHNLSLNRYFVKVPRSQEDPGKGSFWRIDPASEGKLAEQAYRKRRARGVPC 298          

HSP 2 Score: 92.0485 bits (227), Expect = 1.397e-19
Identity = 37/90 (41.11%), Postives = 55/90 (61.11%), Query Frame = 1
Query:  205 YFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLV 474
            Y ++   +T+GR+S+ G VD+D+G  +F+SR HLE+        ++CLGKNG+F+D  F+   A    LP  C LRFPST + +    LV
Sbjct:   11 YVVRKRTVTVGRDSSQGAVDVDMGRSSFISRVHLEIALEGPHFMLRCLGKNGVFVDGVFQRRGAAALRLPKTCVLRFPSTTIRLRFTSLV 100          
BLAST of Forkhead box protein vs. Ensembl Sea Lamprey
Match: foxf2a (forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-5])

HSP 1 Score: 108.997 bits (271), Expect = 4.709e-28
Identity = 48/109 (44.04%), Postives = 71/109 (65.14%), Query Frame = 1
Query: 1153 QKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKR----RLRSNNCGSIC 1467
            +KPP+SY  LIV A+ SS  +++TL+ IY ++   +P+F+   +GW+NSVRHNLSLN  F+K+P+G   PGKG +W +D A E      +FR+R    RL+S     +C
Sbjct:    5 EKPPFSYIALIVMAIQSSPAKRVTLSEIYQFLQGRFPFFRGAYQGWKNSVRHNLSLNECFVKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRLKSRQASPVC 113          
BLAST of Forkhead box protein vs. Ensembl Sea Lamprey
Match: foxg1a (forkhead box G1a [Source:ZFIN;Acc:ZDB-GENE-990415-267])

HSP 1 Score: 108.227 bits (269), Expect = 2.365e-27
Identity = 48/97 (49.48%), Postives = 70/97 (72.16%), Query Frame = 1
Query: 1156 KPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRS 1446
            KPP+SY  LI+ A+  S +++LTL+GIY YI  ++PY++ + +GWQNS+RHNLSLN+ F+KVPR  D+PGKG++W +D + +   I     K R RS
Sbjct:   32 KPPFSYNALIMMAIRQSPEKRLTLSGIYEYIMHNFPYYRQNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGRTGKLRRRS 128          
BLAST of Forkhead box protein vs. Ensembl Yeast
Match: FKH2 (Forkhead family transcription factor; rate-limiting activator of replication origins; evolutionarily conserved regulator of lifespan; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; positively regulates transcriptional elongation; facilitates clustering, activation of early-firing replication origins; negative role in chromatin silencing at HML and HMR; major role in expression of G2/M phase genes; relocalizes to cytosol under hypoxia [Source:SGD;Acc:S000005012])

HSP 1 Score: 101.679 bits (252), Expect = 1.599e-22
Identity = 44/86 (51.16%), Postives = 61/86 (70.93%), Query Frame = 1
Query: 1156 KPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLI 1413
            KPP+SYA +I QA+ SS +  ++L  IY YIS +Y Y++    GWQNS+RHNLSLN+ F KVPR  +EPGKG  WR+  +Y+ + +
Sbjct:  340 KPPHSYATMITQAILSSPEGVISLADIYKYISSNYAYYRFAKSGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRISESYQQEFL 425          
BLAST of Forkhead box protein vs. Ensembl Yeast
Match: HCM1 (Forkhead transcription factor; drives S-phase activation of genes involved in chromosome segregation, spindle dynamics, budding; also activates genes involved in respiration, use of alternative energy sources (like proline), NAD synthesis, oxidative stress resistance; key factor in early adaptation to nutrient deficiency and diauxic shift; suppressor of calmodulin mutants with specific SPB assembly defects; ortholog of C. elegans lifespan regulator PHA-4 [Source:SGD;Acc:S000000661])

HSP 1 Score: 98.2117 bits (243), Expect = 9.541e-22
Identity = 46/91 (50.55%), Postives = 59/91 (64.84%), Query Frame = 1
Query: 1141 GTDTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLI 1413
            G   +KPPYSYA LI  A+  S++ +LTL+ IY++I  H+PY+K  D  WQNS+RHNLSLN  FIK  +  D  GKG FW V    E+K  
Sbjct:  104 GELAKKPPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAFIKTEKSCD--GKGHFWEVRPGAETKFF 192          
BLAST of Forkhead box protein vs. Ensembl Yeast
Match: FKH1 (Forkhead family transcription factor; rate-limiting replication origin activator; evolutionarily conserved lifespan regulator; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; regulates transcription elongation, chromatin silencing at mating loci, expression of G2/M phase genes; facilitates clustering, activation of early-firing replication origins; binds HML recombination enhancer, regulates donor preference during mating-type switching [Source:SGD;Acc:S000001393])

HSP 1 Score: 83.1889 bits (204), Expect = 4.941e-17
Identity = 57/189 (30.16%), Postives = 91/189 (48.15%), Query Frame = 1
Query: 1156 KPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNCGSICS-ENIPSASRVFSLSSGRAGSLCAVSDRNAKLNNIFTLRRAGDQKAPTTYVFRKMSDTQ--QLTENVFGSAAKLISKQSDVNNSS 1713
            KPP SYA +I QA+ S+ +  ++L  IY +IS +Y +++     WQNSVRHNLSLN+ F KVP+   + GKG  W+         I+   R+  L   N G +       S +R   L   + G + A    +     I   +     +A ++ +       Q  QLT  +  + +  ++  ++VNNSS
Sbjct:  303 KPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWK---------ISDEVRRDFLNKWNAGKLSKIRRGASVTRQLQLHMSKFGEIPAPESSSIDPRGIKAQKVKKSLQATSSILGESAPQLQRTQLTGQISTTTSMDVTTNANVNNSS 482          
BLAST of Forkhead box protein vs. Ensembl Yeast
Match: FHL1 (Regulator of ribosomal protein (RP) transcription; has forkhead associated domain that binds phosphorylated proteins; recruits coactivator Ifh1p or corepressor Crf1p to RP gene promoters; also has forkhead DNA-binding domain though in vitro DNA binding assays give inconsistent results; computational analyses suggest it binds DNA directly at highly active RP genes and indirectly through Rap1p motifs at others; suppresses RNA pol III and splicing factor prp4 mutants [Source:SGD;Acc:S000006308])

HSP 1 Score: 72.7886 bits (177), Expect = 1.552e-13
Identity = 44/142 (30.99%), Postives = 75/142 (52.82%), Query Frame = 1
Query: 1024 IVLNARPYRSYSYKGEVIYTHNSQVFSSIYDSKDLAIEYGTDTQKPPYSYAQLIVQAVSS-SRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRS 1446
            I   A+P ++ +           ++   +Y  +++ +EY T   KP  SY+ ++   +   S  + ++L+ IY  I + +PY+K    GWQ+SVRHNLSLN+ F KV +     GKG  W +D  Y    IA+  R+++ +S
Sbjct:  420 ITTGAKPKKAQTKPAVKKEKKPPKIPKKVYTLEEIPVEYRT---KPTVSYSAMLTTCIRKYSTAKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLSLNKSFRKVSKE----GKGWLWGLDEEY----IAERERQKKKQS 550          

HSP 2 Score: 50.0618 bits (118), Expect = 1.554e-6
Identity = 24/75 (32.00%), Postives = 46/75 (61.33%), Query Frame = 1
Query:  172 YARITFGNENAYFMKTEKITIGRNSADG---TVDIDVGPHTFVSRKHLEMMYSY--KKLKIKCLGKNGIFIDNYF 381
            YAR+ F +   ++++T    IGR S +     VD+++GP   +SR+H ++ Y++   + ++  +GKNG F+D+ F
Sbjct:  283 YARLDFQS-FTFYVQTLHAIIGRRSENDFSHKVDVNLGPSKSISRRHAQIFYNFGTGRFELSIIGKNGAFVDDIF 356          
BLAST of Forkhead box protein vs. Ensembl Nematostella
Match: EDO36951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH30])

HSP 1 Score: 161.384 bits (407), Expect = 1.151e-46
Identity = 71/97 (73.20%), Postives = 85/97 (87.63%), Query Frame = 1
Query: 1156 KPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRS 1446
            KPPYSYAQLIVQA+ S+ D+QLTL+GIY +I+K+YPY+++ DKGWQNS+RHNLSLNRYF+KVPR QDEPGKGSFWR+D + E KL  QAFRKRR R 
Sbjct:    4 KPPYSYAQLIVQAILSATDKQLTLSGIYAHITKNYPYYRTADKGWQNSIRHNLSLNRYFVKVPRAQDEPGKGSFWRIDPSCEQKLAEQAFRKRRQRG 100          
BLAST of Forkhead box protein vs. Ensembl Nematostella
Match: EDO44876 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUL7])

HSP 1 Score: 113.62 bits (283), Expect = 5.350e-30
Identity = 47/94 (50.00%), Postives = 68/94 (72.34%), Query Frame = 1
Query: 1156 KPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRR 1437
            KPPYSYA LI  A+  ++  ++TL+ IY +I +++ +++  D  WQNS+RHNLSLN+ F+KVPR +DEPGKG FWR+D AY    +   F++RR
Sbjct:    1 KPPYSYATLICMAMRDTKRVKITLSAIYKWIKENFMFYRVADPTWQNSIRHNLSLNKCFVKVPRKKDEPGKGGFWRIDPAYADMFVDGVFKRRR 94          
BLAST of Forkhead box protein vs. Ensembl Nematostella
Match: EDO46828 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP00])

HSP 1 Score: 109.383 bits (272), Expect = 1.674e-28
Identity = 46/98 (46.94%), Postives = 73/98 (74.49%), Query Frame = 1
Query: 1153 QKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRS 1446
            +KP +SY  LI+ A+  S +++LTL+GIY YI K++PY++++ +GWQNS+RHNLSLN+ F+KVPR  D+PGKG++W +D + +  +I     K + R+
Sbjct:    1 EKPAFSYNALIMMAIRGSEEKRLTLSGIYEYIMKNFPYYRNNKQGWQNSIRHNLSLNKCFVKVPRNYDDPGKGNYWMLDPSADDVIIGGTTGKLKRRN 98          
BLAST of Forkhead box protein vs. Ensembl Nematostella
Match: EDO42654 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0W7])

HSP 1 Score: 108.227 bits (269), Expect = 4.961e-28
Identity = 43/82 (52.44%), Postives = 65/82 (79.27%), Query Frame = 1
Query: 1156 KPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYE 1401
            KPPYSY  LI  A+  S+ +++TL+GIY +I +++PY++ + +GWQNS+RHNLSLN+ F+K+PR + +PGKG +W +D AYE
Sbjct:    3 KPPYSYVALISMAIKQSKGQKITLSGIYQFIIENFPYYRLNKRGWQNSIRHNLSLNKCFVKIPRERSDPGKGCYWALDPAYE 84          
BLAST of Forkhead box protein vs. Ensembl Nematostella
Match: EDO35022 (Forkhead domain protein 1; Predicted protein [Source:UniProtKB/TrEMBL;Acc:Q3LUT2])

HSP 1 Score: 111.694 bits (278), Expect = 3.808e-27
Identity = 51/101 (50.50%), Postives = 68/101 (67.33%), Query Frame = 1
Query: 1138 YGTDTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDK-GWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRR 1437
            Y    QKPPYSY  LI  A+  S  R++TLNGIY++I+  +PY+   +K GWQNS+RHNLSLNR F+KV R + +PGKG +W +D AYE       + +RR
Sbjct:   55 YTPAPQKPPYSYVALISMAIKQSPGRKITLNGIYHFITSAFPYYTWQNKRGWQNSIRHNLSLNRCFVKVHREKADPGKGCYWTLDPAYEEMFEDGKYWRRR 155          
BLAST of Forkhead box protein vs. Ensembl Medaka
Match: foxk1 (forkhead box K1 [Source:NCBI gene;Acc:100301617])

HSP 1 Score: 177.563 bits (449), Expect = 2.910e-46
Identity = 78/119 (65.55%), Postives = 96/119 (80.67%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC-----GSICSENIPSA 1488
            D  KPPYSYAQLIVQA+SS+ D+QLTL+GIY +I+KHYPY+++ DKGWQNS+RHNLSLNRYF+KV R QDEPGKGSFWR+D A E+KL+ QAFRKRR R   C     G + S + P++
Sbjct:  288 DESKPPYSYAQLIVQAISSAPDKQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFLKVARSQDEPGKGSFWRLDSASETKLVEQAFRKRRQRGVACFRTPFGPLSSRSAPAS 406          

HSP 2 Score: 93.9745 bits (232), Expect = 2.511e-19
Identity = 39/91 (42.86%), Postives = 59/91 (64.84%), Query Frame = 1
Query:  190 GNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMY-SYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVN 459
            G +  + M+   +TIGRNS+ G+VDI++G  +F+SR+HL + Y       ++CLGKNG+F+D  F+   A P  LP EC  RFPST +++ 
Sbjct:   72 GRDFEFVMRQRTVTIGRNSSHGSVDINMGHSSFISRRHLLISYDEASGFSLRCLGKNGVFVDGVFQRRGAPPLSLPRECVFRFPSTVIKIQ 162          
BLAST of Forkhead box protein vs. Ensembl Medaka
Match: foxk1 (forkhead box K1 [Source:NCBI gene;Acc:100301617])

HSP 1 Score: 177.178 bits (448), Expect = 3.747e-46
Identity = 78/119 (65.55%), Postives = 96/119 (80.67%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC-----GSICSENIPSA 1488
            D  KPPYSYAQLIVQA+SS+ D+QLTL+GIY +I+KHYPY+++ DKGWQNS+RHNLSLNRYF+KV R QDEPGKGSFWR+D A E+KL+ QAFRKRR R   C     G + S + P++
Sbjct:  288 DESKPPYSYAQLIVQAISSAPDKQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFLKVARSQDEPGKGSFWRLDSASETKLVEQAFRKRRQRGVACFRTPFGPLSSRSAPAS 406          

HSP 2 Score: 93.9745 bits (232), Expect = 2.560e-19
Identity = 39/91 (42.86%), Postives = 59/91 (64.84%), Query Frame = 1
Query:  190 GNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMY-SYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVN 459
            G +  + M+   +TIGRNS+ G+VDI++G  +F+SR+HL + Y       ++CLGKNG+F+D  F+   A P  LP EC  RFPST +++ 
Sbjct:   72 GRDFEFVMRQRTVTIGRNSSHGSVDINMGHSSFISRRHLLISYDEASGFSLRCLGKNGVFVDGVFQRRGAPPLSLPRECVFRFPSTVIKIQ 162          
BLAST of Forkhead box protein vs. Ensembl Medaka
Match: si:ch211-262e15.1 (forkhead box protein K2 [Source:NCBI gene;Acc:101160321])

HSP 1 Score: 175.252 bits (443), Expect = 7.556e-46
Identity = 82/132 (62.12%), Postives = 101/132 (76.52%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNCGSICSENIPSASRVFSLSSGRAGSLCAVS 1542
            D  KPPYSYAQLIVQA++ + D+QLTLNGIYN+I+K+YPY+++ DKGWQNS+RHNLSLNRYFIKV R Q+EPGKGSFWR+D + E+KLI QAFRKRR R   C    + + P +SR    S   +G L A S
Sbjct:  215 DDSKPPYSYAQLIVQAITLAPDKQLTLNGIYNHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVARSQEEPGKGSFWRIDPSSEAKLIDQAFRKRRPRGVPC--FRTPHGPLSSRSAPASPNHSGVLSAHS 344          

HSP 2 Score: 98.2117 bits (243), Expect = 1.075e-20
Identity = 45/105 (42.86%), Postives = 64/105 (60.95%), Query Frame = 1
Query:  190 GNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMY------SYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQL-VGRK 483
            G E  Y MK   +TIGRNS+ G+VD+ +G  +F+SR+HLE+        +     ++CLGKNG+F+D  F    A P +LP  CT RFPSTN+++    L  G+K
Sbjct:   16 GREFEYMMKKRSVTIGRNSSQGSVDVSMGHSSFISRRHLEIFTTSDDGSASGDFYLRCLGKNGVFVDGVFLRRGAPPLQLPRMCTFRFPSTNIKITFTALSTGKK 120          
BLAST of Forkhead box protein vs. Ensembl Medaka
Match: ENSORLT00000016284.2 (forkhead box protein K2 [Source:NCBI gene;Acc:101160853])

HSP 1 Score: 174.096 bits (440), Expect = 1.394e-45
Identity = 77/119 (64.71%), Postives = 95/119 (79.83%), Query Frame = 1
Query: 1147 DTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC-----GSICSENIPSA 1488
            D  KPPYSYAQLIVQA++ + D+QLTLNGIY +I+K+YPY+++ DKGWQNS+RHNLSLNRYFIKV R Q+EPGKGSFWR+D A E+KLI QAFRKRR R   C     G + S + P++
Sbjct:  210 DDSKPPYSYAQLIVQAITMATDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVARSQEEPGKGSFWRIDPASEAKLIEQAFRKRRPRGVPCFRTPLGPLSSRSAPAS 328          

HSP 2 Score: 97.0561 bits (240), Expect = 2.362e-20
Identity = 45/111 (40.54%), Postives = 67/111 (60.36%), Query Frame = 1
Query:  190 GNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYK----KLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLVGRKSGKCNSMES 510
            G E  Y MK   +TIGRNS+ G+VD+ +G  +F+SR+HLE+  + +    +  ++CLGKNG+F+D  F+   A P +LP  C  RFPST++++    L   K    N  ES
Sbjct:   17 GREFEYLMKKRSVTIGRNSSQGSVDVSMGHSSFISRRHLEIFTAGEDGVGEFYLRCLGKNGVFVDGVFQRRGAPPLQLPRMCCFRFPSTSIKITFTALNSDKKEPRNVPES 127          
BLAST of Forkhead box protein vs. Ensembl Medaka
Match: foxk1 (forkhead box K1 [Source:NCBI gene;Acc:100301617])

HSP 1 Score: 159.844 bits (403), Expect = 6.244e-41
Identity = 72/119 (60.50%), Postives = 92/119 (77.31%), Query Frame = 1
Query: 1150 TQKPPYSY-AQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNC-----GSICSENIPSA 1488
            T  PP+ +   LIVQA+SS+ D+QLTL+GIY +I+KHYPY+++ DKGWQNS+RHNLSLNRYF+KV R QDEPGKGSFWR+D A E+KL+ QAFRKRR R   C     G + S + P++
Sbjct:  289 TTGPPFHFRPPLIVQAISSAPDKQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFLKVARSQDEPGKGSFWRLDSASETKLVEQAFRKRRQRGVACFRTPFGPLSSRSAPAS 407          

HSP 2 Score: 93.5893 bits (231), Expect = 2.501e-19
Identity = 39/91 (42.86%), Postives = 59/91 (64.84%), Query Frame = 1
Query:  190 GNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMY-SYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVN 459
            G +  + M+   +TIGRNS+ G+VDI++G  +F+SR+HL + Y       ++CLGKNG+F+D  F+   A P  LP EC  RFPST +++ 
Sbjct:   72 GRDFEFVMRQRTVTIGRNSSHGSVDINMGHSSFISRRHLLISYDEASGFSLRCLGKNGVFVDGVFQRRGAPPLSLPRECVFRFPSTVIKIQ 162          
BLAST of Forkhead box protein vs. Planmine SMEST
Match: SMESG000040645.1 (SMESG000040645.1)

HSP 1 Score: 1403.65 bits (3632), Expect = 0.000e+0
Identity = 829/832 (99.64%), Postives = 830/832 (99.76%), Query Frame = 1
Query:  103 MSVDFEDETLKSDSDIIYSDYIEYARITFGNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLVGRKSGKCNSMESDNDANDFIDTRTLVNSRKRKATQTINENFSYDIFESVNITNKEITINNFDVVPMRRPMEMKRDISDSNMKSDLDRTMTESVIHNESSTIXXXXXXXXXXXXXXFVTHHRKPMNSAPVISSGTCTTGLNPKLEQQIPXXXXXXXXXXXXXXXXXXXKKFQNVCIEKSNTIPQIVLNARPYRSYSYKGEVIYTHNSQVFSSIYDSKDLAIEYGTDTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNCGSICSENIPSASRVFSLSSGRAGSLCAVSDRNAKLNNIFTLRRAGDQKAPTTYVFRKMSDTQQLTENVFGSAAKLISKQSDVNNSSNTISPDXXXXXXXXXXXXXXXXXXXXXXXXXXXLGQKRIFQPPISMINKXXXXXXXXXXXXXXXXTIFSIGGKVFSTNKLKPIQLLSTKNSASFVSVKXXXXXXXXXXXTGNKYILISTXXXXXXXXXXXXXXXXXXXXXXXXTGSGTLNRHQEPDHHSDHQTRASNKPPRINPIILSDNQLEMAHHYKSQQPISPLSVSETCEFPLDEPSQLDSSSTELGPLSPGIKFTQSXXXXXXXXXXXXXXXXXXXSYSILDHSNDIDSPADLYKEAATEIDDYCVWQDECLGLQDVEIE 2598
            MSVDFEDETLKSDSDIIYSDYIEYARITFGNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLVGRKSGKCNSMESDNDANDFIDTRTLVNSRKRKATQTINENFSYDIFESVNITNKEITINNFDVVPMRRPMEMKRDISDSNMKSDLDRTMTESVIHNESSTINSSPNYNNHNNNSNFVTHHRKP+NSAPVISSGTCTTGLNPKLEQQIPSIINSSHNTTTQTSTISTNKKFQNVCIEKSNTIPQIVLNARPYRSYSYKGEVIYTHNSQVFSSIYDSKDLAIEYGTDTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNCGSICSENIPSASRVFSLSSGRAGSLCAVSDRNAKLNNIFTLRRAGDQKAPTTYVFRKMSD QQLTENVFGSAAKLISKQSDVNNSSN ISPDNVFHTNHNHNNINISVNSNSKSNTSSKLGQKRIFQPPISMINKPPPSNANGNGNANSNSTIFSIGGKVFSTNKLKPIQLLSTKNSASFVSVKQQSPQQQHHQQTGNKYILISTSQIDNQSSQNSHNNNIHSNQMISITGSGTLNRHQEPDHHSDHQTRASNKPPRINPIILSDNQLEMAHHYKSQQPISPLSVSETCEFPLDEPSQLDSSSTELGPLSPGIKFTQSLQQEDEDDDLDLEMDQFLDSYSILDHSNDIDSPADLYKEAATEIDDYCVWQDECLGLQDVEIE
Sbjct:    1 MSVDFEDETLKSDSDIIYSDYIEYARITFGNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLVGRKSGKCNSMESDNDANDFIDTRTLVNSRKRKATQTINENFSYDIFESVNITNKEITINNFDVVPMRRPMEMKRDISDSNMKSDLDRTMTESVIHNESSTINSSPNYNNHNNNSNFVTHHRKPVNSAPVISSGTCTTGLNPKLEQQIPSIINSSHNTTTQTSTISTNKKFQNVCIEKSNTIPQIVLNARPYRSYSYKGEVIYTHNSQVFSSIYDSKDLAIEYGTDTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNCGSICSENIPSASRVFSLSSGRAGSLCAVSDRNAKLNNIFTLRRAGDQKAPTTYVFRKMSDAQQLTENVFGSAAKLISKQSDVNNSSNAISPDNVFHTNHNHNNINISVNSNSKSNTSSKLGQKRIFQPPISMINKPPPSNANGNGNANSNSTIFSIGGKVFSTNKLKPIQLLSTKNSASFVSVKQQSPQQQHHQQTGNKYILISTSQIDNQSSQNSHNNNIHSNQMISITGSGTLNRHQEPDHHSDHQTRASNKPPRINPIILSDNQLEMAHHYKSQQPISPLSVSETCEFPLDEPSQLDSSSTELGPLSPGIKFTQSLQQEDEDDDLDLEMDQFLDSYSILDHSNDIDSPADLYKEAATEIDDYCVWQDECLGLQDVEIE 832          
BLAST of Forkhead box protein vs. Planmine SMEST
Match: SMESG000061695.1 (SMESG000061695.1)

HSP 1 Score: 247.284 bits (630), Expect = 1.260e-69
Identity = 124/199 (62.31%), Postives = 148/199 (74.37%), Query Frame = 1
Query: 1069 EVIYTHNSQVFSSIYDSKDLAIEYGTDTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNCGSICSENIPSASRVFSLSSGRAGSLCA------------VSDRNAKLNNIFTLRRAGD---QKAPTTYVF 1620
            E  YT+N Q+  ++ DS DL IE+G+DTQKPPYSYAQLIVQAVS++RDRQLTLNGIYNYISK+YPYFK+HDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVD AYE+KLIAQAFRKRRLR+N  G +  + +   S+V ++S+  A S  +            ++ R     N+ TL+RA D   Q   TTYV 
Sbjct:  285 EQYYTNNGQI--TVLDSDDLTIEHGSDTQKPPYSYAQLIVQAVSTARDRQLTLNGIYNYISKNYPYFKAHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDPAYENKLIAQAFRKRRLRNNASGIVNEDGL--VSQVLNVSNIDANSQVSNAKVFGINKSGQIASRTPNFGNVITLKRACDINTQNGGTTYVL 479          

HSP 2 Score: 163.696 bits (413), Expect = 2.468e-41
Identity = 75/106 (70.75%), Postives = 89/106 (83.96%), Query Frame = 1
Query:  169 EYARITFGNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLVGRKS 486
            +YARITF  +  Y M+ E++ IGRNSA G+VDIDVG  TFVSRKHLE+ YSY+KLK+KCLGKNGIFIDN FK+HS IPYELP +CTLRFPST+V+  V+QLVG KS
Sbjct:   18 QYARITFFGQVPYIMQKERVIIGRNSAAGSVDIDVGAVTFVSRKHLELTYSYQKLKVKCLGKNGIFIDNIFKSHSFIPYELPSKCTLRFPSTDVQFCVEQLVGIKS 123          
BLAST of Forkhead box protein vs. Planmine SMEST
Match: SMESG000061695.1 (SMESG000061695.1)

HSP 1 Score: 246.514 bits (628), Expect = 2.336e-69
Identity = 124/198 (62.63%), Postives = 148/198 (74.75%), Query Frame = 1
Query: 1069 EVIYTHNSQVFSSIYDSKDLAIEYGTDTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNCGSICSENIPSASRVFSLSSGRAGSLCA------------VSDRNAKLNNIFTLRRAGD---QKAPTTYV 1617
            E  YT+N Q+  ++ DS DL IE+G+DTQKPPYSYAQLIVQAVS++RDRQLTLNGIYNYISK+YPYFK+HDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVD AYE+KLIAQAFRKRRLR+N  G +  + +   S+V ++S+  A S  +            ++ R     N+ TL+RA D   Q   TTYV
Sbjct:  268 EQYYTNNGQI--TVLDSDDLTIEHGSDTQKPPYSYAQLIVQAVSTARDRQLTLNGIYNYISKNYPYFKAHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDPAYENKLIAQAFRKRRLRNNASGIVNEDGL--VSQVLNVSNIDANSQVSNAKVFGINKSGQIASRTPNFGNVITLKRACDINTQNGGTTYV 461          

HSP 2 Score: 135.576 bits (340), Expect = 2.385e-32
Identity = 67/106 (63.21%), Postives = 77/106 (72.64%), Query Frame = 1
Query:  169 EYARITFGNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLVGRKS 486
            +YARITF                   A G+VDIDVG  TFVSRKHLE+ YSY+KLK+KCLGKNGIFIDN FK+HS IPYELP +CTLRFPST+V+  V+QLVG KS
Sbjct:   18 QYARITFF-----------------GAAGSVDIDVGAVTFVSRKHLELTYSYQKLKVKCLGKNGIFIDNIFKSHSFIPYELPSKCTLRFPSTDVQFCVEQLVGIKS 106          
BLAST of Forkhead box protein vs. Planmine SMEST
Match: SMESG000061695.1 (SMESG000061695.1)

HSP 1 Score: 246.514 bits (628), Expect = 2.616e-69
Identity = 124/198 (62.63%), Postives = 148/198 (74.75%), Query Frame = 1
Query: 1069 EVIYTHNSQVFSSIYDSKDLAIEYGTDTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNNCGSICSENIPSASRVFSLSSGRAGSLCA------------VSDRNAKLNNIFTLRRAGD---QKAPTTYV 1617
            E  YT+N Q+  ++ DS DL IE+G+DTQKPPYSYAQLIVQAVS++RDRQLTLNGIYNYISK+YPYFK+HDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVD AYE+KLIAQAFRKRRLR+N  G +  + +   S+V ++S+  A S  +            ++ R     N+ TL+RA D   Q   TTYV
Sbjct:  285 EQYYTNNGQI--TVLDSDDLTIEHGSDTQKPPYSYAQLIVQAVSTARDRQLTLNGIYNYISKNYPYFKAHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDPAYENKLIAQAFRKRRLRNNASGIVNEDGL--VSQVLNVSNIDANSQVSNAKVFGINKSGQIASRTPNFGNVITLKRACDINTQNGGTTYV 478          

HSP 2 Score: 163.696 bits (413), Expect = 2.885e-41
Identity = 75/106 (70.75%), Postives = 89/106 (83.96%), Query Frame = 1
Query:  169 EYARITFGNENAYFMKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVKQLVGRKS 486
            +YARITF  +  Y M+ E++ IGRNSA G+VDIDVG  TFVSRKHLE+ YSY+KLK+KCLGKNGIFIDN FK+HS IPYELP +CTLRFPST+V+  V+QLVG KS
Sbjct:   18 QYARITFFGQVPYIMQKERVIIGRNSAAGSVDIDVGAVTFVSRKHLELTYSYQKLKVKCLGKNGIFIDNIFKSHSFIPYELPSKCTLRFPSTDVQFCVEQLVGIKS 123          
BLAST of Forkhead box protein vs. Planmine SMEST
Match: SMESG000064173.1 (SMESG000064173.1)

HSP 1 Score: 146.747 bits (369), Expect = 2.573e-38
Identity = 61/101 (60.40%), Postives = 83/101 (82.18%), Query Frame = 1
Query: 1141 GTDTQKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSVRHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLR 1443
            GT+T KPPYSYAQLI+QA+ S   +Q+TL+ IY YISK++PY+K + KGWQNS+RHNLSLNRYFI++PR  +  GK +FW++D + E++LI QAF KRR++
Sbjct:  155 GTETIKPPYSYAQLIIQAIISEESQQMTLSEIYRYISKNFPYYKMNQKGWQNSIRHNLSLNRYFIRIPRSHNNCGKSAFWKLDKSQEAQLIKQAFWKRRMK 255          

HSP 2 Score: 67.3958 bits (163), Expect = 1.401e-11
Identity = 32/85 (37.65%), Postives = 51/85 (60.00%), Query Frame = 1
Query:  211 MKTEKITIGRNSADGTVDIDVGPHTFVSRKHLEMMYSYKKLKIKCLGKNGIFIDNYFKAHSAIPYELPYECTLRFPSTNVEVNVK 465
            MK     IGR+     VD+ +     +SR HL+++ +  +L +KC GKNGIFI+  F+ ++     LP   T+RFPSTN+E+ ++
Sbjct:    1 MKNNTCVIGRD-VSSKVDLTITSSPCISRMHLKLIANDNRLFLKCFGKNGIFINESFQVYTLDEVPLPALSTIRFPSTNIELQIE 84          
The following BLAST results are available for this feature:
BLAST of Forkhead box protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXK23.090e-4973.79forkhead box K2 [Source:HGNC Symbol;Acc:HGNC:6036][more]
FOXK23.093e-4966.39forkhead box K2 [Source:HGNC Symbol;Acc:HGNC:6036][more]
FOXK14.362e-4963.16forkhead box K1 [Source:HGNC Symbol;Acc:HGNC:23480... [more]
FOXK26.987e-4764.39forkhead box K2 [Source:HGNC Symbol;Acc:HGNC:6036][more]
FOXK29.984e-4764.39forkhead box K2 [Source:HGNC Symbol;Acc:HGNC:6036][more]
back to top
BLAST of Forkhead box protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkh-25.015e-2750.52ForKHead transcription factor family [Source:UniP... [more]
lin-313.685e-2252.50pep chromosome:WBcel235:II:3982549:3986944:1 gene:... [more]
fkh-23.765e-2246.15ForKHead transcription factor family [Source:UniP... [more]
fkh-23.765e-2246.15ForKHead transcription factor family [Source:UniP... [more]
pha-42.311e-2153.57Defective pharyngeal development protein 4 [Sourc... [more]
back to top
BLAST of Forkhead box protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FoxK1.543e-3869.00gene:FBgn0036134 transcript:FBtr0332653[more]
FoxK1.553e-3869.00gene:FBgn0036134 transcript:FBtr0300783[more]
FoxK1.553e-3869.00gene:FBgn0036134 transcript:FBtr0300784[more]
FoxK1.553e-3869.00gene:FBgn0036134 transcript:FBtr0300786[more]
FoxK1.553e-3869.00gene:FBgn0036134 transcript:FBtr0300785[more]
back to top
BLAST of Forkhead box protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxk12.187e-4867.23forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6... [more]
FOXK25.849e-4663.87si:ch211-262e15.1 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
foxk22.060e-4446.73forkhead box K2 [Source:ZFIN;Acc:ZDB-GENE-030131-2... [more]
foxj1a9.437e-3054.74forkhead box J1a [Source:NCBI gene;Acc:767737][more]
foxj1a9.437e-3054.74forkhead box J1a [Source:NCBI gene;Acc:767737][more]
back to top
BLAST of Forkhead box protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxk24.565e-4858.78forkhead box K2 [Source:NCBI gene;Acc:100216193][more]
foxk24.195e-4758.78forkhead box K2 [Source:NCBI gene;Acc:100216193][more]
foxk21.143e-4658.78forkhead box K2 [Source:NCBI gene;Acc:100216193][more]
prss22.316e-2947.22serine protease 2 [Source:Xenbase;Acc:XB-GENE-6065... [more]
foxj14.295e-2952.88forkhead box J1 [Source:NCBI gene;Acc:496834][more]
back to top
BLAST of Forkhead box protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Foxk17.178e-4963.16forkhead box K1 [Source:MGI Symbol;Acc:MGI:1347488... [more]
Foxk28.400e-4763.64forkhead box K2 [Source:MGI Symbol;Acc:MGI:1916087... [more]
Foxj11.605e-3153.85forkhead box J1 [Source:MGI Symbol;Acc:MGI:1347474... [more]
Foxg19.820e-2750.00forkhead box G1 [Source:MGI Symbol;Acc:MGI:1347464... [more]
Foxg19.820e-2750.00forkhead box G1 [Source:MGI Symbol;Acc:MGI:1347464... [more]
back to top
BLAST of Forkhead box protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P85037|FOXK1_HUMAN2.095e-4863.16Forkhead box protein K1 OS=Homo sapiens OX=9606 GN... [more]
sp|P42128|FOXK1_MOUSE5.021e-4863.16Forkhead box protein K1 OS=Mus musculus OX=10090 G... [more]
sp|Q01167|FOXK2_HUMAN3.355e-4664.39Forkhead box protein K2 OS=Homo sapiens OX=9606 GN... [more]
sp|Q7ZX03|FOXK2_XENLA3.468e-4663.85Forkhead box protein K2 OS=Xenopus laevis OX=8355 ... [more]
sp|Q3UCQ1|FOXK2_MOUSE5.876e-4663.64Forkhead box protein K2 OS=Mus musculus OX=10090 G... [more]
back to top
BLAST of Forkhead box protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B3KV395.200e-4863.16cDNA FLJ16099 fis, clone TESTI2008278, highly simi... [more]
A0A4U1ETS37.764e-4863.16Fork-head domain-containing protein (Fragment) OS=... [more]
A0A5J5MRY42.002e-4763.16Fork-head domain-containing protein (Fragment) OS=... [more]
M1ER362.028e-4763.16Forkhead box K1 (Fragment) OS=Mustela putorius fur... [more]
A0A3L7HQR42.834e-4763.16FOXK1 (Fragment) OS=Cricetulus griseus OX=10029 GN... [more]
back to top
BLAST of Forkhead box protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxk12.032e-4867.23forkhead box K1 [Source:NCBI gene;Acc:103029597][more]
foxk26.689e-4664.71forkhead box K2 [Source:ZFIN;Acc:ZDB-GENE-030131-2... [more]
ENSAMXT00000049290.17.898e-3051.46forkhead box J1 [Source:NCBI gene;Acc:103028087][more]
ENSAMXT00000057506.11.164e-2851.02pep primary_assembly:Astyanax_mexicanus-2.0:21:201... [more]
foxg1b2.166e-2850.00forkhead box G1b [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
back to top
BLAST of Forkhead box protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxk12.418e-4870.87forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6... [more]
foxk13.166e-4670.87forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6... [more]
foxk13.458e-4670.87forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6... [more]
foxf2a4.709e-2844.04forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-... [more]
foxg1a2.365e-2749.48forkhead box G1a [Source:ZFIN;Acc:ZDB-GENE-990415-... [more]
back to top
BLAST of Forkhead box protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
FKH21.599e-2251.16Forkhead family transcription factor; rate-limitin... [more]
HCM19.541e-2250.55Forkhead transcription factor; drives S-phase acti... [more]
FKH14.941e-1730.16Forkhead family transcription factor; rate-limitin... [more]
FHL11.552e-1330.99Regulator of ribosomal protein (RP) transcription;... [more]
back to top
BLAST of Forkhead box protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO369511.151e-4673.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448765.350e-3050.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468281.674e-2846.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426544.961e-2852.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350223.808e-2750.50Forkhead domain protein 1; Predicted protein [Sou... [more]
back to top
BLAST of Forkhead box protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxk12.910e-4665.55forkhead box K1 [Source:NCBI gene;Acc:100301617][more]
foxk13.747e-4665.55forkhead box K1 [Source:NCBI gene;Acc:100301617][more]
si:ch211-262e15.17.556e-4662.12forkhead box protein K2 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000016284.21.394e-4564.71forkhead box protein K2 [Source:NCBI gene;Acc:1011... [more]
foxk16.244e-4160.50forkhead box K1 [Source:NCBI gene;Acc:100301617][more]
back to top
BLAST of Forkhead box protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040645.10.000e+099.64SMESG000040645.1[more]
SMESG000061695.11.260e-6962.31SMESG000061695.1[more]
SMESG000061695.12.336e-6962.63SMESG000061695.1[more]
SMESG000061695.12.616e-6962.63SMESG000061695.1[more]
SMESG000064173.12.573e-3860.40SMESG000064173.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004053 ID=SMED30004053|Name=Forkhead box protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2651bp
ATAATATTTCGTAAACATATTGGTAAACATTCATTGTTTACCAACATCAA
ACTGTAAATAACAAGTAAACAAAACAAATATATAATCAAAGCAGAATAAA
ATATGTCTGTGGATTTTGAAGATGAAACTTTGAAATCAGATTCAGATATC
ATTTATTCTGATTATATTGAATACGCAAGAATAACATTTGGAAATGAAAA
TGCATATTTTATGAAAACCGAAAAAATCACCATCGGTAGAAATAGTGCAG
ATGGAACGGTAGATATTGATGTTGGTCCTCACACATTTGTTTCACGCAAA
CATTTGGAAATGATGTATTCATATAAGAAATTAAAAATTAAATGCTTGGG
AAAGAATGGAATTTTTATCGATAACTATTTTAAAGCTCATTCTGCAATTC
CCTACGAACTTCCTTATGAGTGTACTCTGCGATTTCCCAGTACAAACGTT
GAAGTGAATGTTAAACAACTTGTCGGTAGAAAGTCAGGCAAATGTAATTC
TATGGAATCTGATAATGACGCGAATGATTTTATCGATACCCGAACATTAG
TAAACAGCCGCAAGAGAAAAGCAACACAAACAATCAACGAAAACTTTAGT
TACGATATATTTGAAAGTGTGAATATCACAAATAAGGAAATTACAATAAA
TAATTTCGATGTCGTCCCGATGCGAAGGCCGATGGAAATGAAAAGAGACA
TAAGTGACAGCAACATGAAATCAGATCTCGATCGGACAATGACTGAGTCG
GTAATCCACAATGAAAGCAGCACCATCAACAGCAGCCCGAATTATAACAA
TCACAATAATAATAGTAACTTCGTCACGCATCATCGGAAACCTATGAATT
CCGCCCCAGTCATATCATCTGGTACCTGCACAACAGGACTGAATCCGAAA
CTCGAACAGCAGATTCCATCAATAATCAACAGCAGTCACAATACGACAAC
GCAAACATCAACGATATCAACGAATAAGAAATTCCAAAATGTTTGCATCG
AGAAATCCAATACAATTCCACAAATCGTTCTTAACGCGCGCCCATATCGG
TCATATTCATACAAAGGTGAAGTGATTTACACTCACAATTCTCAGGTATT
CAGCTCGATATACGACTCGAAGGACCTGGCCATTGAGTACGGGACAGACA
CTCAGAAACCTCCGTATTCATACGCCCAGCTGATTGTACAAGCTGTCAGC
TCGTCCCGGGACAGACAGCTGACCCTGAATGGCATATACAATTACATCAG
CAAGCATTATCCCTATTTCAAATCACACGATAAAGGATGGCAAAATTCCG
TTCGTCACAACTTGTCGCTGAACCGCTACTTTATCAAGGTTCCTAGAGGC
CAGGATGAGCCTGGCAAAGGTTCCTTTTGGCGTGTTGACGGTGCCTACGA
GAGCAAATTGATCGCACAAGCGTTCAGAAAGCGGCGATTACGCAGCAACA
ATTGCGGTAGCATCTGTAGTGAAAACATTCCCAGCGCTTCCAGAGTATTC
AGCCTCAGCAGTGGGCGAGCAGGCAGTCTTTGTGCAGTTTCTGATCGGAA
TGCCAAATTGAATAACATTTTCACGCTGAGGAGAGCTGGTGATCAGAAGG
CGCCCACGACATACGTGTTTAGAAAGATGAGCGATACTCAACAATTGACA
GAAAATGTTTTCGGATCAGCAGCCAAGCTGATTAGCAAGCAATCAGATGT
CAATAATTCTAGCAACACAATTTCTCCCGACAATGTCTTTCATACCAATC
ACAATCACAATAATATCAATATCAGTGTCAACAGCAACAGCAAGTCCAAC
ACAAGCTCGAAACTTGGACAGAAACGCATTTTCCAGCCGCCAATCAGCAT
GATCAACAAGCCGCCACCTTCCAATGCCAACGGCAACGGCAATGCCAATA
GCAACAGCACGATATTCAGCATCGGTGGCAAAGTCTTCTCAACGAATAAA
TTGAAACCTATACAGCTACTTTCAACCAAGAATTCCGCCTCATTTGTATC
AGTAAAGCAGCAGTCTCCACAGCAACAGCACCATCAGCAAACCGGAAACA
AATATATCCTCATTTCCACATCCCAAATCGACAATCAAAGTTCCCAAAAC
AGCCACAATAACAATATCCACAGCAACCAAATGATCAGTATTACCGGTTC
CGGCACCCTAAACCGTCACCAGGAACCAGATCACCATAGTGACCATCAAA
CTCGGGCATCAAATAAGCCCCCCCGCATCAATCCGATCATCCTATCAGAT
AATCAACTGGAAATGGCTCATCATTACAAGTCCCAGCAACCGATCTCACC
ATTGAGCGTATCAGAAACATGTGAATTTCCGCTCGATGAACCGAGCCAGC
TCGATTCCAGTTCCACGGAGCTTGGGCCCCTCTCGCCTGGCATTAAGTTC
ACTCAGTCCTTGCAACAGGAGGACGAAGACGATGACCTTGATCTGGAAAT
GGATCAATTTCTCGACTCATACTCGATCCTTGACCATTCCAACGATATCG
ATTCTCCCGCTGACCTTTACAAGGAGGCCGCTACAGAAATTGATGATTAT
TGCGTGTGGCAAGATGAATGCCTGGGCCTGCAGGACGTCGAGATTGAGAT
CCATTGAGCTTGATTCATTCATTACACATATATATATATATATATATATG
T
back to top

protein sequence of SMED30004053-orf-1

>SMED30004053-orf-1 ID=SMED30004053-orf-1|Name=SMED30004053-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=835bp
MSVDFEDETLKSDSDIIYSDYIEYARITFGNENAYFMKTEKITIGRNSAD
GTVDIDVGPHTFVSRKHLEMMYSYKKLKIKCLGKNGIFIDNYFKAHSAIP
YELPYECTLRFPSTNVEVNVKQLVGRKSGKCNSMESDNDANDFIDTRTLV
NSRKRKATQTINENFSYDIFESVNITNKEITINNFDVVPMRRPMEMKRDI
SDSNMKSDLDRTMTESVIHNESSTINSSPNYNNHNNNSNFVTHHRKPMNS
APVISSGTCTTGLNPKLEQQIPSIINSSHNTTTQTSTISTNKKFQNVCIE
KSNTIPQIVLNARPYRSYSYKGEVIYTHNSQVFSSIYDSKDLAIEYGTDT
QKPPYSYAQLIVQAVSSSRDRQLTLNGIYNYISKHYPYFKSHDKGWQNSV
RHNLSLNRYFIKVPRGQDEPGKGSFWRVDGAYESKLIAQAFRKRRLRSNN
CGSICSENIPSASRVFSLSSGRAGSLCAVSDRNAKLNNIFTLRRAGDQKA
PTTYVFRKMSDTQQLTENVFGSAAKLISKQSDVNNSSNTISPDNVFHTNH
NHNNINISVNSNSKSNTSSKLGQKRIFQPPISMINKPPPSNANGNGNANS
NSTIFSIGGKVFSTNKLKPIQLLSTKNSASFVSVKQQSPQQQHHQQTGNK
YILISTSQIDNQSSQNSHNNNIHSNQMISITGSGTLNRHQEPDHHSDHQT
RASNKPPRINPIILSDNQLEMAHHYKSQQPISPLSVSETCEFPLDEPSQL
DSSSTELGPLSPGIKFTQSLQQEDEDDDLDLEMDQFLDSYSILDHSNDID
SPADLYKEAATEIDDYCVWQDECLGLQDVEIEIH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR001766Fork_head_dom
IPR000253FHA_dom
IPR011991WHTH_DNA-bd_dom
IPR030456TF_fork_head_CS_2
IPR008984SMAD_FHA_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
GO:0005515protein binding
GO:0000977RNA polymerase II regulatory region sequence-specific DNA binding
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0007275multicellular organism development
GO:0007517muscle organ development
GO:0016579protein deubiquitination
GO:0030154cell differentiation
GO:0045892negative regulation of transcription, DNA-templated
GO:0045893positive regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001766Fork head domainPRINTSPR00053FORKHEADcoord: 396..413
score: 71.47
coord: 352..365
score: 59.86
coord: 373..390
score: 45.68
IPR001766Fork head domainSMARTSM00339forkneu4coord: 350..441
e-value: 4.2E-47
score: 172.5
IPR001766Fork head domainPFAMPF00250Forkheadcoord: 351..436
e-value: 5.6E-38
score: 129.1
IPR001766Fork head domainPROSITEPS50039FORK_HEAD_3coord: 352..447
score: 32.88
IPR001766Fork head domainCDDcd00059FHcoord: 352..429
e-value: 4.44059E-41
score: 142.693
IPR000253Forkhead-associated (FHA) domainSMARTSM00240FHA_2coord: 41..94
e-value: 3.2E-4
score: 30.0
IPR000253Forkhead-associated (FHA) domainPROSITEPS50006FHA_DOMAINcoord: 42..94
score: 12.31
IPR000253Forkhead-associated (FHA) domainCDDcd00060FHAcoord: 42..121
e-value: 2.85217E-5
score: 41.603
NoneNo IPR availableGENE3DG3DSA:2.60.200.20coord: 25..124
e-value: 2.4E-5
score: 26.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 688..702
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 687..708
NoneNo IPR availablePANTHERPTHR45881FAMILY NOT NAMEDcoord: 23..707
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 340..447
e-value: 8.2E-42
score: 143.4
IPR030456Fork head domain conserved site 2PROSITEPS00658FORK_HEAD_2coord: 396..402
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 351..445
IPR008984SMAD/FHA domain superfamilySUPERFAMILYSSF49879SMAD/FHA domaincoord: 35..119