dynein heavy chain 3, axonemal

Overview
Namedynein heavy chain 3, axonemal
Smed IDSMED30004042
Length (bp)12741
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of dynein heavy chain 3, axonemal (SMED30004042) t-SNE clustered cells

Violin plots show distribution of expression levels for dynein heavy chain 3, axonemal (SMED30004042) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of dynein heavy chain 3, axonemal (SMED30004042) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for dynein heavy chain 3, axonemal (SMED30004042) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004042

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 26

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30004042SMESG000013737.1 SmedASXL_023853SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30004042SMESG000013737.1 SmedASXL_000554SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30004042SMESG000013737.1 SmedASXL_000536SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30004042SMESG000013738.1 SMESG000013737.1 SmedASXL_017312SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30004042SMESG000013737.1 SmedASXL_000585SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30004042SMESG000013737.1 SmedASXL_019608SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30004042SMESG000013737.1 SmedASXL_019238SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30004042SMESG000013738.1 SMESG000013737.1 dd_Smed_v4_9009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004042SMESG000013738.1 SMESG000013737.1 dd_Smed_v4_9009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004042SMESG000013738.1 SMESG000013737.1 dd_Smed_v4_9009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004042SMESG000013738.1 SMESG000013737.1 dd_Smed_v4_9009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30004042SMESG000013738.1 SMESG000013737.1 dd_Smed_v4_9009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30004042SMESG000013738.1 SMESG000013737.1 dd_Smed_v4_9009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30004042SMESG000013738.1 SMESG000013737.1 dd_Smed_v4_9009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004042SMESG000013738.1 SMESG000013737.1 dd_Smed_v4_9009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004042SMESG000013738.1 SMESG000040932.1 SMESG000029286.1 SMESG000027381.1 SMESG000018320.1 SMESG000013737.1 SMESG000079557.1 SMESG000073618.1 SMESG000050300.1 SMESG000017256.1 Contig12573uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004042SMESG000013738.1 SMESG000040932.1 SMESG000029286.1 SMESG000027381.1 SMESG000018320.1 SMESG000013737.1 SMESG000079557.1 SMESG000073618.1 SMESG000050300.1 SMESG000017256.1 Contig12573newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30004042SMESG000013737.1 SMESG000013731.1 dd_Smed_v4_23484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004042SMESG000013737.1 SMESG000013731.1 dd_Smed_v4_23484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004042SMESG000013737.1 SMESG000013731.1 dd_Smed_v4_23484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30004042SMESG000013737.1 SMESG000013731.1 dd_Smed_v4_23484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30004042SMESG000013737.1 SMESG000013731.1 dd_Smed_v4_23484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30004042SMESG000013738.1 SMESG000013737.1 dd_Smed_v6_9009_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30004042SMESG000013737.1 SMESG000013731.1 dd_Smed_v6_23484_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30004042SMESG000013738.1 SMESG000013737.1 dd_Smed_v6_9009_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004042SMESG000013738.1 SMESG000013737.1 dd_Smed_v4_9009_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Human
Match: DNAH3 (dynein axonemal heavy chain 3 [Source:HGNC Symbol;Acc:HGNC:2949])

HSP 1 Score: 3705.22 bits (9607), Expect = 0.000e+0
Identity = 1986/3952 (50.25%), Postives = 2691/3952 (68.09%), Query Frame = 3
Query:  771 KFMASQNLTEKYPDVTNQFLIDTKQN-FQTSVKKAILDYILLNKLEQKRLGL-MMPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLI-SIENICESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLI-FVPSFDR----ICDQLCQIIDNIIG-----------SVSQFSRLENVLFIKVEGTPSLP-------------FILSMLNYEEFVISN--KEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLN--DAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIEN-SVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSF-GAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSG--KLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRI--MECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            K +++  LT  + +     L+  K+N +  S+ K+I+DYIL++ +E+KRL +  +P      V+R  +PWHS    +K++ ++  +  +  +++L   +  ++ +LR + + E +    PL   +  ++ +++  +  Q L N W+  C ++  S  +      P+S  +  R +E +F  VA+  S  LR +V  S+ + V     ++D   ++  Y          +  ++ I L      S P+I F PSFD     I D   +II N  G           S +  +     +     G PS+               +L  +N EE ++S+   +  + + K N   P KY  +Y  +  LL+ T E +   F+  +  + D+  ++  +K   +E AS+   +P+ +F LD   +N  L +R++ L+   +    + +R  N SIC QY  I  ++++    T +LV L E+++K     +  L+ +L  A+  + FL++Y  LP               +I  I D+S   L  +R++A   L K   +F   L G   +++ F +R  +   +   N ++L+++++ LN    E + IN+EE LL     T Y  LQ +L  K P+++LW +A  F    ++WMNGP+  ++AE++  E  ++W+T Y+L K  S  +   P R A  +K K++KFK  +PI+   CNPG+K RHW  +S  VG++I P   T LS+ML  G  K +E L  + + ASKE+SLEK   RM+ DW  + FSF  Y++T  NILC +DDIQ+LL+DH++KT TM  SPFI P E+E   W++ L R++D L++WLK QA WLYLEPIF S DI  Q+P EG +F IVD  W+++M++   D++++       + E LQ +  LLE IQKGLNDYLEKKRL+FPRFFFLSN+ELLEILSETKDPLRVQPHLKKCFEGI+KL+FT+   I GM+S+E E V F   I+P  A+G+VEKW+ QVE  M  S+REV+   +  Y ++ R  WV  WPGQVV+  S++ WT++ + A+  +TL +FLKK++ QI+ IV+LVR + L S  R+TL A  V+DVHARDVVAKL    VS  +DF WISQ+RYYW  +        ++ ++++TTE  YGYEYLGN+ RLVITPLTDRCYRTLMGA+KLNLGGAPEGPAGTGKTET+KDLAKA+AKQCVVFNCSDGLDYK+MGKFFKGLAQ+GAWACFDEFNRIE+EVLSV+AQQI +IQ+AI  +L+ F+FEGTEL L+ +C +FITMNPGYAGR+ELPDNLK LFRTVAMMVPDYALI EISLYSMGF+++R+LA KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     E  ++L++++DVNL KFL  D+PLF GIISDLFPGV  P  DY+   ++L + ++ MKL+PVPWF+ KIIQIYEM+LVRHG MIVG    GKT A+K L+ ALGDL+    +E  +V + IINPKAI++G LYG FD VSHEW DG+LA  FRE ASS SD+RKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQM +K ++IFEP DLEQASPATVSRCGMIYMEP QLG  PL   ++   LP  L  E +  V  +F WL+ P L+F    CK  V+   + L  +M++LYSSLLD++R V ++  +  +    +                          +L   F  SL+W+  G I     K     F   +  M D+    +PRPK++K  +N + P++G+I+D  F+K+  G W TW   I K + +++    ++  ++IPT++T RQ FFL   L +   P++FVG TGTGKSA+   F+L  LP   +L + + FSA+TS++Q QD   SKLDRRR+GL+ PP  K  VVF+DD++MP KE YGAQPP+E+LRQ IDH +WFD+KD T L I D+L+ +AM  P   R  +T R  RH NII+I+ F+D+ +  IF  I+DWHF  GF++   R  K++V AT  I++  + +FLPTP+KSHYVFNLRDFSRVIQG LL     L+++       K IRLW+HE YRVF+DRLI  ED  +FF ++K+     FK+    +    S   K   +  +R L FGD+ K + D                K+Y+EITD + L   M+ YL+E+N +SKAPM LV+FRFAIEHI+RICR+L+Q  GH LLVGIGGSGRQSAAKL+TF+  +E++QIE+T+ Y+ +DWR+D+++++   G     T FLF D+QIK+  F+EDINMLLN+GD+PN+F  +++ +I+EKMQ   + Q  ++E+T ++MYN FIERV   +   L  SPIGDAF +RLR FPSLINCCTI+WFQ WP DAL++VANK L++VE+  ++R ++V MC++F +SV  LS  +Y  + R NYVTPTSYLELI TF  LLN K+ E+   + RY  GL+KL+F+ +Q+++MQ EL A QPQLI TS+ET K++  IE ET E +  + +V+ +E    V A  A+ IK++CE +LAEAMP + AA+ ALDTL   DIS+VK+MQNPP  VKLVME++CI+KG+KPE+K DPSG  K++EDYW  +KK+LGDLKFL+ LK+YDKD IP   M++IR ++IN+P F P  IKN+SSACEGLC WVRA+EVYDR+ KVV+PK+E+L  AE     QM +L  K+ EL  V  +L  L ++F+    +K DLE NIE+   K+ RAEKLI+GLGGEK RW +    L IR+ N+ GDVLL +G VAYLG FT+ YR +C   W  ECK   IP    S FSLS  LGDP+++R WQI GLPVDSFS+DN +IV+++ RW+L+IDP GQANKWIK +E + NKL VIK SD  Y+R+LEN LQ GTP L+EN+GEELD+ +E +LLK TFKQ  VEY+RLG++++EYS+DF+ YITTRLRNPHYLPE +VKV L+NFMITP GL+DQ+LGIV AKEKPELE+++ QLI+ESA N++ LKEIED+IL++LS SKGNILEDE AI++LSSSKVLSE+IS KQ+ A+ TE +I+  R GYKPVA H + +FF ISDLA+++PMYQYSL+WFINLY+HS+ +S  S ++ +R+K +  HFT ++Y N+CRSLFEKDKLLFS LL IGI K + ++ E VW FLLTGGI+LD+P  NP P WLSEK+W E+   S L    G ++    N+ +WK I DS  PH E+ PG W+     LE++V++RCL P+K++PAV  +I   +G  Y+E P FDL+ S+ +S    P+IFVLSP  DPM+ L +FA+   +  T  + +SLGQGQGPIA   I  ++K   W++LQNCHLA SW+P L KICEE+++ +S  N  FRLWLTSYPS  FPV++LQN +KMTNEPPKGLRANLLRSY   PISD  FF++  +  +++K+LF LCFFHAVVQERRN+G +GWNIPYEFN+SDL+IS+ Q+QMF+NDY++V  +ALTYLTGECNYGGRVTD++DRRL++SLL   Y KE +  + + L    TY +P   S   SY+++++  P  A PEVFGLH NA++ K+ QETNQLFE +L+TLP++  G  KS Q ++E+LA DILSKLP+ F +EE+   YPV+YEE MNTVL QELIRFN+L +V+R+SL++L  A++G +LM + LEEV+ SM++GKVP++W+  SYPSLKPLG Y++DL+AR+ FFQ WID G P  FW+SGFYFTQSFLTGV QNYAR+    ID + F+F +   E    + P D GA+I GL+LE  RW  +   + ES  K+LYD LP+I + P   +    ++ Y CPVYKT+ARRG LSTTGHSTNYV +I LP+    +HWINRG+A+LCQL++
Sbjct:  260 KLISNTLLTSPFLEPLMVVLVQEKENDYYCSLMKSIVDYILMDPMERKRLFIESIPRLFPQRVIRAPVPWHSVYRSAKKWNEEHLHTVNPMMLRLKELWFAEFRDLRFVRTAEILAGKLPLQPQEFWDVIQKHCLEAHQTLLNKWIPTCAQLFTSRKEHWIHFAPKSNYDSSRNIEEYFASVASFMSLQLRELVIKSLEDLVSLFMIHKDGNDFKEPYQEMKFF----IPQLIMIKLEV----SEPIIVFNPSFDGCWELIRDSFLEIIKNSNGIPKLKYIPLKFSFTAAAADRQCVKAAEPGEPSMHAAATAMAELKGYNLLLGTVNAEEKLVSDFLIQTFKVFQK-NQVGPCKYLNVYKKYVDLLDNTAEQNIAAFLKENHDIDDFVTKINAIKKRRNEIASMNITVPLAMFCLDATALNHDLCERAQNLKDHLIQFQVDVNRDTNTSICNQYSHIADKVSEVPANTKELVSLIEFLKKSSAVTVFKLRRQLRDASERLEFLMDYADLPY--------------QIEDIFDNSRNLLLHKRDQAEMDLIKRCSEFELRLEGYHRELESFRKREVMTTEEMKHNVEKLNELSKNLNRAFAEFELINKEEELLEKEKST-YPLLQAMLKNKVPYEQLWSTAYEFSIKSEEWMNGPLFLLNAEQIAEEIGNMWRTTYKLIKTLS--DVPAPRRLAENVKIKIDKFKQYIPILSISCNPGMKDRHWQQISEIVGYEIKPTETTCLSNMLEFGFGKFVEKLEPIGAAASKEYSLEKNLDRMKLDWVNVTFSFVKYRDTDTNILCAIDDIQMLLDDHVIKTQTMCGSPFIKPIEAECRKWEEKLIRIQDNLDAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKSLMSQAVKDNRILVAADQPRMAEKLQEANFLLEDIQKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTDNLEIVGMISSEKETVPFIQKIYPANAKGMVEKWLQQVEQMMLASMREVIGLGIEAYVKVPRNHWVLQWPGQVVICVSSIFWTQEVSQALAENTLLDFLKKSNDQIAQIVQLVRGK-LSSGARLTLGALTVIDVHARDVVAKLSEDRVSDLNDFQWISQLRYYWVAK--------DVQVQIITTEALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRKLKTFIFEGTELSLNPTCAVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYEVFLKVLNDNIKKMKLQPVPWFIGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLAAALGDLHAANQMEEFAVEYKIINPKAITMGQLYGCFDQVSHEWMDGVLANAFREQASSLSDDRKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMNSKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLKDSYMDT-LPSSLTKEHKELVNDMFMWLVQPCLEFGRLHCKFVVQTSPIHLAFSMMRLYSSLLDEIRAVEEEEMELGEGLSSQQIFL----------------------WLQGLFLFSLVWTVAGTINADSRKKFDVFFRNLIMGMDDN----HPRPKSVKLTKNNIFPERGSIYDFYFIKQASGHWETWTQYITKEE-EKVPAGAKVSELIIPTMETARQSFFLKTYLDH-EIPMLFVGPTGTGKSAITNNFLL-HLPKNTYLPNCINFSARTSANQTQDIIMSKLDRRRKGLFGPPIGKKAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGYWFDKKDTTRLDIVDMLLVTAMGPPGGGRNDITGRFTRHLNIISINAFEDDILTKIFSSIVDWHFGKGFDVMFLRYGKMLVQATKTIYRDAVENFLPTPSKSHYVFNLRDFSRVIQGVLLCPHTHLQDV------EKCIRLWIHEVYRVFYDRLIDKEDRQVFFNMVKETTSNCFKQTIEKVLIHLSPTGKI-VDDNIRSLFFGDYFKPESDQ---------------KIYDEITDLKQLTVVMEHYLEEFNNISKAPMSLVMFRFAIEHISRICRVLKQDKGHLLLVGIGGSGRQSAAKLSTFMNAYELYQIEITKNYAGNDWREDLKKIILQVGVATKSTVFLFADNQIKDESFVEDINMLLNTGDVPNIFPADEKADIVEKMQTAARTQGEKVEVTPLSMYNFFIERVINKISFSLAMSPIGDAFRNRLRMFPSLINCCTIDWFQSWPTDALELVANKFLEDVELDDNIRVEVVSMCKYFQESVKKLSLDYYNKLRRHNYVTPTSYLELILTFKTLLNSKRQEVAMMRNRYLTGLQKLDFAASQVAVMQRELTALQPQLILTSEETAKMMVKIEAETREADGKKLLVQADEKEANVAAAIAQGIKNECEGDLAEAMPALEAALAALDTLNPADISLVKSMQNPPGPVKLVMESICIMKGMKPERKPDPSGSGKMIEDYWGVSKKILGDLKFLESLKTYDKDNIPPLTMKRIRERFINHPEFQPAVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLREAEGKLAAQMQKLNQKRAELKLVVDRLQALNDDFEEMNTKKKDLEENIEICSQKLVRAEKLISGLGGEKDRWTEAARQLGIRYTNLTGDVLLSSGTVAYLGAFTVDYRVQCQNQWLAECKDKVIP--GFSDFSLSHTLGDPIKIRAWQIAGLPVDSFSIDNGIIVSNSRRWALMIDPHGQANKWIKNME-KANKLAVIKFSDSNYMRMLENALQLGTPVLIENIGEELDASIEPILLKATFKQQGVEYMRLGENIIEYSRDFKLYITTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAKNKKHLKEIEDKILEVLSMSKGNILEDETAIKVLSSSKVLSEEISEKQKVASMTETQIDETRMGYKPVAVHSATIFFCISDLANIEPMYQYSLTWFINLYMHSLTHSTKSEELNLRIKYIIDHFTLSIYNNVCRSLFEKDKLLFSLLLTIGIMKQKKEITEEVWYFLLTGGIALDNPYPNPAPQWLSEKAWAEIVRASALPKLHGLMEHLEQNLGEWKLIYDSAWPHEEQLPGSWKFSQG-LEKMVILRCLRPDKMVPAVREFIAEHMGKLYIEAPTFDLQGSYNDSSCCAPLIFVLSPSADPMAGLLKFADDLGMGGTRTQTISLGQGQGPIAAKMINNAIKDGTWVVLQNCHLAASWMPTLEKICEEVIVPES-TNARFRLWLTSYPSEKFPVSILQNGIKMTNEPPKGLRANLLRSYLNDPISDPVFFQSCAKAVMWQKMLFGLCFFHAVVQERRNFGPLGWNIPYEFNESDLRISMWQIQMFLNDYKEVPFDALTYLTGECNYGGRVTDDKDRRLLLSLLSMFYCKE-IEEDYYSLAPGDTYYIPPHGS-YQSYIDYLRNLPITAHPEVFGLHENADITKDNQETNQLFEGVLLTLPRQSGGSGKSPQEVVEELAQDILSKLPRDFDLEEVMKLYPVVYEESMNTVLRQELIRFNRLTKVVRRSLINLGRAIKGQVLMSSELEEVFNSMLVGKVPAMWAAKSYPSLKPLGGYVADLLARLTFFQEWIDKGPPVVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFEFEVTPQETVMENNPED-GAYIKGLFLEGARWDRKTMQIGESLPKILYDPLPIIWLKPGESAMFLHQDIYVCPVYKTSARRGTLSTTGHSTNYVLSIELPTDMPQKHWINRGVASLCQLDN 4116          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Human
Match: DNAH7 (dynein axonemal heavy chain 7 [Source:HGNC Symbol;Acc:HGNC:18661])

HSP 1 Score: 3403.61 bits (8824), Expect = 0.000e+0
Identity = 1835/3915 (46.87%), Postives = 2548/3915 (65.08%), Query Frame = 3
Query:  834 DTKQNFQTSVKKAILDYILLNKLEQ---KRLGLMMPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENI--CESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEA--ASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKS--HTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDL-NKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPR---------PKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTW-QSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEIT--LKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTE-MRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLF--ENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDP--SGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLN 12497
            + ++++  SV+K+I+D++L +  E+   K+   +  ++  + +L +  PW    L +  Y++      + T++ +L  +   + +LRL+ I+    C+   L L+    I  ++     + L   W  + + I      + +  +P    +   ++E FFNC A L +  L+ +   S+ +F + I Q  D V            A  +   I+R+ L+ D        F P      D    + D +I +VS   R+E  L+ K E + S P  L  +   E V ++KEK+++ +   S AP ++ ++Y  + +L+ +  E     F+  +        E+ K + L +E    S+ T + + +F + CE + + L+ R+  +    L  M    +  N  +C +++ I  +       T++L+E++ Y++K+   ++I L+ +L  +   + FL+ Y      D+ LNN+ F W  R+  I +     + ++ E+    L+   ++FVE L     Q +EF     L D     ++   +  KL+   ++ +Q N EE      + + Y Q ++I     P+ +L+++AV F   Y  W  GP  +V+ ++VEA+  + W+  Y+L K F    Y   M     +++K+E FK ++P+IQ +CNPGL+ RHW+AMS  VG+ + P  D+ +S  L M L+ +++    +S  ASKE+SLEKA  +M  +W  + F    Y+ETG  IL +VD+IQ+LL+DHI+KT TMR SPFI P+E ++  W+  L  L++ L+ WLKVQA WLYLEPIF S DI  Q+P EG +F  VD+ WR IM  V  D  V+ V+  D +LE L+ S  LLE I KGLN+YLEKKRL+FPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGI+K++FTE   IT M S+E E V+    I   +A G VEKW++++E  M +S+ +V   A   Y +  R  WV+DWPGQ VL  S + WT++   AI      LE++LK  ++QI  IV LVR + L    R+TL A +VLDVHARDV++ L+   +S + DF W+SQ+RYYW          ++L  +M+   + YGYEYLGN+ RLVITPLTDRCYRTL GA+ L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGL   GAWACFDEFNRI+LEVLSV+AQQI TIQR I    ++ +FEGTEL+LD +C +FITMNPGYAGRSELPDNLK LFRTVAMMVPDYA+IAEI LYS GFV AR L+ KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     EE ++L+SIIDVNLPKFL  D+PLF+GI SDLFPGV+ P  DY DL   + +   +M L+   +F +KI+Q+YEM++VRHG MIVG+ F GKT A++ L+ AL D+  K L  EN V   ++NPK++++G LYG+FD+VSHEWSDG+LA +FR  ASS + +RKW+IFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+ + N+IFEP DLE ASPATVSRCGMIYMEP  LG  PL+  W+   LP  +   Q+  +  LF+ ++P S++FI +  K         LV +++ L    +DD  +                          K+   N+    E  + L   F  SLIWS GA    D +LKF+   R   E+ +SP     R          +    A  +  P+KGTI+D+ F+ +  G W  W + L E P +    K    + I++PT+DT+R    L  +L   +KP +FVG TGTGKS  I  F+L+ L  + +    + FSAQT++ Q Q+   SKLD+RR+G++ PP  K +VVF+DD++MP +E YGAQPP+E+LRQ +DH  W+D KD + + + D+ I  AM  P   R  VT R +RHFNII I+EF D++M  IF  I+ WH    ++       L+  IV+ T  +++  M + LPTPAKSHY+FNLRDFSRVIQG      V L      ++   + RLWVHE  RV++DRL+ + D       I++++     E FH LF     DN      + +R LMF DF   K++                  Y EI D + L   ++ +L+EYN +SK PM+LVLFRFAIEHI+RI R+L+QP  H+LLVG+GGSGRQS  +LA  + D+ +FQ+E+++ Y  ++W +D++ ++R   +  ++  FLF D QIKE  FLED++ LLN+G+IPNLF  + +  +    +     + +  Q + + I ++N FI+  R  LH+VL  SPIGDAF +RLR FP+L+NCCTI+WFQ WPEDAL+ VA++ L+E+E+ +++R+  + MC+ FH S  DLSK F+  + R NYVTPTSYLELI TF  LL KK+ E++  K+RY VGLEKL+ + +Q++ MQ+EL+A  PQL   SKE ++++ +IE E+VEV K  K+VK +E     +A  +K+IKD+C+++LA A+P++ +A+ ALDTL   DI++VK+M++PP GVKLVMEA+CILKG+K +K  DP  SGK +ED+W  AK+LLGD++FL  L  YDKD IP AYM  IR  YI NP F P KI+N S+A EGLC WV A++ YD++ K+V+PKK KLA AE   +  M  L+ KQ  L EV+ KLA+LQ+  +  +Q+K DLEN ++L   K+ERAE+LI GLGGEK RW     +L   + N+ GD+L+ +G+VAYLG FT  YRQ   + W   CK   IP S + +      LG+ V +R W I GLP DSFS+DN +I+ +  RW L+IDPQ QANKWIK +E + N L VIKLS+  Y+R LENC+QFGTP LLENVGEELD +LE +LLKQTFKQ     IRLGD  +EY+ DFRFYITT+LRNPHYLPE SVKVTL+NFMITP G++DQ+LGIV A+E+P+LE+ +  LI++ A N+RQLKEIED+IL++LS+S+GNILEDE AI+ILSSSK L+ +IS KQE A +TE +I+  R GY+P+A H SILFF+++DLA+++PMYQYSL+WFINL+I SIENSE S  +  RL+ L  HFT ++Y N+CRSLFEKDKLLFSF L I +   +  +++  WRFLLTGGI LD+P  N +  WL +KSW+E+  L +L  FK   ++F+     WK + DS  PH E FP +WE++ +  +R+++IRCL P+KVIP +  +I+  LG  ++EPP FDL  +F +S+   P+IFVLSPG DPM+ L +FA+ +    + L  +SLGQGQGPIA   + +++K   W++LQNCHLATSW+P L K+CEE  L     +P+FR+WLTSYPS  FPV+VLQN VKMTNE PKGLRAN++RSY   PISD +FF + K+P+ F+KLL+ LCFFHA+VQERR +G +GWNIPYEFN++DL+IS++QL MF+N YE++  EAL Y+TGECNYGGRVTD+ DRR + S+L   ++ EL+ +  +    SG Y VP  + D  SY+ + K  P   APE+FG++ NA++ K+Q ET  LF++IL+T  +     +KSS  ++ ++ASDIL KLP  F IE    +YP  Y + MNTVL+QE+ RFNKL++ IR S V+++ A++GL +M   LEEV  S++  K+P +W   SYPSLKPLGSY++D +AR+KF Q W + G P  FW+SGF+FTQ+FLTG  QNYAR+    ID L FD+ +ME  EY  P ++G FIHGL+L+   W+ +   L ESH K+LYD +PV+ + P  ++ I    SY  P+YKT+ RRGVLSTTGHSTN+V  + LPS Q  +HWI RG+A LCQLN
Sbjct:  209 EMREDYLLSVRKSIVDFVLKDPREKGDDKKTDELPAHRAEMEILPK--PWRKSFLAASSYIRDHLNAMNPTMLAVLDLWHTNFKKLRLVDIKEFHNCQDA-LELSSFQNIIMRHMDSAKETLLKMWFPEVQNIYYQG--NKKKQLPTG--DSSAKLESFFNCAAALMTLQLQDLTLVSMQDFTDLIAQPPDSV-----------RAFEHPGFIMRLILDNDTIK-----FEPELSDYIDIFLNVYDVMIKAVSFVPRVETKLYSKWE-SKSKPTTLKPIILNEIVDAHKEKIKEVIMKESVAPTEHLRLYDKYDFLITRKAERDVDNFLAENHSYEKIIDEICKYQKLIEEIQYTSIKT-IRLGMFEMHCEELIRALVKRADIICGKLLAKMFRDHQEVNTRLCDEFERIAEKALSTPPNTAELMEMKAYIQKVEVTDMIELEQRLVDSKNCLAFLIEYVNFSPADMRLNNSVFQWYGRMGEIFEEHRKIIKEKIEQYQEGLKLRCERFVEELESYAKQSEEFYSFGDLQDVQRYLKKAQILNGKLDLAADKIEQFNAEEEAFG-WLPSVYPQRKKIQDGLNPYLRLYETAVEFSSNYRAWTEGPYHKVNPDQVEADIGNYWRGLYKLEKTFHDSPYALAM--TKKVRSKVEDFKQHIPLIQVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVSSFLDMNLEPYIDRFEGISEAASKEYSLEKAMEKMITEWDAVEFVIHSYRETGTFILASVDEIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFTAVDKTWRDIMRSVMQDKHVLTVVTIDRMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELIEIISTAKARGQVEKWLVELERVMINSIHKVTGDATFAYTKYERINWVRDWPGQTVLCVSQIFWTKEVQTAIPMGIKALEQYLKTCNRQIDDIVTLVRGK-LSMQNRVTLGALVVLDVHARDVLSSLVKKNISDDSDFEWLSQLRYYW--------QENHLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGADILMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIKDNCASMNLQMTAFFSEKILQVYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDSVSHEWSDGVLAVSFRAFASSVTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMLSWVN-LLPASVSVIQKEFIMGLFDRMVPVSVEFIRKHTKELSPTSDTNLVRSLMNLIDCFMDDFAD------------------------EVKLKERND---RETYSLLEGIFLFSLIWSVGASCTDDDRLKFNKILR---ELMESPISDRTRNTFKLQSGTEQTSSKALTVPFPEKGTIYDYQFVTEGIGKWEPWIKKLKEAPPIP---KDVMFNEIIVPTLDTIRYSA-LMELLTTHQKPSIFVGPTGTGKSVYITNFLLNQLNKEIYKPLLINFSAQTTAAQTQNIVMSKLDKRRKGVFGPPLGKRMVVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPPGGGRNPVTPRYMRHFNIITINEFSDKSMYTIFSRILTWHLEICYKFPDEFLDLTTQIVNGTMTLYKEAMKNLLPTPAKSHYLFNLRDFSRVIQG------VCLSRPETTETTEVIKRLWVHEVLRVYYDRLLDNTDRSWLINYIQEILRNYMYEDFHELFQRLDFDNDGMVEADDLRSLMFCDFHDPKREDTN---------------YREIADVDNLRMIVEIHLEEYNNISKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSVFQVEISKGYDTTEWHEDLKVILRKCAEGEMQGVFLFTDTQIKEESFLEDVSNLLNAGEIPNLFALDEKQEICDKMRQLDRQRDKTKQTDGSPIALFNMFIDHCRSQLHVVLAMSPIGDAFRNRLRKFPALVNCCTIDWFQSWPEDALQAVASRFLEEIEMSEEIRDGCIDMCKSFHTSTIDLSKSFFVELQRYNYVTPTSYLELISTFKLLLEKKRSEVMKMKKRYEVGLEKLDSASSQVATMQMELEALHPQLKVASKEVDEMMIMIEKESVEVAKTEKIVKADETIANEQAMASKAIKDECDADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDMRFLQSLHEYDKDNIPPAYMNIIRKNYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGELKIAMDGLRKKQAALKEVQDKLARLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSHTALELGQLYINLTGDILISSGVVAYLGAFTSTYRQNQTKEWTTLCKGRDIPCSDDCSLMG--TLGEAVTIRTWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQSQANKWIKNME-KANSLYVIKLSEPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVAQERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALANEISQKQEVAEETEKKIDTTRMGYRPIAIHSSILFFSLADLANIEPMYQYSLTWFINLFILSIENSEKSEILAKRLQILKDHFTYSLYVNVCRSLFEKDKLLFSFCLTINLLLHERAINKAEWRFLLTGGIGLDNPYAN-LCTWLPQKSWDEICRLDDLPAFKTIRREFMRLKDGWKKVYDSLEPHHEVFPEEWEDKANEFQRMLIIRCLRPDKVIPMLQEFIINRLGRAFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMAALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKEGTWVVLQNCHLATSWMPTLEKVCEE--LSPESTHPDFRMWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLNQYEELPYEALRYMTGECNYGGRVTDDWDRRTLRSILNKFFNPELVENSDYKFDSSGIYFVP-PSGDHKSYIEYTKTLPLTPAPEIFGMNANADITKDQSETQLLFDNILLTQSRSAGAGAKSSDEVVNEVASDILGKLPNNFDIEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLKTIRDSCVNIQKAIKGLAVMSTDLEEVVSSILNVKIPEMWMGKSYPSLKPLGSYVNDFLARLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKYTIPIDLLGFDYEVMEDKEYKHPPEDGVFIHGLFLDGASWNRKIKKLAESHPKILYDTVPVMWLKPCKRADIPKRPSYVAPLYKTSERRGVLSTTGHSTNFVIAMTLPSDQPKEHWIGRGVALLCQLN 4023          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Human
Match: DNAH12 (dynein axonemal heavy chain 12 [Source:HGNC Symbol;Acc:HGNC:2943])

HSP 1 Score: 3363.16 bits (8719), Expect = 0.000e+0
Identity = 1806/3885 (46.49%), Postives = 2527/3885 (65.05%), Query Frame = 3
Query:  969 PWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIK--VEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYT-NFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFS--------------------------HPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHT--LEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKE-LNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNL---KCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSG-FEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSG---KLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQV-FEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTL-PKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            PWHS  +Q++  +    +  H T+  LL      + +  L+    I    P+    L        +   + + N+W       L +  +++E + P        +++ F++CV+TL SN L+ ++R ++                EG+  LF       +  I +I L  D      + F P+F  + D +  +++ I  +      L+NV  I   + GT S P  L     E  +    + L+  V  N E   K+ + Y   + +LL+ T  ++   F   D    +Y   +EK  SL+ E   LP ++   +  LDCE +   L +++K    I LN + +K R  N  IC+++++I     K  ETT ++++L  YVEK RT  +  L  +++++ R + + L+  + P +D+ LN T   W  +I PI D +   +   + +  N+L   +++ +  +     +++EF +  +L    +   ++ ++ +++ E  E  + IN+EE L    + T Y +L ++    EP+ K +   + + +   +WM+G  L+++ E +EA+ +   +  ++  K F                            P+    +   +T+  +++ FK  +P +  LCNPG++ RHW  +S  VG+D+TP   T L  +L + L  +LE    +S+ ASKEFSLEKA   M   W++I F  + Y++TGV IL +VD+IQ +L+D I+KT TMR SPFI PFE EI  W+  L R+++ ++ WLKVQA WLYLEPIF S DI +Q+P EG QF+ VD  WR IM     D KV+       LLE LQ+   LLE+I KGLN YLEKKRL+FPRFFFLSN+E+LEILSETKDPLRVQPHLKKCFEGI+KL+F     I  M S+E E V+    I    A G VEKW++QVE  M  S+ +V+  A   Y + +R  WV++WPGQVVL  S + WT +    I   T  L+++ K+   Q++ IVELVR + L    R TL A + +DVHARDVV  ++   VS + DF W++Q+RYYW         N+N  +R++   V Y YEYLGN+ RLVITPLTDRCYRTL+GA  LNLGGAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY +MGKFFKGLA SGAWACFDEFNRIELEVLSV+AQQI  IQRAI+ +L +F+FEGTEL+L+ +C + ITMNPGYAGRSELPDNLKVLFRTVAMMVP+YALIAEISLYS GF+ AR L+ KIV  YRLCSEQLSSQ HYDYGMRAVK+VL AAG LK K     E+ ++L+SI DVN PKFL  DIPLF+GI SDLFPG++ P  DY +      E      L+PV +FL+KIIQ YEM++VRHG M+VG+ F  KT     L+  L  +N+     E  VI+  +NPK+I++G L+G+FD VSHEW+DGI+A TFRE A SE+ +RKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQM+ + ++IFE  DL QASPATVSRCGMIY+EP QLG +PL+  W+        + E +  ++ LF WLIPPSL+   +KCK  +   +  +V ++ +L+  LL +V                                EN+   +    +++A F  SLIWS G   D D +  FD F R +    D  N   P P ++   +C  +    +KG ++D+++  K  G W  W  LI+  +L +  K  +I +I++PT+DT+R  F +   +    KP++FVG TGTGKS  +K  +++ L    +    +  SA+TS++QVQ+   ++LD+RR+G++ PP  K  ++FIDD++MP  EKYGAQPP+E+LRQ  D   W+D KD + + + D+ + +AM  P   R  VT R +RHFNI +I+ F DETM  IF  I+ ++  +  F      +   IV+ T +I++  + + LPTP KSHY FNLRDFSRVI+GCLL++   + N       + +IRL+VHE  RVF+DRLI+ +D    F+L K V++  FKE FH +F      N   T  ++R LMFGD++    +P+          EG+ ++Y EI +       +   LDEYN   K  M+LV+FR+ +EH++RICR+L+Q  G++LLVG+GGSGRQS  +LAT +    IFQ E++++Y +++WR+D++ L+RN G KG +T FL  D QIKE  FLEDI+ +LN+G++PN+F  +++ E++E ++ + Q  N   E++ + ++  F+ R + NLH+V+ FSPIGDAF +RLR FPSLINCCTI+WFQ WPEDAL+ VA K L+ +E+ +  +++IV +C+HFH S+ DLS++F   +GR NYVT TSYLELI +F  LL +K+  ++ +K+RY  GL+KL F+E+Q+  MQ+EL   QP+L E   E   ++++IE E+V+VE  R+ VK +E     KAE+A+++K++CES+LAEA+P + AA+ ALDTLK  DI+IVK+M+NPP GVKLVM AVC++K +KPEK +DPSG   K++ DYW  +KKLLGD+ FL  LK YDKD IP   M+KIR +Y+ NP FDP K+   SSA EGLC W+ A+EVYDR+ KVV+PKK +L+ A+      M  L  K+ EL EVE  L  LQ  F  K +EK  LE+ +EL   K+ERA +LI GLGGEK RW +   DL I ++N+ GDVL+ AG++AYLG FT G+RQ C + W   CK   IP S E   S    LGDPV++R W I GLP D+FS+DN VIV +  RW L+IDPQGQANKWIK  E E N+L VIKLSD  Y+R LENC+QFGTP LLENVGEELD  LE +LL+QTFKQ  ++ IRLG+ ++EYS DF+FYITT+LRNPHY+PE + KV+L+NFMITP GLEDQ+LGIV AKE+PELE+ R  LI++SA+N++QLK+IE +IL+ LS+S+GNILEDE AI++L S+K++S +I+ KQ+ A KTE +I   R GY+P+A H S+LFF+I+DLA++DPMYQYSL+WF+NLYI+SI +S  S  +E RL+ LN HFT  +Y NICRSLFEKDKLLFSFLLC  +   + +++     FLLTGG+SL S +KNP P WL +KSW E+   S    F+G  + F  +I +W+ I DSK PH  KFP   ++ L+ L++++++RCL P+K+ PA+ +Y+   LG ++VEPP FDL  S+ +S+   P+IFVLSPG DPM+ L +FA  K++S    + +SLGQGQGPIA   I  +++   W+ LQNCHLA SW+P L KICE+        N +FRLWLTSYPSS FPV +LQN VKMTNEPP GLR NLL+SY T P+SD +FFK  +  ++ +EKLLF +CFFHA+VQER+ +G +GWNIPY FN+SDL+ISIRQLQ+FIN+Y+ +  EA++YLTGECNYGGRVTD+ DRRL++++L   Y+  ++ +  +  + SG Y  P        Y+  IK+ P    PE+FGLH N +++K+ Q+T  LFES+L+T    + +G S S+  I+ ++  DIL+KLP  F IE    KYPV YEE MNTVL+QE+ RFN LI  IR +L DL+ A++G+++M + LE +  S+++GKVP +W++ SYPSLKPLGSYI+D +AR+ F Q+W ++G+P  FW+SGF+FTQ+FLTG +QNYAR+    ID L ++F ++         ++G +IHGLYL+  RW  E   L E + K+L+DL+P+I I PT KS I   ++Y CP+YKT+ R+G LSTTGHSTN+V  + L + Q  +HWI RG+A LCQL+D
Sbjct:  188 PWHSSYVQARNQIFSNLHIIHPTMKMLLDLGYTTFADTVLLDFTGIRAKGPIDCESLKTDLSIQTRNAEEKIMNTWYPKVIN-LFTKKEALEGVKPE-------KLDAFYSCVSTLMSNQLKDLLRRTV----------------EGFVKLFDPKDQQRL-PIFKIELTFD---DDKMEFYPTFQDLEDNVLSLVERIAEA------LQNVQTIPSWLSGT-STPVNLDTELPEHVLHWAVDTLKAAVHRNLEGARKHYETYVEKYNWLLDGTAVENIETFQTEDHTFDEYTEFIEKFLSLASEIMLLPQWIHYTMVRLDCEDLKTGLTNKAKAFANILLNDIASKYRKENECICSEFEAIKEHALKVPETTEEMMDLISYVEKARTVGIEELILRIQESKRQMSYFLDVFLFPQEDLALNATVLMWPRKINPIFDENDELIENAKHKKENELMAKREKLILEIEKESRRMEEFTEFAELERMQQYVTDVRQLQKRIQESEEAVQFINKEEELFKWEL-TKYPELDKLKVNIEPYQKFFNFVLKWQRSEKRWMDGGFLDLNGESMEADVEEFSREIFKTLKFFQTKLKKELQEKRKAARKRSLEEEKIEEEPKDNATITMCSTVMEQIKAFKEYIPTVSILCNPGMRARHWKQISEIVGYDLTPDSGTTLRKVLKLNLTPYLEQFEVISAGASKEFSLEKAMNTMIGTWEDIAFHISLYRDTGVCILSSVDEIQAILDDQIIKTQTMRGSPFIKPFEHEIKAWEDRLIRIQETIDEWLKVQAQWLYLEPIFCSEDIMQQMPEEGRQFQTVDRHWRDIMKFCAKDPKVLAATSLTGLLEKLQNCNELLEKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFLPNLDIKAMYSSEGERVELIALISTSAARGAVEKWLIQVEDLMLRSVHDVIAAARLAYPESARRDWVREWPGQVVLCISQMFWTSETQEVISGGTEGLKKYYKELQNQLNEIVELVRGK-LSKQTRTTLGALVTIDVHARDVVMDMIKMGVSHDTDFLWLAQLRYYW--------ENENARVRIINCNVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQQKLVVFVFEGTELKLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNARPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKYPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGIKLPEADYHEFLECAHEACNVHNLQPVKFFLEKIIQTYEMMIVRHGFMLVGEPFAAKTKVLHVLADTLTLMNEHGYGEEEKVIYRTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFALSETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSPQMSLIFETMDLSQASPATVSRCGMIYLEPSQLGWEPLVSSWLNSLKGPLCEPEYQALLRGLFAWLIPPSLNQRKKKCKELIPTSNSNVVVSLTRLFEVLLCNVV-------------------------------ENDPTSKHIRVWIMACFIFSLIWSIGGSCDTDGRRVFDTFIRLIILGKDDEN---PVPDSVGKWECPFD----EKGLVYDYMYELKNKGRWVHWNELIKNTNLGD--KQIKIQDIIVPTMDTIRYTFLMDLSITYA-KPLLFVGPTGTGKSVYVKDKLMNHLEKDQYFPFYINLSARTSANQVQNIIMARLDKRRKGVFGPPMGKKCIIFIDDMNMPALEKYGAQPPIELLRQFFDCGHWYDLKDTSKITLVDIELIAAMGPPGGGRNPVTPRCIRHFNICSINSFSDETMVRIFSSIVAFYLRTHEFPPEYFVIGNQIVNGTMEIYKQSVENLLPTPTKSHYTFNLRDFSRVIRGCLLIERDAVAN------KHTMIRLFVHEVLRVFYDRLINDDDRRWLFQLTKTVIKDHFKESFHSIFSHLRKQNAPVTEEDLRNLMFGDYM----NPD---------LEGDDRVYIEIPNIHHFSDVVDQCLDEYNQTHKTRMNLVIFRYVLEHLSRICRVLKQSGGNALLVGLGGSGRQSLTRLATSMAKMHIFQPEISKSYGMNEWREDMKGLLRNVGMKGQKTVFLITDTQIKEEAFLEDIDSVLNTGEVPNIFAADEKQEVMEGVRPVAQAGNKHDELSPLALFAFFVNRCKDNLHVVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQSWPEDALERVAVKFLETLELTEVEQQEIVPICKHFHTSIMDLSERFLHELGRHNYVTATSYLELIGSFRQLLTQKRQAVMEAKQRYMNGLDKLAFAESQVGEMQMELVELQPKLEEAKIENANMMQVIEIESVQVEAKRQFVKLDEEIASGKAEEAQALKNECESDLAEAIPALEAALSALDTLKPADITIVKSMKNPPSGVKLVMAAVCVMKDIKPEKISDPSGTGGKIL-DYWGPSKKLLGDMNFLRDLKEYDKDNIPVTVMQKIRSEYLMNPEFDPPKVAKASSAAEGLCKWIMAMEVYDRVAKVVAPKKARLSEAQKSLAETMELLNQKRAELAEVEHHLENLQMTFLEKTEEKAALEDQVELCAKKLERASQLIGGLGGEKSRWAQAADDLQITYENLTGDVLVSAGVIAYLGAFTSGFRQTCTKDWSMLCKKKKIPCSEEFLLSK--TLGDPVKIRAWNIAGLPTDTFSIDNGVIVNNCRRWPLMIDPQGQANKWIKNSEKE-NQLSVIKLSDSDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLRQTFKQGGIDCIRLGEVIIEYSFDFKFYITTKLRNPHYMPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKDIEKKILETLSSSEGNILEDESAIKVLDSAKMMSNEITKKQQIAEKTELKIAESREGYRPIAKHSSVLFFSIADLANIDPMYQYSLTWFVNLYINSIHDSNKSKILEKRLRYLNDHFTYNLYCNICRSLFEKDKLLFSFLLCANLLLARKEIEYQELMFLLTGGVSLKSAEKNPDPTWLQDKSWEEICRASEFPAFRGLRQHFCEHIYEWREIYDSKEPHNAKFPAPMDKNLNELQKIIILRCLRPDKITPAITNYVTDKLGKKFVEPPPFDLTKSYLDSNCTIPLIFVLSPGADPMASLLKFANDKSMSGNKFQAISLGQGQGPIAAKMIKAAIEEGTWVCLQNCHLAVSWMPMLEKICED--FTSETCNSSFRLWLTSYPSSKFPVTILQNGVKMTNEPPTGLRLNLLQSYLTDPVSDPEFFKGCRGKELAWEKLLFGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFINEYDTIPFEAISYLTGECNYGGRVTDDWDRRLLLTMLADFYNLYIVENPHYKFSPSGNYFAP-PKGTYEDYIEFIKKLPFTQHPEIFGLHENVDISKDLQQTKTLFESLLLTQGGSKQTGASGSTDQILLEITKDILNKLPSDFDIEMALRKYPVRYEESMNTVLVQEMERFNNLIITIRNTLRDLEKAIKGVVVMDSALEALSGSLLVGKVPEIWAKRSYPSLKPLGSYITDFLARLNFLQDWYNSGKPCVFWLSGFFFTQAFLTGAMQNYARKYTTPIDLLGYEFEVIPSDTSDTSPEDGVYIHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKPTQKSRIIKSDAYVCPLYKTSERKGTLSTTGHSTNFVIAMLLKTDQPTRHWIKRGVALLCQLDD 3960          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Human
Match: DNAH1 (dynein axonemal heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:2940])

HSP 1 Score: 2751.08 bits (7130), Expect = 0.000e+0
Identity = 1580/3858 (40.95%), Postives = 2319/3858 (60.11%), Query Frame = 3
Query: 1152 EQYAQKQSQ-------YLQNSWMKDCEEILVSSIDSI--------ESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVV--CYEGYY---DLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLF--IKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLN-SEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQ-LLDYEAELEKLKSLSDEA---ASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRII----PILDSSGYNLTK----ERERALNKLEKW-QKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLE-EFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIEN----SVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFL-SLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFG---------------CWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLI-IEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIM-DWHFNSGFEITLK----------RLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEV---EIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEK-KTDPSGKLMEDYWPTAKKLLGDL-KFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIM--ECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLN 12497
            E++ Q QSQ       +L++SW+   +  + SS+  +        E+      M ++R   +    V  +  + LRF+V++S+  F +FI      V  C +      DL +       N +  + L  D +  H   +    ++    L  + D  I +     +LE ++   I + G P    +L  +   E ++   E+LR  +    S+A I        +R  L     D +        Q LL  E     L  L ++    +SLP+ + +  F ++ + + Q L  + K L    L+ +         SIC ++ SI R++ ++  +  +L EL+E+++ +    L+ L+ ++ K       + +Y ++  D+ L N ++  +ND+ I    P        L +    E E    K++   Q  F E L GL+  +  F+   +++ A E   E+ ++ ++L +C +     N  E + S  + T Y +L  ++   +P+  LW +A  + +  + WMN P+  +DAE++E      +KT ++  K F   +       A  I+A++E+FK  +P+IQ L NPG++ RHW+ +SN++  ++ P+ +   +  L M L  H+E + +V+  A KE+++E+A  +M+ +W  I+F+  PYK T   IL + D+   LL+DHIV T  M  SP+  PFE  IN W+  L   ++ L  WL  Q +WLYLEPIF S DI +Q+P+E  +++ ++  W+ IM     + +V+NV     +L+ L+    +L+ +QKGL++YLE KR  FPRF+FLS++ELLEILS+TKDP  VQPHL+KCFE I++L F E+  IT M SAE EEV+  + I+P      VE W+ +VE +MK S+ ++++KA+  Y  + R QWV +WPGQV +A    +WT +   A+++  L  +   +  QQ+S +V LVR + L  + R  L A IV++VHA+DVV+KL+   V S +DF WISQ+RYYW        +N++L IR V  E  YGYEYLGN+ RLVITPLTDRCY TL GA+ L  GGAP GPAGTGKTET+KDL KA+A Q VVFNCSD LD+ +MGKFFKGLA +GAWACFDEFNRI++EVLSV+AQQI TIQ+A + ++E F+FEG E+ L  SC +FITMNPGYAGR+ELPDNLK LFR VAMMVPDYA+I EISLYS GF EA  LA KI   ++L SEQLSSQ HYD+GMRAVK+V++AAG LKR+   + EE + L++I DVN+PKFL  D+ LF GI+SDLFP +++   DY  L   + E  R   L+ V  FL K IQ+YE  +VRHGLM+VG +  GK+  ++ L+ A+  L  + +I      +V + ++NPK+I++G LYG FD ++HEW+DGI +   R  A +    +KW +FDGPVDAIWIENMNTVLDDNKKLCL SGEII++T    M+FE +DL  ASPATVSRCGM+Y+EP  LG  P I+ W+++  P     E+    + LF   +  S+ F+    K  +   +  L  ++L+L                                + L KI +E    K  R   LI  +F+ SLIWS GA  D   +  F  + R   E     N++            L+ P++G +FD+                        W  W   ++      ++  T   NI++PT+DTV+    L  +L N +KP++ +G TGTGK+  I   +L +L   D++ H LTFSA+TS++Q QD   SKLD+RR+G++ PP  +  + FIDD++MP  E YGAQPP+E+LRQ +DH  W+DRK       + D+    AM  P   R  VT RL+RHFN ++  E D+ + K IF  I+ +W      E + +            ++ +V AT  ++ ++ +  LPTPAKSHY FNLRD S+V QG L+     +++  Q      L+RLW HE  RVF DRL++ ED   F +L+K+ +E     ++ V F               + +++GDF+    D               +K Y  IT E  + Q ++ Y+++YN ++ A + LVLF  A+ HI RI R LRQ  G++LL+G+GGSGR S  +LA+ + ++E FQIE+++ Y +S+WRDD+++++   G + +  TFLF D QIK   FLEDIN +LNSGDIPNL+  +++             Q   ++ T  N+   +  RVR N+H+VL  SPIG+ F +RLR FPSL+NCCTI+WF  WP +ALK VA   L+E+   E  Q+  + ++ +C + HQSVS    ++   + R NYVTP SYLEL+  F  L+ +K++E+ T+K R   GL+KL  +   ++ MQ +L++  P L E +K+T   ++ I+ +T   E+ R  V+ EE     KA+ A++I DD + +L EA+P ++AA+ +L  L +ND++ V+AMQ PP GVKLV+EAVCI+KG+KP+K   +  G  ++DYW   K LL D   FL+ L  +DKD I +  ++ I+  YI+N  F P  I  +S AC  +C WVRA+  Y  + K V PK++ L  A+         L   +  L EVE  +A +Q  ++    +K +LE   E  + ++ RA KLI GL  EK RW + + +L    +N+ GDVL+ AG VAYLGPFT  YR    + W  + +S ++P    S  +L   LG+PV++R WQI GLP D+ SV+N VI   + RW+  IDPQ QANKWIK +E + N L+V KLSD+ +LR +EN ++FG PCLLENVGEELD  LE VLLKQT+KQ     ++LGD V+ Y +DFR YITT+L NPHY PE S K+TL+NF ++P+GLEDQ+LG V A+E+P+LE+ + QLII +A  R++LK+IEDQIL  LS+S+GN ++D + I++L +SK+ + +I  K   A +TE +I+  R  Y PVA    ILFF +SDLA++DPMYQYSL WF+N+++  I NSE + +++ R+ N+N + T ++Y N+CRSLFEK KL+F+FLLC+ I   + K+++  WR+LL+GG S+    +NP PDWLS+++W ++  LSNL  F  +  DFV ++ +++ I DS  PH E  PG W++ L   ++L+V+RCL  +KV  A+  ++   L   ++EP   +L + FK+S+S TP+IFVLSPG DP +DLY+FAE    S   L  +SLGQGQGP AE+ +  S++   W+  QNCHLA SW+P L ++ E   +   +++ +FRLWLTS PS+ FPV++LQN  KMT EPP+G+RANLL+SY++     EDF  +  +   F+ LL SLC FH    ERR +G +G+NIPYEF D DL+I I QL+MF+++Y+D+  + L Y  GE NYGGRVTD+ DRR IM++L   Y+ ++L  E    + SG Y     T DL+ YL++IK  P N  PE+FGLH NA +   Q ET  L  +I+   PK  S  S+  + I+ED+  +IL K+P+   ++ +  KYPVLYEE MNTVL+QE+IR+N+L++VI ++L DL  A++GL++M + LE +  S+    VP LWS  +YPSLKPL S++ DL+ R+ F Q WI +G P  FW+SGF+F Q+FLTG LQN+AR+   +ID + FDF++M     E ++    G +IHGL+LE  RW  E   L ES  K LY  + VI +LPT       ++ Y CP+YKT  R G LSTTGHSTNYV  + +P+ Q  +HWI RG+A +C L+
Sbjct:  540 EEFEQIQSQTFSQVQMFLKDSWISSLKVAMRSSLRDMSKGWYNLYETNWEVYLMSKLR---KLMELVKYMLQDTLRFLVQDSLASFSQFISDTCCSVLNCTDDMVWGDDLINSPYRPRKNPLFIMDLVLDSSGVH---YSTPLEQFEASLLNLFDKGILATHAVPQLEKLVMEDIFISGDP----LLESVGLHEPLV---EELRATIASAVSKAMIPLQAYAKEYRKYLELNNNDIASFLKTYQTQGLLAQEVREVVLTHLREKEILDSSLPSSIIIGPFYINTDNVKQSLSKKRKALATSVLDILAKNLHKEVDSICEEFRSISRKIYEKPNSIEELAELREWMKGI-PERLVGLEERIVKV------MDDYQVM--DEFLYNLSSDDFNDKWIASNWPSKILGQIELVQQQHVEDEEKFRKIQIMDQNNFQEKLEGLQLVVAGFSIHVEISRAHEIANEVRRVKKQLKDCQQLAMLYNNRERIFSLPI-TNYDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEKNVVEAFKTMHKCVKQFK--DMPACQEVALDIRARIEEFKPYIPLIQGLRNPGMRIRHWETLSNQININVRPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSTILFNVLPYKATDTYILKSPDEASQLLDDHIVMTQNMSFSPYKKPFEQRINSWENKLKLTQEVLEEWLNCQRSWLYLEPIFSSEDINQQLPVESKRYQTMERIWKKIMKNAYENREVINVCSDLRMLDSLRDCNKILDLVQKGLSEYLETKRSAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARLLFQEDLEITHMYSAEGEEVQLCFSIYP---SSNVEDWLREVERSMKASVHDIIEKAIRAYPTMPRTQWVLNWPGQVTIAGCQTYWTMEVAEALEAGNLRSQLFPQLCQQLSDLVALVRGK-LSRMQRAVLSALIVIEVHAKDVVSKLIQENVVSVNDFQWISQLRYYW--------TNNDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVERFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMITEISLYSFGFNEASVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPSMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTIKEEDTDYGILDEAIREACRNSNLKDVEGFLTKCIQLYETTVVRHGLMLVGPTGSGKSTCYRVLAAAMTSLKGQPSISGGMYEAVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFSSFIRAGAITSDTNKKWYMFDGPVDAIWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFIECWLRKLPPLLKPYEEH--FKALFVSFLEESISFVRSSVKEVIASTNCNLTMSLLKLLDCFFKPF---------------------LPREGLKKIPSE----KLSRIVELIEPWFIFSLIWSVGATGDSSGRTSFSHWLRLKME-----NEQL----------TLLFPEEGLVFDYRLEDAGISGTNDSEDEEEEYKQVAWVKW---MDSSAPFTMVPDTNYCNIIVPTMDTVQMSHLLDMLLTN-KKPVLCIGPTGTGKTLTISDKLLKNLA-LDYISHFLTFSARTSANQTQDFIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKIIGAFKNLVDINFVCAMGPPGGGRNTVTPRLMRHFNYLSFAEMDEVSKKRIFSTILGNWLDGLLGEKSYRERVPGAPHIAHFTEPLVEATIMVYATITSQLLPTPAKSHYTFNLRDLSKVFQGMLMADPAKVEDQVQ------LLRLWYHENCRVFRDRLVNEEDRSWFDQLLKRCME-----QWEVTFNKVCP---------FQPILYGDFMSPGSD---------------VKSYELITSESKMMQVIEEYIEDYNQINTAKLKLVLFMDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWRDDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNLYTADEQ--DQIVSTMRPYIQEQGLQPTKANLMAAYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATVFLNEIPELESSQEEIQGLIQVCVYIHQSVSKKCIEYLAELTRHNYVTPKSYLELLHIFSILIGQKKLELKTAKNRMKSGLDKLLRTSEDVAKMQEDLESMHPLLEEAAKDTMLTMEQIKVDTAIAEETRNSVQTEEIKANEKAKKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPGEKPGTKVDDYWEPGKGLLQDPGHFLESLFKFDKDNIGDVVIKAIQ-PYIDNEEFQPATIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALLEAQDDLGVTQRILDEAKQRLREVEDGIATMQAKYRECITKKEELELKCEQCEQRLGRAGKLINGLSDEKVRWQETVENLQYMLNNISGDVLVAAGFVAYLGPFTGQYRTVLYDSWVKQLRSHNVP--HTSEPTLIGTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQSQANKWIKNMEKD-NGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNTVLKLGDTVIPYHEDFRMYITTKLPNPHYTPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIISNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAIRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRISNINRYLTYSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQSEWRYLLSGG-SISIMTENPAPDWLSDRAWRDILALSNLPTFSSFSSDFVKHLSEFRVIFDSLEPHREPLPGIWDQYLDQFQKLLVLRCLRGDKVTNAMQDFVATNLEPRFIEPQTANLSVVFKDSNSTTPLIFVLSPGTDPAADLYKFAEEMKFS-KKLSAISLGQGQGPRAEAMMRSSIERGKWVFFQNCHLAPSWMPALERLIEH--INPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVRANLLKSYSSL---GEDFLNSCHKVMEFKSLLLSLCLFHGNALERRKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYDDIPYKVLKYTAGEINYGGRVTDDWDRRCIMNILEDFYNPDVLSPE-HSYSASGIYHQIPPTYDLHGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALLGTIIQLQPKSSSAGSQGREEIVEDVTQNILLKVPEPINLQWVMAKYPVLYEESMNTVLVQEVIRYNRLLQVITQTLQDLLKALKGLVVMSSQLELMAASLYNNTVPELWSAKAYPSLKPLSSWVMDLLQRLDFLQAWIQDGIPAVFWISGFFFPQAFLTGTLQNFARKFVISIDTISFDFKVMFEAPSELTQRPQVGCYIHGLFLEGARWDPEAFQLAESQPKELYTEMAVIWLLPTPNRKAQDQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPTHQPQRHWIKRGVALICALD 4264          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Human
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 2363.57 bits (6124), Expect = 0.000e+0
Identity = 1361/3405 (39.97%), Postives = 2013/3405 (59.12%), Query Frame = 3
Query: 2571 LWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFD-ITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKET-GVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFT---------------EETVIT----GMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWV-QDWPGQVVLAASAVHWTEQATNAIKS------HTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENS----VIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAH-FFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEI-KQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTG--GISLDSPQKNPVPDWLSEKSWNEMFGLSNLEP----FKGWLKDFV--------------MNIQKWKSIVDSKTPHLEK---------FPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYT-TTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPK-EISGESKSSQTIIEDLASDILSKLPQIFQI----EEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECH-----------------------EYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENS---YHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            LW S   + KL  +W+      +D E +  +     K   +L K         P      +K K+EK K  LP+I  L NP LK RHW A+   V    +   I   L  +  + +    +++ ++S +AS E +LE    ++++ W+   F   P++++  V IL   DDIQVLL+D  +  +T+ +S ++GP ++ ++ W K L      L  WL  Q  WLYLE IF + DI+RQ+P E   F  VD+ W+ IM KV      +       LLE  Q++ ALL+QIQK L  YLE KR+ FPRF+FLSN+ELLEIL++T++P  VQPHL+KCF+ ISKL+F                 E V T     MLS E E V        L+A G VE+W+ +VE AM  SLR + K A+  Y    R  WV    P QV+L  S + W    T  +++        L+ F K N ++++++  +V+  +L  L R  L A I +DVHARD+V +L+ S+V + + F+W  Q+RYYW  +L      DN V RM  ++  YGYEYLG   RLVITPLTDRCY  LMGA++L+LGGAP GPAGTGKTET+KDLAKA+A QCVVFNCSDGLDYK MG+FF GLAQSGAW CFDEFNRI++EVLSVIAQQ+ TI+ A   +L  F+FEG E++L  +C  FITMNPGYAGR+ELPDNLK LFR  AMMVP+YALIAE+ LYS GF  ++ LA K+  +Y+LCSEQLS Q HYD+GMRAVKSVL  AG LKR+   L E+ V+++++ D NLPKFL  D  LF GIISDLFPGV+ P  DY  L   +++ +    L+P    + K+IQ YE +LVRHG+M+VG +  GKT  ++ L+  LG+L K L IENS    V   ++NPK+I++G LYG  + ++ EW DG++A + R   +  S++ KWII DGPVDA+WIENMNTVLDDNK LCL + E I++T + +M+FE +DL  ASPATVSRCGM++++P +L   P +K W++  + + L +E +  +  LF   +   L FI +KC   +    +  V  +  L  SL+     +GK                            N  +++ + N ++   F    +WS G   +               +  D+P+ + P   +L                 I M         W+ +I     +   +      +L+PT DTVR  + + ++L   +  ++F G TG GKS + K  +     +  ++   L FSAQTSS + Q+   SKL+R+R+ +   P +K +V+F+DD++MP  ++YG+QPP+E+LRQ  D   ++DR       I+DV I SA A P   R  VT R +RHF+++ +    + ++K IFQ I++  F S F   +K+ +  IV A+ +I+  +    LPTPAKSHYVFNLRD S+ +QG L      ++   Q      + RL+ HE  RVFHDRLI++ED   +F +I  + EM  K      FG  + D +   N   + ++FGDF+K   D  +             ++Y+++ D E     +Q YLD+YNL +   + LV F+ AIEH++RI RM+RQ  G++LLVG+GG+G+QS  +LA  IC ++  QIE++R Y+   + +D+R+L +  G +     FLF D QI    FLEDIN +LNSG++PNLFE +D LE +    +   ++    E     ++  FI +VR+ LH+VL  SP+G+AF SR R FPSL+NCCTI+WF  WP +AL  V+     +V+   ++++EK+ +MC + H SVS +++++Y  + R  Y TPTSYLELI  ++++L++K+ +II++++R   GL KL  +   +  M+++L A +P L+  S++ E L++ +  +    ++VR  V+E+EA   VKAE+ ++I DD + +L EA+P ++AA +ALD+L + DIS ++    PPD V  VMEA+ IL   KP+             WP+AK+LLGD  FL  L  YDK+ I    + K++ +YINNP F P K++ +S AC+ +C+WVRA+++Y R++KVV PK++KL  A++     MA L+ KQ  L +VE ++  LQ+ +     EK  L   + LTK ++ RA KL A L  E+ RW + I        N+ G+V + A  VAY G FT  YRQ  +E W  +C+S+ IP+    +     +LGDP  +R+W   GLP D  S +N ++VT   RW L+IDPQ QAN+WI+  ES ++ L++IKL+D  +LR+LEN ++ G P LLE + E LD  LE +LLKQ F       IRLGD  ++Y ++FRFY+TT++ NPHYLPE  +KVT++NF +T +GLEDQ+L  V   EKP LE++R +LI+   +++ QLK IE++IL++L TS+GNIL++E+ I+ L  SK+ S  I  + E A  TE  IN  R  Y+PVA  GS+++F I+ L+ +DPMYQYSL +F  L+  +IE S  + +++ RL  L        Y N+ R LFE+ KL++SF+LC+ + + Q  + +  W F L G  G+  + P K   P WL   +W   F   +LE     F G  ++ +              +N QKW+    SK  H +K             W   LS   +L++I+C   EKV+ A+  +++  LG +++E P  DL   +++    TP++F+LS G DPM    RFA     S   ++ +SLGQGQGPIAE  + +++KS NW+ LQNCHLA SW+  + ++ +      S I   FRL+L+S PS+ FPV VLQNSVK+TNEPPKGLRAN+ R++T  TP     FF+ +   + + +++F +CFFHA++QER+ +G +GWNI YEFNDSD + ++  L+++  + + +  +AL Y+TGE  YGGRVTD+ D+R + ++L   +  E  L E +  +ESG Y  P+  S L  + ++I+  P    PE+FG+H NA L  + +ET+ L  +IL   P+    GE KS+  I+++L + + +++P+  ++    E + +K        + TVL QE+ RFN L+++I  SL  L  A+ G ++M   +E+VY S +  +VP+LWS  +YPSLKPLGS++ DLI R  F   W+  GQP ++W+SGF+F Q FLTG LQN+AR+    ID+L F + ++  +                       E   P D G  +HG++++  RW  ++  + ++    +  +LPV++  P      N++ S   YHCP+YKT AR G LSTTGHSTN+V T+ LPS +   +WI +G A LCQL++
Sbjct:  892 LWDSFSEWDKLQQEWLKSKFDCLDPEVLNGQVSKYAKFVTQLEKGLP------PNSVVPQLKYKVEKMKEKLPVIIDLRNPTLKARHWAAIEQTVDATLVDAEIPLTLERLSQLHVFDFGQEIQDISGQASGEAALEAILKKVEDSWKTTEFVILPHRDSKDVFILGGTDDIQVLLDDSTINVATLASSRYLGPLKTRVDEWQKQLALFNQTLEEWLTCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPAEGKIPGIDGEPEKVYTNDILAMLSPEGERVSLGKG---LKARGNVEEWLGKVEEAMFTSLRRLCKAAIADYQGKLRTDWVVAGHPSQVILTVSQIMWCRDLTECLETEHSNHIQALKNFEKVNFERLNALAAIVQG-SLPKLHRNILTALITIDVHARDIVTELVQSKVETVESFDWQRQLRYYWDIDL------DNCVARMALSQYTYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPFAMMVPNYALIAEVILYSEGFESSKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLNEDVVLIRALQDSNLPKFLTDDALLFSGIISDLFPGVQIPEHDYGILQSTIVDVMNRQNLQPEMCMVRKVIQFYETMLVRHGVMLVGPTGGGKTTVYRILAETLGNLQK-LGIENSFYQAVKTYVLNPKSITMGELYGEVNNLTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMKG-ISKKLTEETQEYILNLFQRYVDEGLHFINKKCSQAIPQVDISKVTTLCCLLESLI-----LGKDGV-------------------------NLAMEQTKLNTILCQTFVFCYLWSLGG--NLTENYYDSFDTFIRTQFDDNPDARLPNSGDLWS---------------IHMDFDTKRLDPWERIIPTFKYN---RDVPFFEMLVPTTDTVRYGYLMEKLLA-VKHSVLFTGITGVGKSVIAKGLLNKIQESAGYVPVYLNFSAQTSSARTQEIIESKLERKRKNILGAPGNKRIVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIISACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILN-GFLSDFPPAVKQTASSIVEASVEIYNKMSVDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGTIREEIQ------IFRLFCHECQRVFHDRLINNED-KHYFHVI--LTEMANKH-----FG-IAIDLEYFLN---KPIIFGDFIKFGADKAD-------------RIYDDMPDIEKTANVLQDYLDDYNLTNPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCLQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDTQIVVEEFLEDINNILNSGEVPNLFE-KDELEQVLAATRPRAKEVGISEGNRDEVFQYFISKVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSKTFFSQVDAGNEELKEKLPLMCVNVHLSVSSMAERYYNELRRRYYTTPTSYLELINLYLSMLSEKRKQIISARDRVKNGLTKLLETNILVDKMKLDLSALEPVLLAKSEDVEALMEKLAVDQESADQVRNTVQEDEATAKVKAEETQAIADDAQRDLDEALPALDAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAKPD-------------WPSAKQLLGDSNFLKRLLEYDKENIKPQILAKLQ-KYINNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKVVEPKRQKLRAAQAELDITMATLREKQALLRQVEDQIQALQDEYDKGVNEKESLAKTMALTKARLVRAGKLTAALEDEQVRWEESIQKFEEEISNITGNVFIAAACVAYYGAFTAQYRQSLIECWIQDCQSLEIPIDPSFSLIN--ILGDPYEIRQWNTDGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKES-KSGLKIIKLTDSNFLRILENSIRLGLPVLLEELKETLDPALEPILLKQIFISGGRLLIRLGDSDIDYDKNFRFYMTTKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPRLEEQRIKLIVRINTDKNQLKTIEEKILRMLFTSEGNILDNEELIDTLQDSKITSGAIKTRLEEAESTEQMINVAREKYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIETSVKTENLQQRLDVLLEQTLLTAYVNVSRGLFEQHKLIYSFMLCVEMMRQQGTLSDAEWNFFLRGSAGLEKERPPKPEAP-WLPTATW---FACCDLEESFPVFHGLTQNILSHPISIRLGSFETYINPQKWEGY--SKMKHEDKHMRQEKEAAHQDPWSAGLSSFHKLILIKCCKEEKVVFALTDFVIENLGKQFIETPPVDLPTLYQDMSCNTPLVFILSTGSDPMGAFQRFARESGYS-ERVQSISLGQGQGPIAEKMVKDAMKSGNWVFLQNCHLAVSWMLAMEELIKTFTDPDSAIKDTFRLFLSSMPSNTFPVTVLQNSVKVTNEPPKGLRANIRRAFTEMTP----SFFEENILGKKWRQIIFGICFFHAIIQERKKFGPLGWNICYEFNDSDRECALLNLKLYCKEGK-IPWDALIYITGEITYGGRVTDSWDQRCLRTILKRFFSPE-TLEEDYKYSESGIYFAPMADS-LQEFKDYIENLPLIDDPEIFGMHENANLVFQYKETSTLINTILEVQPRSSTGGEGKSNDEIVQELVASVQTRVPEKLEMEGASESLFVKDLQGRLNSLTTVLGQEVDRFNNLLKLIHTSLETLNKAIAGFVVMSEEMEKVYNSFLNNQVPALWSNTAYPSLKPLGSWVKDLILRTSFVDLWLKRGQPKSYWISGFFFPQGFLTGTLQNHARKYNLPIDELSFKYSVIPTYRDQAAVIEAAKTVQFGQELPMDMELPSPED-GVLVHGMFMDASRWDDKEMVIEDALPGQMNPVLPVVHFEP----QQNYKPSPTLYHCPLYKTGARAGTLSTTGHSTNFVVTVLLPSKRSKDYWIAKGSALLCQLSE 4158          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 610.527 bits (1573), Expect = 8.062e-175
Identity = 518/2120 (24.43%), Postives = 990/2120 (46.70%), Query Frame = 3
Query: 6126 GCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRR--RGLYKPPQDKT--LVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPS-ASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGF---EITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVV-LKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANK-----SLDEVEIKQDVR---------------EKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSS--DIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGG----ISLDSPQKNPVP---DWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEE---RLSPL----ERLVVIRCLCPEKVIPAVISYI-VGFLGHEYVEPPAFD-LELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQG-PIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFIN---------DYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSE--CFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTI-------IEDLASDILSKLPQIFQIEEIHMKYPVL-YEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIK--FFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVL 12278
            G W  W S +  P ++         ++++PT+DTVR    L   L    KP++  G  G+GK+  + A +      ++    ++ FS+ T+ + +  +F    + RR   G+   P   +  LV+F D+I++P  +KYG Q  +  LRQL++   ++   D++ + +E +    A   P+   R  +TSR LRH  I+ +D     +++ I+       FN         ++ L+  + +A  D++ +   HF     + HYV++ R+ +R ++G  + +++  L++L+ E    +L+RLW HE  R+F DRL++ E+     E   K+V+ T  E++   FG+      R      R L++  +L     P        V++E E++ Y          +   FY +E ++       LVLF   ++H+ RI R+ RQ  GH LL+G  G+G+ + ++   ++    +FQ+++   Y+ +D+ +D+R ++R  G +  +  F+  +  + +T FLE +N LL +G++P LFE  D    +    +   Q+   I  +   +Y  F ++V +NLH+V T +P G     R    P+L N C +NWF  W E+AL  V ++      LD  + +  VR               + +V      H++V   ++   +   R+   TP  +L+ IK F++L ++K+ ++   K   ++GL K+  +E Q+  +Q  L+    +L E  +     +K +  +  + E+ +K  ++ +     + +     K   E++LA+  P +  A  A+  +K++ +  VK+M +PP  VKL +EA+CIL G      TD         W   ++++    F+  +  +D + +    ++++  +YI NP ++  K+   S AC  +  W RA  +Y  +L  V P + +L   E     +  + KV    + E+E  + K +E +     +  +++ ++   + K+ R+ +L++ L  E+ RW    +  + + D+++GD LL +  +AY G +    R E    W N   +  +    +          D  R+ +WQ+  LPVD    +NA+++   NR+ L+IDP GQA ++I K  + +N ++     D+ + + LE+ L+FG   L+++V E  D +L  VL ++  +      I +GD  ++ S  F+ ++ TR     + P+   +VT VNF +T + L  Q L  V   E+P+++K+R  L+        +L+ +E  +L  L+ SKG IL+D   IE L   K  + +++ K    +K   E++ V   Y+ ++   S ++ T+  L  +  +Y YSL + + ++ H ++  E SS  D   RL+ + +   + V++ + R +   DK+L + LL     +           F L  G    ++ +    + +P   D+L+ ++   +     +  F+        N     S + +  P     P  W++   +LSPL      L+V+  L P++++ +    +   F  H   +    D L +   E     P++   + G D    +   A   N     L  +++G  +G   A+S +  + KS  W++L+N HLA SWL +L K      L   + +  FRL+LT+      P ++L+ S  +  EP  GL+ANLLRS ++ P       + +K P    +L   +C+ HA+VQER  Y  +GW+  YEF+D+DL+++   L   ++         + E +    L  L  +C YGG++ +  D+ L+  +L +++  +    +    P  +    L     S  +  +  ++       P   GL  NAE     +    +  ++L    +E++      + +       + +LA   L  LP+    E + M+  V   ++ +     +E+   ++L++ IR+ L ++ +  R      N    +  S+  G+VP+ W +Y+ P    +  +++DL  R+K        DN +  TFW+ G +  ++++T   Q  A+ N  ++++L+    I            G  I G     G   +E C L++S   ++
Sbjct: 1553 GDWQPWLSKV--PTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAE-HKPLVLCGPPGSGKTMTLLAALRS---QQEMEVVNVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGT-----FNRAMLKMTPAVRGLADQLTNAMVDVYLASQEHF-TQDDQPHYVYSPRELTRWVRG--ISEAITPLESLSAE----QLVRLWAHEAIRLFQDRLVTEEE----REWTDKLVDTT-AERY---FGNAC----RLDEALKRPLLYSCWLSRNYVP--------VTRE-ELQDYVSA-------RLKGFYEEELDV------KLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEG-DEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLG--ENVGTD---------WKAIRQVMMKDDFMTRILQFDTELLTPEILKQME-KYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDD-RL-QWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKN-IQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVENKKSIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPE-SNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVETN---RQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEK-----RLHSMKPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQ-----RLTKAPTERSRLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPK----EIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHIGRTDSTDVFRISGIDIRGAK-SVGGNKLELCELVKSECDIV 3584          

HSP 2 Score: 545.043 bits (1403), Expect = 6.638e-155
Identity = 356/983 (36.22%), Postives = 551/983 (56.05%), Query Frame = 3
Query: 2730 PMRCAA-----TIKAKLEKF-KINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMG------LDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIF-GSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEE-TVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQIS--------RCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKS---LVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFL-FEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQX---------XXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDY----QDLTRILIERL---RTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFR---EHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIY 5543
            P++C        +K  L  + K+N+ ++  L +  LK+RHW  M  ++      R++  LSD L +G      + +H   + ++   A  E +LE+    M+  WQ        Y +    ++   DD+   L++H    S M+ SP+   FE     WD+ L+++    + W+ VQ  W+YLE +F GSA+I   +P E  +F  +      +M KV    ++++V+        L+    +L +IQK L +YLE++R  FPRF+F+ +E+LLEI+  +KD  R+Q HLKK F GI+ +   EE   IT   S E E+V     +   +    +  W+  +E  MK +L   +  +LT +++++          +W+  +P QV+   + + W ++    +      E +   +Q +   +EL+ D  LK    + R  +EA I   VH RD   KL+S ++ + +DF W+  MR+Y+  + K        V++M  ++  YG+EYLG   RLV TPLTDRCY T+  A+   LGG+P GPAGTGKTE+ K L   + +  +VFNC +  D+++MG+   GL Q GAW CFDEFNR+E  +LS ++QQIQTIQ A+R   +M +   G  L ++ +  IFITMNPGY+GRS LPDNLK LFR++AM  PD  LIA++ L+S GF  A TLA KIV ++ LC EQLS Q HYD+G+RA+K VL +AG +            L  + E++++++S+ +  +PK +  DI L   ++SD+FPG+           Q L+ +  E L     ++ E    +LDK++Q+Y++  + HGLM+VG S  GKT A+K L   L  L +  N+E   +  +I+ KA+S   LYG  D  + EW+DG+     R   ++   E+D R+WIIFDG VD  W+EN+N+VLDDNK L L +GE + +     +IFE  DL+ A+ ATVSRCGM++
Sbjct:  409 PVKCRTYKSYEHVKQMLHTYGKMNM-LVAELKSEALKERHWHQMMKEM------RVNWNLSD-LTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNY-QNKTRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEEDRSITAFHSREGEKVDLVKIVSTKDVR--INDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENV---EQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYF--DPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVL---LKALERWENVEG--VAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVW 1370          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 609.757 bits (1571), Expect = 2.139e-174
Identity = 519/2120 (24.48%), Postives = 992/2120 (46.79%), Query Frame = 3
Query: 6126 GCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRR--RGLYKPPQDKT--LVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPS-ASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGF---EITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVV-LKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANK-----SLDEVEIKQDVR---------------EKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSS--DIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGG----ISLDSPQKNPVP---DWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEE---RLSPL----ERLVVIRCLCPEKVIPAVISYI-VGFLGHEYVEPPAFD-LELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQG-PIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYE----DVQLEALTYLT-----GECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSE--CFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTI-------IEDLASDILSKLPQIFQIEEIHMKYPVL-YEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIK--FFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVL 12278
            G W  W S +  P ++         ++++PT+DTVR    L   L    KP++  G  G+GK+  + A +      ++    ++ FS+ T+ + +  +F    + RR   G+   P   +  LV+F D+I++P  +KYG Q  +  LRQL++   ++   D++ + +E +    A   P+   R  +TSR LRH  I+ +D     +++ I+       FN         ++ L+  + +A  D++ +   HF     + HYV++ R+ +R ++G  + +++  L++L+ E    +L+RLW HE  R+F DRL++ E+     E   K+V+ T  E++   FG+      R      R L++  +L     P        V++E E++ Y          +   FY +E ++       LVLF   ++H+ RI R+ RQ  GH LL+G  G+G+ + ++   ++    +FQ+++   Y+ +D+ +D+R ++R  G +  +  F+  +  + +T FLE +N LL +G++P LFE  D    +    +   Q+   I  +   +Y  F ++V +NLH+V T +P G     R    P+L N C +NWF  W E+AL  V ++      LD  + +  VR               + +V      H++V   ++   +   R+   TP  +L+ IK F++L ++K+ ++   K   ++GL K+  +E Q+  +Q  L+    +L E  +     +K +  +  + E+ +K  ++ +     + +     K   E++LA+  P +  A  A+  +K++ +  VK+M +PP  VKL +EA+CIL G      TD         W   ++++    F+  +  +D + +    ++++  +YI NP ++  K+   S AC  +  W RA  +Y  +L  V P + +L   E     +  + KV    + E+E  + K +E +     +  +++ ++   + K+ R+ +L++ L  E+ RW    +  + + D+++GD LL +  +AY G +    R E    W N   +  +    +          D  R+ +WQ+  LPVD    +NA+++   NR+ L+IDP GQA ++I K  + +N ++     D+ + + LE+ L+FG   L+++V E  D +L  VL ++  +      I +GD  ++ S  F+ ++ TR     + P+   +VT VNF +T + L  Q L  V   E+P+++K+R  L+        +L+ +E  +L  L+ SKG IL+D   IE L   K  + +++ K    +K   E++ V   Y+ ++   S ++ T+  L  +  +Y YSL + + ++ H ++  E SS  D   RL+ + +   + V++ + R +   DK+L + LL     +           F L  G    ++ +    + +P   D+L+ ++   +     +  F+        N     S + +  P     P  W++   +LSPL      L+V+  L P++++ +    +   F  H   +    D L +   E     P++   + G D    +   A   N     L  +++G  +G   A+S +  + KS  W++L+N HLA SWL +L K      L   + +  FRL+LT+      P ++L+ S  +  EP  GL+ANLLRS ++ P       + +K P    +L   +C+ HA+VQER  Y  +GW+  YEF+D+DL+++   L   ++       +V+ E L + T      +C YGG++ +  D+ L+  +L +++  +    +    P  +    L     S  +  +  ++       P   GL  NAE     +    +  ++L    +E++      + +       + +LA   L  LP+    E + M+  V   ++ +     +E+   ++L++ IR+ L ++ +  R      N    +  S+  G+VP+ W +Y+ P    +  +++DL  R+K        DN +  TFW+ G +  ++++T   Q  A+ N  ++++L+    I            G  I G     G   +E C L++S   ++
Sbjct: 2485 GDWQPWLSKV--PTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAE-HKPLVLCGPPGSGKTMTLLAALRS---QQEMEVVNVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGT-----FNRAMLKMTPAVRGLADQLTNAMVDVYLASQEHFTQDD-QPHYVYSPRELTRWVRG--ISEAITPLESLSAE----QLVRLWAHEAIRLFQDRLVTEEE----REWTDKLVDTT-AERY---FGNAC----RLDEALKRPLLYSCWLSRNYVP--------VTRE-ELQDYVSA-------RLKGFYEEELDV------KLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEG-DEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLG--ENVGTD---------WKAIRQVMMKDDFMTRILQFDTELLTPEILKQME-KYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDD-RL-QWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKN-IQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVENKKSIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPE-SNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVETN---RQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEK-----RLHSMKPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQ-----RLTKAPTERSRLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPK----EIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHIGRTDSTDVFRISGIDIRGAK-SVGGNKLELCELVKSECDIV 4516          

HSP 2 Score: 545.428 bits (1404), Expect = 7.422e-155
Identity = 356/983 (36.22%), Postives = 551/983 (56.05%), Query Frame = 3
Query: 2730 PMRCAA-----TIKAKLEKF-KINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMG------LDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIF-GSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEE-TVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQIS--------RCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKS---LVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFL-FEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQX---------XXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDY----QDLTRILIERL---RTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFR---EHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIY 5543
            P++C        +K  L  + K+N+ ++  L +  LK+RHW  M  ++      R++  LSD L +G      + +H   + ++   A  E +LE+    M+  WQ        Y +    ++   DD+   L++H    S M+ SP+   FE     WD+ L+++    + W+ VQ  W+YLE +F GSA+I   +P E  +F  +      +M KV    ++++V+        L+    +L +IQK L +YLE++R  FPRF+F+ +E+LLEI+  +KD  R+Q HLKK F GI+ +   EE   IT   S E E+V     +   +    +  W+  +E  MK +L   +  +LT +++++          +W+  +P QV+   + + W ++    +      E +   +Q +   +EL+ D  LK    + R  +EA I   VH RD   KL+S ++ + +DF W+  MR+Y+  + K        V++M  ++  YG+EYLG   RLV TPLTDRCY T+  A+   LGG+P GPAGTGKTE+ K L   + +  +VFNC +  D+++MG+   GL Q GAW CFDEFNR+E  +LS ++QQIQTIQ A+R   +M +   G  L ++ +  IFITMNPGY+GRS LPDNLK LFR++AM  PD  LIA++ L+S GF  A TLA KIV ++ LC EQLS Q HYD+G+RA+K VL +AG +            L  + E++++++S+ +  +PK +  DI L   ++SD+FPG+           Q L+ +  E L     ++ E    +LDK++Q+Y++  + HGLM+VG S  GKT A+K L   L  L +  N+E   +  +I+ KA+S   LYG  D  + EW+DG+     R   ++   E+D R+WIIFDG VD  W+EN+N+VLDDNK L L +GE + +     +IFE  DL+ A+ ATVSRCGM++
Sbjct: 1341 PVKCRTYKSYEHVKQMLHTYGKMNM-LVAELKSEALKERHWHQMMKEM------RVNWNLSD-LTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNY-QNKTRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEEDRSITAFHSREGEKVDLVKIVSTKDVR--INDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENV---EQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYF--DPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVL---LKALERWENVEG--VAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVW 2302          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 609.757 bits (1571), Expect = 2.139e-174
Identity = 519/2120 (24.48%), Postives = 992/2120 (46.79%), Query Frame = 3
Query: 6126 GCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRR--RGLYKPPQDKT--LVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPS-ASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGF---EITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVV-LKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANK-----SLDEVEIKQDVR---------------EKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSS--DIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGG----ISLDSPQKNPVP---DWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEE---RLSPL----ERLVVIRCLCPEKVIPAVISYI-VGFLGHEYVEPPAFD-LELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQG-PIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYE----DVQLEALTYLT-----GECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSE--CFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTI-------IEDLASDILSKLPQIFQIEEIHMKYPVL-YEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIK--FFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVL 12278
            G W  W S +  P ++         ++++PT+DTVR    L   L    KP++  G  G+GK+  + A +      ++    ++ FS+ T+ + +  +F    + RR   G+   P   +  LV+F D+I++P  +KYG Q  +  LRQL++   ++   D++ + +E +    A   P+   R  +TSR LRH  I+ +D     +++ I+       FN         ++ L+  + +A  D++ +   HF     + HYV++ R+ +R ++G  + +++  L++L+ E    +L+RLW HE  R+F DRL++ E+     E   K+V+ T  E++   FG+      R      R L++  +L     P        V++E E++ Y          +   FY +E ++       LVLF   ++H+ RI R+ RQ  GH LL+G  G+G+ + ++   ++    +FQ+++   Y+ +D+ +D+R ++R  G +  +  F+  +  + +T FLE +N LL +G++P LFE  D    +    +   Q+   I  +   +Y  F ++V +NLH+V T +P G     R    P+L N C +NWF  W E+AL  V ++      LD  + +  VR               + +V      H++V   ++   +   R+   TP  +L+ IK F++L ++K+ ++   K   ++GL K+  +E Q+  +Q  L+    +L E  +     +K +  +  + E+ +K  ++ +     + +     K   E++LA+  P +  A  A+  +K++ +  VK+M +PP  VKL +EA+CIL G      TD         W   ++++    F+  +  +D + +    ++++  +YI NP ++  K+   S AC  +  W RA  +Y  +L  V P + +L   E     +  + KV    + E+E  + K +E +     +  +++ ++   + K+ R+ +L++ L  E+ RW    +  + + D+++GD LL +  +AY G +    R E    W N   +  +    +          D  R+ +WQ+  LPVD    +NA+++   NR+ L+IDP GQA ++I K  + +N ++     D+ + + LE+ L+FG   L+++V E  D +L  VL ++  +      I +GD  ++ S  F+ ++ TR     + P+   +VT VNF +T + L  Q L  V   E+P+++K+R  L+        +L+ +E  +L  L+ SKG IL+D   IE L   K  + +++ K    +K   E++ V   Y+ ++   S ++ T+  L  +  +Y YSL + + ++ H ++  E SS  D   RL+ + +   + V++ + R +   DK+L + LL     +           F L  G    ++ +    + +P   D+L+ ++   +     +  F+        N     S + +  P     P  W++   +LSPL      L+V+  L P++++ +    +   F  H   +    D L +   E     P++   + G D    +   A   N     L  +++G  +G   A+S +  + KS  W++L+N HLA SWL +L K      L   + +  FRL+LT+      P ++L+ S  +  EP  GL+ANLLRS ++ P       + +K P    +L   +C+ HA+VQER  Y  +GW+  YEF+D+DL+++   L   ++       +V+ E L + T      +C YGG++ +  D+ L+  +L +++  +    +    P  +    L     S  +  +  ++       P   GL  NAE     +    +  ++L    +E++      + +       + +LA   L  LP+    E + M+  V   ++ +     +E+   ++L++ IR+ L ++ +  R      N    +  S+  G+VP+ W +Y+ P    +  +++DL  R+K        DN +  TFW+ G +  ++++T   Q  A+ N  ++++L+    I            G  I G     G   +E C L++S   ++
Sbjct: 2485 GDWQPWLSKV--PTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAE-HKPLVLCGPPGSGKTMTLLAALRS---QQEMEVVNVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGT-----FNRAMLKMTPAVRGLADQLTNAMVDVYLASQEHFTQDD-QPHYVYSPRELTRWVRG--ISEAITPLESLSAE----QLVRLWAHEAIRLFQDRLVTEEE----REWTDKLVDTT-AERY---FGNAC----RLDEALKRPLLYSCWLSRNYVP--------VTRE-ELQDYVSA-------RLKGFYEEELDV------KLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEG-DEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLG--ENVGTD---------WKAIRQVMMKDDFMTRILQFDTELLTPEILKQME-KYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDD-RL-QWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKN-IQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVENKKSIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPE-SNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVETN---RQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEK-----RLHSMKPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQ-----RLTKAPTERSRLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPK----EIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHIGRTDSTDVFRISGIDIRGAK-SVGGNKLELCELVKSECDIV 4516          

HSP 2 Score: 545.428 bits (1404), Expect = 7.422e-155
Identity = 356/983 (36.22%), Postives = 551/983 (56.05%), Query Frame = 3
Query: 2730 PMRCAA-----TIKAKLEKF-KINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMG------LDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIF-GSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEE-TVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQIS--------RCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKS---LVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFL-FEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQX---------XXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDY----QDLTRILIERL---RTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFR---EHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIY 5543
            P++C        +K  L  + K+N+ ++  L +  LK+RHW  M  ++      R++  LSD L +G      + +H   + ++   A  E +LE+    M+  WQ        Y +    ++   DD+   L++H    S M+ SP+   FE     WD+ L+++    + W+ VQ  W+YLE +F GSA+I   +P E  +F  +      +M KV    ++++V+        L+    +L +IQK L +YLE++R  FPRF+F+ +E+LLEI+  +KD  R+Q HLKK F GI+ +   EE   IT   S E E+V     +   +    +  W+  +E  MK +L   +  +LT +++++          +W+  +P QV+   + + W ++    +      E +   +Q +   +EL+ D  LK    + R  +EA I   VH RD   KL+S ++ + +DF W+  MR+Y+  + K        V++M  ++  YG+EYLG   RLV TPLTDRCY T+  A+   LGG+P GPAGTGKTE+ K L   + +  +VFNC +  D+++MG+   GL Q GAW CFDEFNR+E  +LS ++QQIQTIQ A+R   +M +   G  L ++ +  IFITMNPGY+GRS LPDNLK LFR++AM  PD  LIA++ L+S GF  A TLA KIV ++ LC EQLS Q HYD+G+RA+K VL +AG +            L  + E++++++S+ +  +PK +  DI L   ++SD+FPG+           Q L+ +  E L     ++ E    +LDK++Q+Y++  + HGLM+VG S  GKT A+K L   L  L +  N+E   +  +I+ KA+S   LYG  D  + EW+DG+     R   ++   E+D R+WIIFDG VD  W+EN+N+VLDDNK L L +GE + +     +IFE  DL+ A+ ATVSRCGM++
Sbjct: 1341 PVKCRTYKSYEHVKQMLHTYGKMNM-LVAELKSEALKERHWHQMMKEM------RVNWNLSD-LTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNY-QNKTRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEEDRSITAFHSREGEKVDLVKIVSTKDVR--INDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENV---EQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYF--DPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVL---LKALERWENVEG--VAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVW 2302          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 500.36 bits (1287), Expect = 3.097e-141
Identity = 370/1158 (31.95%), Postives = 611/1158 (52.76%), Query Frame = 3
Query: 2217 LNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSH------PEYKGP---MRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDT----PLSDMLAMGLD--KHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKET-GVNI---------LCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKF--TEETVITGMLSAESEEVKF--AYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIK-SHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNP---GYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWI 5591
            ++N   TW DR   +LD     +  + E   + +E   K   +    LKA+ ++F  RN   DA++ ++E  +M + +    E++ Q  Q    LS G +    +  +        D + +      +  D W+   I E+   E++  +Q  W      T +F         + KG       +  +   +E FK     ++      L   HW  M   +G    PR  T      +D+L++  +  ++ + L +++S+A  E ++  A   +     +  F+   YK + G N+         + ++ D Q LL+       ++++SP+   F  +   W+  L  L   L    ++Q  W+YLEPIFG    R  +P E  +F  VD ++R I+N V+ D++++++    +L + L+     L + QK LN +LE+KR  FPRF+F+ +++LLEIL ++ +P  +Q H+KK F+GI++++F  T ET+I+ M+S+E E V    A  I P      VE W+ ++   M+ +L+++  +A+           +  +P QV+  A  V ++    N +  S  L  F  +  +++ +   +  D+ +  L    L++ I+  +H  DVV +LL+++  S + + W  Q+R+Y        L N  +V+R V++E  Y YEY GN ++LV TPLTD+CY TL  A+ + LGG P GPAGTGKTE+ K LA  + +Q +VFNC +G+D  SMG+ F G+ + GAW CFDEFNR++  VLS ++ QIQTIQ AI+ +     F G  ++++ +  IF+T+NP   GY GR ++PDNLK LFR V M  PD  LI+   LYS GFV+A  LA KIV++++L  + LS Q HYD+G+RA+K VL   G L+R      E  +V+++++   L K    D   F+ +I D+F  V K +  +++L   L    + M ++     ++K+ Q+YE +  R G+++VG +  GK+  +K L  +L    K L +         NPKA++   L G  D  + EWSDGI+    RE  + ++    WI+ DG +D  W+E +N+VLDDN+ L + SGE IQ  +  N +FE + L+ ASPATVSR GMIY+    +    ++  W+
Sbjct:  970 IDNLEQTW-DRFELMLDGHQSMIKDQVEVLKSNVETSVKGMKDEAEKLKARWEQFKPRN---DALQGDRE--EMLKAIQFIKEKRVQWQQ----LSDGREKIEKECGQFGLEPPKMDIIDEIDEDIKQFEDNWL---IYEMFNNELDTMSQEEWIVFRSKTYLFDEFLQKWMEKLKGTGSQTHMSVRLMKDVEHFKEVSSALKFCRGDVLSADHWHEMFRFLGL---PRGTTIEKLKFADLLSVSKNIIENTDQLKQLNSRAQGEVAIRDAIQELTLWAAQTEFTLADYKHSNGQNLKIIKEWKESINSLKDSQALLQ-------SLKSSPYYSQFTDKTAVWETRLADLDVFLAQMNEIQRKWIYLEPIFG----RGALPSEASRFSRVDSEYRAILNDVSKDARLVSLCSRQSLKKSLEQIVDQLNRCQKALNQFLEQKRTAFPRFYFIGDDDLLEILGQSTNPQVIQTHMKKLFQGINRVQFSSTGETIIS-MVSSEGETVPLSKAVRIVPQ-----VESWLQELSDEMRRTLKDLTAQAVADAQPS-----LAKYPSQVLCLAEEVKFSASIENNLNGSSDLNSFKSQLLEKLKAYTNMKVDDKVSDL---KLKSLILDLIHHIDVVDQLLTNQAKSINSWTWQRQLRFY--------LVNGGIVLRQVSSEFEYTYEYQGNYAKLVHTPLTDKCYLTLTQAMYMGLGGNPYGPAGTGKTESVKALAALMGRQVLVFNCDEGIDVTSMGRIFTGIVECGAWGCFDEFNRLDSTVLSAVSMQIQTIQGAIKSRAGSCTFGGKNVQVNPNSAIFVTLNPAGKGYGGRQKMPDNLKQLFRAVVMGKPDNELISSTILYSEGFVDATALARKIVSVFQLSRQMLSKQQHYDWGLRALKVVLGGCGALRRTQTNKNETDLVVQALLLNTLSKLTFSDSERFNSLIDDIFSNVTKEMTKFEELVEPLGVAAQEMGIKLGDKQMEKVFQLYEQMRQRIGVVVVGAAGSGKSTIWKILQRSLILTKKPLKVTQ------FNPKAVNRSKLLGNMDMDTREWSDGIITMAARE-VTKDTSVHHWIVCDGDIDPEWVEALNSVLDDNRLLTMPSGERIQFGSNVNFLFETDSLQFASPATVSRMGMIYISEEDVTPKDIVASWL 2071          

HSP 2 Score: 433.721 bits (1114), Expect = 5.083e-121
Identity = 503/2108 (23.86%), Postives = 947/2108 (44.92%), Query Frame = 3
Query: 6207 LIPTVDTVRQRFFLTRILKNG-RKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQ----VQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLI-IEDVLICSAM-AIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMT-------FKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYN-EITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRIN---YVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCM---VKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIR-LQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVP-DWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQ-----KWKSIVDSKTPHLEK-FPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKIS---IRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNA-APEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILS---KLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLW-SQYSYPS--LKPLGSYISDLIARIKFFQ---NWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESH-SKVLYDLLPVINILPTLKSH--INWENSYHCPVYKTAARRGVLST 12395
             + T DT R    +   L++G R+  +  G TG GK  ++K    +   ++     SL  SAQ+SS      +Q +     +   R +++P     +++F+  I++P  +KYG    + +L+QL+ ++ +FD   N   + IE++    +M  I   +  ++++RL      ++++  D   +  I++     +     E   +R S++I +   DI+  V ++F PT +   ++F+ RD          L + V+  L  E    KL  +   E  R+F DRL +  D   F E+++ V+ ++       FKEK +V  G      +  T   +  +   DF       N++L+        EI  +N  +T + A F                              A I R+L  P GH  L G  G GR+ + +L   + + ++F   +T  +S   + ++++  +            +  DHQ+++  FL+ IN LL SG++P LF  ++   +   +  + +  N      A+  +     R+R  +H+VL      + F   +   P+++  C + +   +  ++L          VEI      KI +  Q    + + L+  F +V+  +     + P  Y + ++ F  LL  K++ +    ER   G+ KL  + ++++ MQ +       L E   E ++ +K I       E  +  +++ +A      V+ E+ K+  D+    L E  P+++ A  A+ ++K   +S +++++ PP+ V+ +++AV +  G+            ++  W   +K L      D + ++D + I     +K+  L    +  F+    K  S+A   L  WV+A   Y +IL+ ++P + +        +    Q++     L  V+  + +L+  F+   +E T ++ +++  +  I  A  L+  L GE  RW   I         M    L+ +  + YLG  +   R+    L ++ CK  ++P + +     S           W+  GLP D  S++N  I+ ++    L+ID  GQ + ++ K      K E  K +    +  +E  ++FG   +++++  E DS L  +L K    Q   + I  G   ++++ DF+ Y  TR       P   V++ +VNF  T + L  Q+L +    EKPELE+R   L+ ++   + +L+ +E  +LQ L++S+GN+LE+   ++ L+ SK  +E I+     + +   E+   ++ Y P++   S LFF+ S+L   +PMY YS++  ++L+  +I++ E  S    R++ L       V+ +I R +F +D+L+F+            +  E  W  L TG +  +S   + +   W+S         L +L   +  L     N Q      W     SKT   E  FP + E +++  ++++ I+ + PE++   ++ +++  L    + PPAF+L+  F+ES+S  PI+F+L+ G DP  +L  FA   N+       +S+GQGQ   A   I ES     W+ L N HL    +P + K      L  +  + NFRLWLT+   + FP  +LQ S+K+T EPP G+R NLLR+YT    S ++              +F L + HA++QERR +   GW   YEF  SD++++   + QL     D+E V+   L ++     YGGR+ ++ D +++ S L  ++  E +          G  L  L T+++  Y+ HI +  P+   P +FGL  N + + +  E ++   SI         G++K++ +   D  S I+S   KL Q   + +  +   +   + ++ VL  E I    LI+ + +S+  +  +++   L    +++  +S+V  + P  W S ++ PS     L   +      ++ F+   +      P  F  S  ++   FL  + Q  +R+ +  +D+L              PA +   + GL L+   +   D  L E+  S   Y   P++ +  T +S   I  E     PVY ++ R  ++ +
Sbjct: 2197 FVQTADTQRYSDIIGSWLQSGNRESFLITGTTGCGKQQLLKHCFQNDPESQ---LASLYCSAQSSSSHLLQLIQQNCVQASNPTGR-VWRPKDRPNMILFLKGINLPAPDKYGTNELLALLQQLLTYQGFFDH--NLEWVSIENIQFVGSMNPIGDGAAVSISNRLFSLLRCVSLNTTDSSQLTSIYRT----YLTPILEEVGERNSEIIANRMVDIYNKVQSNFRPTDSVV-FLFSPRD----------LTNWVVSLLRHELDQGKLEAVICFEARRIFADRLPTENDKLKFEEILRNVIPISQANETVIFKEKVYVTTGTV-VPGESNTGLPLTPINMSDF-------NQLLAKSINRFAFEIANFNCPLTSQLAFF-----------------------------CACIDRVLTGPGGHLFLPGRPGFGRRDSVRLVAHMHNIQVFSPPVTANFSAKQFDNELKNAITQAVTNNEHVVLILEDHQLRKNIFLQAINSLLASGNVPGLFTQQE---LDGLVALVSEAANQASFTGALQQF--LAHRIRSLVHVVLILEVEANDFKINITENPAILKHCNVIFADRFDRNSL----------VEIP-----KIQMESQGITTTDAILTG-FNDVLVNLPEHLSIQPIKYRQFVENFFQLLGYKRLTLSVRLERLKGGVSKLNEARDEVAKMQKKAGKKSKLLAEKQAEADEALKAITESMSGAEDQKLSMEQLKAATEKENVRIEEQKAKIDE---QLKEVQPLIDEARRAVGSIKSESLSEIRSLRAPPEAVRDILQAVLLFMGI------------LDTSWEAMRKFLSKSGVKDDIMNFDANRITNEIHKKVTALVKQKSNSFEEANAKRASAAAAPLAAWVKANLEYSKILEKIAPLEGEKNKLVKNLKKAEKQMENLSKGLQSVDEVVGELKRKFEVLMKEATQIKVDLDREQDTIRIAGTLVESLSGEFERWKIQIETFGEEQSKMELCSLITSAFITYLGGCSEKDRKS---LLKSMCKMFNMPPTFKPLSFASL----ETEQLNWKTKGLPADQLSLENGSILFTSCHAPLIIDRSGQVSLFLSKF---LEKSETFKAAQPDLMTQIELAIRFGKTIIIDDI-VEFDSALIPILRKDLSSQGPRQVISFGGKSIDFNPDFKIYFCTRDEKVDIRPNSYVQLNIVNFTTTISALSAQLLDVAIHLEKPELEERSSSLLRDAELKKLELEGLEQLLLQQLASSQGNLLENTALLDSLNKSKESAEIITKSIVESEQLHKELTTQKDIYVPLSLFTSSLFFSFSNLQFHNPMYNYSVNTIMHLFGKTIKSCEDKSS--TRVETLARQMQLTVFYHISRGIFRQDRLMFAVAFINATMPKMFQPKE--WE-LFTGVLVDESTDLSALRVQWISPDR------LQSLARIRTHLPSLFNNFQIQDDATWNEF--SKTLQCENAFPKNVELKMTHFQKVLFIQAVKPERLYNCLMDFVLKTLNIPSINPPAFELKHIFQESESTEPILFILADGADPSQELSEFASSMNVP---YHSISMGQGQEIAAYEAIRESASKGEWLCLNNLHLMLQAVPSIFK-----HLSLTTPHENFRLWLTTEGDARFPSMMLQQSLKITFEPPPGVRNNLLRTYTQIDRSTKNVITCQS--------IFVLAWLHALLQERRTFIPQGWTKFYEFGASDVRVAKSFVEQLTANKADWEFVR-GILKFVI----YGGRIENDFDFKVLDSYLNVLFCDEKINGRAGSQLVKGIDL--LATTNVQEYIGHISKSVPSVDEPYLFGLPENIKYSWQIVEADRTISSIRTL----ALGDTKNALSDQSDKISQIVSLWKKLCQSDDLPKRELPTAIRSADPISEVLCLETINALSLIKQLHRSIGHVAKSMKTPSLASPAVQKTIQSLVFQQTPDEWDSMWAGPSDPADYLNVVVKKTRGTLQLFESSKSSSLLSSPIDF--SDLFYPNIFLNALRQTTSRQIKIPLDQLILSSAWTPSQ---LPAKQCVQVQGLLLQGATF---DSFLRETTVSSAAYSQAPIVFLAWTSESSSTITGEQ-IQVPVYSSSERSDLICS 4150          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Celegans
Match: dhc-3 (Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G5EDV4])

HSP 1 Score: 231.876 bits (590), Expect = 6.446e-60
Identity = 137/335 (40.90%), Postives = 215/335 (64.18%), Query Frame = 3
Query: 8088 TPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVIS 9092
            T    L+++ T   L  KK+ E+  +  +Y  G+EK++ +E Q++ MQ EL   QPQL+ TS ET  L+  IE ET++VE  R+VV   E      A  A+S+K + E+ LA A+P + +A+EAL+T+ Q+D+S +K M+ PP  V+L MEAVCIL G+KP K T+  G+++ DYW + +KLL D+ FL  ++S+ +DT+ +  ++ IR +Y++   FDP  +K  S A EGLC WV A+++Y++I K+V PK+E+L  AE + +  + QL+VK+  L +V  KL  L + F    Q+K +LE+ I   +V++ERAE+L+  L GEK +W   I+
Sbjct: 2096 TRAEKLKMVSTITKLAKKKREEVRKTMTKYEKGMEKMKRAEEQVAGMQGELLRLQPQLVRTSIETSMLMSTIEKETIDVENAREVVAANENKANEAATKAQSLKAESEAELASAIPALESAVEALETMTQSDVSSLKTMRFPPYAVRLCMEAVCILLGVKPAKITNEIGEVVNDYWVSGQKLLSDIHFLAKIRSFARDTVSKKTVKLIREKYLSKEEFDPENVKQCSLAAEGLCRWVLAIDMYNQISKIVEPKRERLRKAEVLVKQHLKQLEVKRKALLKVTEKLQGLSDQFSQMCQKKQELESQISSCEVRMERAERLVQALSGEKDKWKNKIT 2430          

HSP 2 Score: 134.035 bits (336), Expect = 2.192e-30
Identity = 153/653 (23.43%), Postives = 299/653 (45.79%), Query Frame = 3
Query: 2463 EEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKL--YDKWMNGPILEVDAEEVEAETQSLWKTAYRLT-KVFSHPEYKGPMRCAA-TIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKV---MNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKL-KFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYN-QISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVH----ARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSM 4382
            +++K I Q  LL   G+ +  +    I  + E F KL  S + F  L  ++  +   I +VD   +  ET+ L      L  K     E++   + A   I+  L +F+  LP++ A+    +K RHW  +       +    +  +S++L M   +  +   +V ++A KE  LE +  +M++ W  +  +F  ++  G  +L T  ++ V ++ H+ ++ T+ +SP        I HW  TL  L   ++ + +    W  +E +F + DI  Q+P E   F+ +  +W  I N++T +  +   M++++  NL  +L   E L  +++ G + YL KKR  FPR F LS+E +L ++ ++++P   + ++   F  ++   + T+  +I+  +S + E +     +    ++  VEKW+ +++  +K +LR  ++  +   N ++S  + + + P QV      + +T Q  N++K ++L           S +   +RD     L +     F+ +  H    +  +V KL++ +V   DD+ W SQ+RYYW  E        N+ IR+ T    Y YE  G    ++   L D   +  +        G   G         ++ +A A+ K   + +    +D K +
Sbjct:  586 KDEKLIGQRSLL---GLLSSPIDCVRIAKVCEFFSKL--STLHFKTLLHHESCLRMRISDVDHNSLVIETERLQSEKNDLKEKAAVIKEHETTSKEALLKIEIVLAEFEKLLPVLGAISCQAMKDRHWKMILQDSETSVKVEGNPLVSELLEMNFIEKADKFEQVGAQAEKERVLETSIEKMKSQW--VTATFVTHQ--GGELLTT--ELNVQMQAHLARSQTILSSPHAFSILDHIRHWLDTLLNLNTFVHLYKQCDTRWRKIEGVFSTEDIAYQMPHEFRTFKKISLRWLHINNQITEERPILEQMDLVQQLNL--ELSELEVLFGRMENGFHAYLRKKRAVFPRLFALSDELVLSLICDSREPANCKSYIPLLFPSLTTFDQNTKMEIIS--VSTKLETISLVKPVNVNLSKRHVEKWMHELDSQIKYTLRTRIRLLIEKMNYKLSPVETILNEPIQVAAVYLKIAFTWQMENSMKQNSLTIL-------ASELKICIRDCQHAVLHKHDRWEFLPVLYHIYKSSTHLVNKLMNEQVIFIDDYRWTSQLRYYWHLE--------NVFIRVGTVSTRYDYEVQG-VDCMIDNQLVDEAVKYFICMNHFGFNGFVNG----MDVNLARQIAGALGKPFAICDTEQEIDCKML 1203          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Fly
Match: Dhc36C (gene:FBgn0013810 transcript:FBtr0304742)

HSP 1 Score: 3122.41 bits (8094), Expect = 0.000e+0
Identity = 1729/3952 (43.75%), Postives = 2495/3952 (63.13%), Query Frame = 3
Query:  792 LTEKYPDVTNQFLIDTKQNFQTSVKKAILDYIL----LNKLEQKRLGLMMPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICE-STPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFI------KVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDE-AASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFS-HPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSH----TLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDY---QDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMT--DSPNQKYPRPKNL---KCARNLM--VPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHS---LTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNS-GFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXX--TAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSG-KLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEK-FPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELL-LSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVT------LPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHE-----YSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIAL---PSSQLVQHWINRGLAALCQLN 12497
            L  K+    N+ + + + ++  ++KKA++D++L    L++L ++ +G          V      W  +  +++  L K  +  H ++  +L  ++ KY +  LI  + + +  +P SL   V +C  +       L+ SW  +    L+ +  S    +P   + R   ++RFFNCVA L +  L  I   S+ E+ +FI       C  G+ +   G  +S +           L     + F PSF ++  +L ++ID+I+ S+    R+E+ L+       K+  TP++P        E  V   K ++   ++     P    Q +  F  L+N +  +    F+ +D     Y   + + K   D  A  +   + M  +    +     L    +QL++  L  M    +     +  +YD+I ++     + T++L++L+ YV       +  ++ +L+     +L+L+++T+    +I  N+ +F W  ++  I +     + ++       L+K  + F   L     Q++ ++    +      ++    + ++L + +E   QIN+EE      + + Y   ++     +P+  L+ +   F   +D WM+  +   D +E++ +  + ++   +L K    HP     M+    +KA++E F+ ++PII  L NPG+K RHW+ +S  +GF I    +  L  ++   LD+++     +S  A+KE +LE+A  +M N+W+ + FS +PY+++G   L  VDDIQ+LL+D I+KT TM++SP+I PFE++I  W+  L  L++ L+ WL+VQA W+YLEPIF S DI++Q+P EG +F  VD+ W+ +M +V+ D KVM V++ D + + L+ + +LLE IQKGLN YLEKKRLYFPRFFFLSN+ELLEILSETKDP RVQ HLKKCFEGI+ L FTEE  +T M S+E EEV     I   +A G VEKW+L++E  MK S+   + +A   Y ++ R  WV  WPGQ V + S  +WT + T   +S      L ++L+K   QI+ IV+LVR + L +  RITL A +VLDVHARDV+A++++++V    DF W+ Q+RYYW         ++NL  RM+   +PYGYEYLGNT RLV+TPLTDRCYRTL  A+ L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGLA  GAW+CFDEFNRI+LEVLSV+AQQI TIQR I       +FEGT L LD +C +FITMNPGYAGRSELPDNLK LFR+VAMMVPDYALI+EI LYS GF+ A+ L+ KIVA YRLCSEQLS+Q HYDYGMRAVKSVL AAG LK + R   E+ +VL+SI DVNLPKFL  DIPLF GI SDLFPG   P  DY      T++  ER      +  P+ L+K+ Q+YEMI+VRHGLM+VG  F GKT  ++ L+ AL  + K    EN  I+ +INPKAI++G LYG+FD VSHEWSDGILA  +R  A S+S +RKW+IFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQ++N  N++FEP DLE ASPATVSRCGMIY+EP  LG +PL+  W +  LP       +  + +L +   P  L  + +  K         L+ +++  +   +DD R+                           + N +++    +T  +   F  S IWS G  LD DS+ KF+  FR L E T   S    Y  P++L     A+  +  +PK+G++FD+ ++K+  G W  WQ  +       + +   ++ I+I T ++VR    L  + ++G KPIM VG TGTGKS  +  +ML  +   D  F+    ++FSAQTS++Q QD   SKLD+RR+G++ PP +   V+F+DD+SMP KE YGAQPP+E+LR ++DH  W+DRK+  P+ + D+ +  AM  PS     VT R  R FN+I+ID+F+++ +  IF  I+ WH ++ GF          IV AT  I+     + LPTPAKSHY+FNLRDFSRVIQG LL      +++      N + RLWVHE  RV+ DRL+   D    FE I   V+  F      LFG     +K    ++ R+L++ DF   K D                K Y E+ D E L + ++ YL EYN MSK PM+LVLFRFAIEH++RICR+++QP  H+LL+G+GGSGRQS  +LA+ ICD+E+FQ+E+TR Y   ++ +DI+ ++R  G   +   FLF D QIK+  FLEDI+ LLNSG++PNLF NE+++E+ EKM QI +Q++  ++   + + ++N F+   +  LH+VL  SPIGDA  +R+R FPS++NCCTI+WFQ WPEDAL  V+ + L   ++    R   + MC  FH S  +LS KF+  + R NYVTPTSYLELI+TF  LL++K+  I  ++ RY  G+ +L+ +  Q+++MQ +L A +P+L E S+   + +  +  ++   E+ R++VK +E+    +A  A+ IKD+C++ L EA+P++ +A+ AL+TL   DI++VK M++PP GV++VMEAVCILK +KP+K  +PSG   +EDYW  +K++L D+KFLD L ++DKD IP   M+K+  + ++N  FDP KIK+ S+ACEGLC WV A+  YD + K+V+PKK  LA AE+ Y   M  L  K   L +VE+ LA +Q+    + ++   L    E    K++RA++LI+GLGGE+ RW +    L   F ++ GDVL+ +G+V+YLGPFTI +R + +  W  +C  ++  V+  + F L+ VLG+PV +R W I GLP D+FS+++A+++ +  RW L+IDPQGQANKWIK  E + NKL VI+L+   Y RV+EN +QFG P LLEN+GEELD VLESVL K  FKQ     I+LGD V+EY+  FRFY+TT+LRNPHYLPE +VKVTL+NFMIT  GL+DQ+LGI  A+E+P+LE  +  LI++ A N+R LKE EDQIL++LS+++ NILEDE A++ILSS+K L+  IS KQ     TE +I+  R  Y P+A H +ILFFTI +LA++DPMYQYSL WF+NLY+ SI+N+E   DI  RL +L +HFT ++Y NICRSLFE+DKLLFS +L I + K  N++D   W FLLTGG+ L++P KNP   WL  ++W+E+  L+NL  FKG  +DF  N  +WK   DSK+P   K  P  W+ R+S  ++L+++R   P+K++PAV++++ G LG  +V+PP FDL  SF +S    P+IF+L+PG DP + L +FAE +      L  +SLGQGQGPIA   I E +K  NW++LQNCHLA S++P L KICE LL      +P+FRLWLTSYP+  FPV VLQN +KMTNEPPKGLR+N+LRS  + PISD +++++  +P++F++L++SLCFFHAV+QERR +G IGWNIPYEFN++DL+IS+ QL+MF+N YE V  +AL YLTGECNYGGRVTD+ DRR + ++L   Y   ++ L   + L E+G Y VP V  +++ YLN  +  P  +AP +FG H NA++ K+Q+ET+ L    L+T             ++ + + ++ ++A+DIL KLP++F  +   +KYP LY + MNTVL+QE++RFN L+  IR SL+ L+  ++GL++M   +E VY+S++I K+P++W+  SYPSLKPLGSY++D + R++F Q+W D+G P TFW+SGF+FTQ+FLTG  QNYAR+   +ID L FD+ ++   E      S P D G F++G++LE  RW      L ES  + L+D +P+I + P  +  +   ++Y CP+YKTA RRGVLSTTGHSTN+V  + L   P++  V HWI RG A LCQL+
Sbjct:  186 LLYKWQTALNENIAEVRADYVFAMKKAVVDFVLRHTVLDRLTKEGVGGKYDTAERREVQSMTNFWRYRYDENRNVLMKTLFCIHRSVASILELWSMKYKDKSLIDSKELAKVESPFSLFTFVYLCGSHIDNGKTLLEESWYGEIHSSLLKA--SKRGQLPD--IRRFTLVKRFFNCVAALMTQQLEDICIRSLKEYADFI-------CDYGHSN--PGFEISVM-----------LADEDTIQFNPSFSKVQSELLRVIDSIMLSIQMLPRIESKLYTDLIVSKKIFLTPTVP--------ESIVQETKNRICAMLEEQRIGPELRLQDFDPFIDLINGSDAERVGNFMESDATFEQYADMVYEYKEKEDRIAKEVWAVIRMGFYEFHRDKFITHLESLCRQLQLDLLARMVTDQQARITRLGKEYDAIAKKALTVPKDTAELMQLKAYVVHAEENLVPEMEARLKVNMSEILWLMDHTLYSPLEIKNNSNSFQWYLKLPSIFEQHRAIIAEKVIEYQELLKKRIELFRRELQNYYEQVQTYDTWGDIKQLSRYKKRAGVLDQRLVQAMETIDQINEEETSYGWDL-SQYPMRKKAHDQLKPYKTLFDAGQDFMDKWDLWMHSQVGSFDPDEIDGDVSNFYRIIQKLDKQMGDHP---ITMQLIQDVKAQIEAFREHMPIINTLGNPGMKARHWELVSEIIGFPIKVSPELTLEKIIEYQLDEYVPKFEAISESATKENNLERAMAKMVNEWEGVEFSISPYRDSGTFKLAAVDDIQILLDDQIIKTQTMKSSPYIKPFEADIIKWEAKLMLLQEILDEWLRVQATWMYLEPIFSSPDIQQQMPEEGRRFSAVDKIWKELMKQVSQDPKVMVVVQIDKMNDKLKKAYSLLEVIQKGLNAYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQIHLKKCFEGIATLNFTEELDVTAMRSSEREEVTLVDVISTSKARGQVEKWLLELEIDMKKSVHHKVSEAFYSYLKMLRHVWVLTWPGQCVQSISLTYWTLEITECFESEEPKENLAKYLQKCVLQINKIVDLVRGD-LNTQNRITLGALVVLDVHARDVLAEIVANQVEDLQDFQWLCQLRYYW--------EDNNLDTRMINCSLPYGYEYLGNTPRLVVTPLTDRCYRTLFAALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRGINSGSPTLVFEGTTLTLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALISEIELYSYGFLTAKPLSVKIVATYRLCSEQLSTQCHYDYGMRAVKSVLKAAGALKLRYRDENEDILVLRSIKDVNLPKFLNQDIPLFQGITSDLFPGTVLPEADYVLFNKCTQMACER---QNKQCTPFVLEKVQQLYEMIVVRHGLMLVGYPFGGKTTTYRVLAEALECMEKTDGSENKAIYTVINPKAITMGQLYGQFDAVSHEWSDGILAVNYRIFAISDSPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSNTTNLVFEPMDLEVASPATVSRCGMIYLEPSSLGWEPLVASW-KNTLPAAFHTVSKQLISMLISRFCPILLFILRKSLKEIAPTSDANLMVSLMNFFECFIDDFRD------------------------EKYVANVSDLDFRAQTEGI---FLFSCIWSLGGSLDADSREKFNIIFRALMEKTFPQSLYDTYGVPEDLYVESLAKPFIFPIPKQGSVFDYRYIKEGKGKWKPWQDDVNSAP--PIPRDIPVNQIIIQTNESVRIGAVLDLLNRHG-KPIMLVGPTGTGKSVYVIDYMLKKM---DLSFYKPLLISFSAQTSANQTQDIIMSKLDKRRKGVFGPPLNSRFVIFVDDVSMPLKENYGAQPPIELLRMMLDHMMWYDRKNIVPMKLIDLQMIVAMGPPSTGN-TVTPRFQRFFNVISIDDFNNDILNTIFSKIVLWHLDTRGFSKEFDPCIDEIVGATLTIYNDAKLNLLPTPAKSHYLFNLRDFSRVIQGVLLSVPEATEDV------NSMRRLWVHEVLRVYGDRLVEDADRSWLFENICSTVKSCFNTDPSRLFGRLVEKDKSLQESDFRQLIYCDFTNPKAD---------------TKNYVEVQDLEELRRVVEAYLVEYNNMSKKPMNLVLFRFAIEHLSRICRIIKQPRSHALLIGVGGSGRQSLTRLASHICDYELFQVEITRLYGPYEYHEDIKAILRKIGASEMHGVFLFTDVQIKDESFLEDISNLLNSGEVPNLFTNEEKIEVQEKMAQIDKQRDKAVQTDGSPVALFNFFVTTCKDQLHIVLAMSPIGDALRNRIRKFPSIVNCCTIDWFQSWPEDALLAVSTRFLASEDLTALERRTAIDMCMEFHTSTQELSAKFFSRLHRYNYVTPTSYLELIQTFKALLSQKRNNITNNRNRYLTGISQLDIAAQQVAVMQEQLIALEPKLKEASEIVAEQVAKVTADSKLAEEQREIVKLDESAAKEQAAVAQEIKDECDAKLGEALPILESALAALNTLTTADIAVVKTMKSPPIGVRIVMEAVCILKDVKPDKVPNPSGLGTVEDYWGPSKRVLSDMKFLDSLLNFDKDNIPVEVMKKLAQRILSNEAFDPDKIKSASTACEGLCRWVIALTKYDVVAKIVAPKKLALAEAEATYNAAMKTLNEKLAMLAKVEANLAAIQKILDEQLRQYGILLAEHEACTKKLQRAQELISGLGGERTRWSETAKMLQASFKSVTGDVLISSGVVSYLGPFTIDFRVDQIRKWVTKC--LNFGVTCTADFQLAVVLGEPVEIRFWNICGLPTDAFSIESAIMMKNARRWPLMIDPQGQANKWIKNYE-KNNKLCVIRLNQADYTRVMENAIQFGLPVLLENIGEELDPVLESVLQKTLFKQGGALCIKLGDSVIEYNHSFRFYMTTKLRNPHYLPEVAVKVTLLNFMITTQGLQDQLLGITVARERPDLEAEKNNLIVQGADNKRMLKETEDQILEVLSSAE-NILEDETAVQILSSAKALANDISEKQVITEATEKQIDIARLSYVPIAEHSTILFFTIVELANIDPMYQYSLVWFVNLYMSSIDNTEKVDDIAARLLDLRNHFTYSLYVNICRSLFERDKLLFSLILNINMMKHDNRIDNAEWMFLLTGGVGLENPYKNPT-TWLGVQNWDELCRLTNLTNFKGLREDFNENSAQWKPFFDSKSPQDNKDIPKSWDNRVSVFQKLLLLRVFRPDKLVPAVLNFVSGELGERFVDPPQFDLMASFADSHCCVPLIFILTPGSDPTATLLKFAEDQGFGTNRLFSLSLGQGQGPIAMKMIDEGVKMGNWVVLQNCHLAASFMPLLEKICENLL--PDATHPDFRLWLTSYPADHFPVVVLQNGIKMTNEPPKGLRSNILRSMISDPISDPEWYESCTQPRIFKQLIYSLCFFHAVIQERRYFGPIGWNIPYEFNETDLRISLMQLRMFLNQYETVNYDALRYLTGECNYGGRVTDDWDRRTLKTILDKFYCPAVIDLETPYYLDETGLYYVP-VFKEVDLYLNFTRDLPQISAPAIFGFHANADIMKDQKETDMLLSHTLLTQDTSASSDDSGGSKALTPEEVVTNVATDILDKLPKLFDRDAALLKYPTLYHQSMNTVLVQEMVRFNVLLNTIRTSLITLRKGIKGLVVMSPAVEAVYKSVLIAKIPAMWAGKSYPSLKPLGSYVTDFLRRLEFLQHWFDHGAPSTFWLSGFFFTQAFLTGAQQNYARKYVISIDLLAFDYEVLTVEEPQRQGLSGPED-GVFVYGIFLEGARWDRTGKYLAESRPRELFDTMPLIWLKPLKRVDLPERHNYLCPMYKTAERRGVLSTTGHSTNFVVAMLLLCNPNTP-VSHWIIRGTALLCQLS 4023          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Fly
Match: Dhc62B (gene:FBgn0013811 transcript:FBtr0303106)

HSP 1 Score: 2717.57 bits (7043), Expect = 0.000e+0
Identity = 1490/3552 (41.95%), Postives = 2176/3552 (61.26%), Query Frame = 3
Query: 2019 ICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQ-------INQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWK------TAYRLT---KVFSHP--EYKG------------PMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSH------TLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQ----DLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLN----KELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPI-MDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLK--SVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFST---DNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEI-KQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDP-SGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKA-SKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTS--DLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESK---SSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            IC +++ I  R  +  ++T +L+E  EY+  ++  ++  L  +++   +    ++  T +      L   T  W   I  I D   YN +++ +        +++   E +  L + I E   +  + D +    +       L   I++ K        IN+EE L    + T Y +L  I T   PF +L K  + + +    W +GP   ++ + VE  T    K        YR+     +  +P  ++KG            P+R   ++   ++ F   + I+  +CNP L++RHW  MS   GFD+TP   T L  +L  GLD  L+    +S  A+KE  L  A   M  +W+  VF + PYKETGV IL ++DDIQ LL+DHI+KT  MR S F+ P E E+  W + + R+ + L+ W KVQA +LYL PIF S DI  Q+P EG  F IV++ +   M  V     VM       LLE LQ +  LLE I  G+++YLEKKRLYFPRFFFL+N+E+LEILSETKDPLRV PHL KCFEGI+ L+F     +  M+S++ E ++F   +    A G VEKW++ VE  M  ++R   + +   Y ++ R +WV +WP   VLA S V+W  +    ++         +  F ++  ++++ IV LVR   + +L RIT+++ IV+DVHA+DV   L+ ++VSSE DF W++QMRYYW         +D   +R++   VP+  EYLGN+ RLVITPLTDRCYRTL+GA +L+L GAPEGPAGTGKTET+KDLAKA+A QC VFNCSDGLDYK+MGKFFKGLA  GAWACFDEFNRIELEVLSV+AQQI  I +A+R     F+FEGTEL L+ +C + ITMNPGYAGRSELPDNLKVLFR+VAMMVPDYA+I EISLYS GFV+AR LA KIV  YRLCSEQLSSQ+HYDYGMRAVK+VL+A G +K++     E+ ++L+S+IDVNLPKFL  D+PLF+GIISD+FPG++ P IDY     +  R+ +E +    LEP P FL K+IQ YEMI+VRHG M+VG+   GK+   + L+  L  L     ++ N    V   I+NPK+I++  LYG FD +S+EW+DG++AK FR+ A + + +RKW+IFDGPVDA+WIENMNTVLDDNKKLCL SGE+I M+N+ +M+FE  DL QASPATVSRCGMIYMEP  LG     K W+++  P + D+E    V  L  WL+PP   F+ R C  ++K G    +     L+   + +                              I    E  ++    +  A    +LIW  G +LD  S+ KFD F + L + TD P    P P        +  P +G + D++F+ KQ G W  W  L ++ D++E  KT     +++PTVDT R    L ++    +K ++ VG TGTGK+  ++ ++++ L  + F    +TF+   S++Q QD   SKL + +RG+Y PP+    V+F+DD++MP KE YGAQPP+E+LRQ  D+   +D KD++ + I +VLI +A  +P  SR  V +R L HFN+ +I+ F D++M  IF  + ++    +G    +  ++  IV AT  I++SV +    TP+KSHY+FNLRD SRV+ GC L++  SV  K +         +R+W HE  RVF+DRL+   D    F+ + + ++  FK+K   +F  +     D    T      ++FG +      P+E             + Y E+   E         LD+YN   +  MD+ LF FA++H+ RICR++      +L++G+GGSGRQS  KLAT +     FQ E+T+ Y  +DW DDI+ +++  G     TTFL  ++QIK   FL+DI+ LLN G++PN+F  +++ E++E ++   Q  N  I+++A+ +++ F++R ++ LH++L+FSPIGDA  +R+R +PSL+NCCTI+W+  WPE+AL+M+A  SL +V +  +D++  I+  CQ+FH + +  ++ F ++ GR  Y T  S++ELI++F  L+ +KQ E + +K RY  GL+ L  +   IS+MQ +L A QP+L+  ++ + K++  I  ET+      + VK +E    V+AE A+ +K DCE +LA+A+PV+  A+ AL+TLK  DI++VK+M+NPP  +KLVM AVC++KG+ PE+  DP SGK+++DYW  +K+LLG++ FL  LK +DKD IP   +++I  ++I N  FDP  +   SSA +GLC W+ A+ +YD + KVV+PKK KLA AE  Y   M  L  K+     +E K+A L         E    E + E  + K+ RAE LI GLGGEK RW K   DL   +D++ GDVL+  GI+AYL    + YR ECV+ W  +   + IP SS  + +   VLG  V ++ WQ+ GLP D FS +NA+I  +++R+SL IDPQ QAN W+K +E  +N+L  +K +   Y++V+   L++GTP ++ENV EEL+  L+ +L++QTF Q  +++I LG+ VV  + +FR Y+T  LRNPH+LPE   KVT++NF +T   L DQ+L IV AKE+P+L++ R  L  E+A+N+  L++ E+ IL+ LS   G+ILE+E AI+IL+ SK LS+ I  KQEAA +T  +I   R  YKPVA H SIL+++I+DL ++DPMYQ+SL+W+INLY++SIE +  S D+  R+K L   FTR +Y N+CRS+FEKDKLL+SF+L   I  G  +V+   +  L+T      +   NP P W++E  W  +  L  L+  +G +  F  ++  W++I D  +P  +  P  W+++ +  E+++V++ L P+ V  AV  +I   +G +YV PP FD+  S+ +S ++TP++F+LSPG DP+  L  FAE      T  + +SLGQGQGPIA + I  + +   W+ LQNCHLA SW+P L  + E   +      PNFR+WLT+YP+  FPV +LQN VKMTNEPP GL+ NL+RSY + PI+D +F+   +K+ + F +LL+ +CFFHAVVQERR YG +GWNI Y FN+SDL+IS+ QL M +N Y+ V  +A++YLT ECNYGGRVTDN DRRLI+++L    + + +    +       Y++P  T   ++  YL+  +  P  A PEV+GLH N+ + ++ Q T  L +S+++ L  E +G +    S + +I D    I  ++P    IE    KYPV Y E MNTV++QE+ RF KL + IR +  DL   ++G+I+M   LE V  +M   ++P+ W   SYP LKPLGSY+ DL  R+ +  +W  +G+P TFW+SGF+FTQ+FLTG +QN+AR+ +  ID L FD+ +++    + P D+G + +GLYLE  RW   + +L+E   KVL   +PVI   P     +   + Y CP+YKTA R+G LSTTGHSTNYV  + L +     HW+ R +A +CQ +D
Sbjct:  505 ICDEFEKIKYRALEIPKSTEELLESAEYMIHVKKDKIAELTDRIQYCLQVGTNIVELTEMSKYHFDLTIKTINW---IKDINDICDYNASQQEQFKFT----FEEHLQEVIKKLNSDIDELLPKLTVIDDMSRPDKFRDSYIILQNFIDQLKTFDDYVAWINKEEKLFKVAL-TEYPKLDIIKTFVYPFAELMKCCIEWQRYLSVWNDGPFEYLEPQFVERTTDDYLKEFQKNQKYYRVKIKQDLIDNPVCKFKGQTEDPDPAKHPVPLRLCTSMIQSIKDFTTGVFIVNTMCNPALRKRHWKEMSEIAGFDVTPDAGTTLRKILNSGLDPILDQFEIISIGANKELQLWNALQAMIKEWETRVFPYGPYKETGVQILSSLDDIQALLDDHILKTLVMRGSAFMKPCEEEVRAWYEKIMRVNETLDQWGKVQANYLYLLPIFSSKDIVAQMPEEGRLFVIVEQTYTRNMGLVLRQPLVMETAPVSGLLESLQKANELLEDIATGVSNYLEKKRLYFPRFFFLANDEMLEILSETKDPLRVLPHLSKCFEGINSLEFDAAKNVLAMISSDKETIEFIEQVSTAAAGGSVEKWLIGVEDEMLKAVRYQNELSFAHYPKVKRHEWVLEWPQMTVLAISQVYWASRVHGCLRRTFGGNMTIMMNFFQELSKELNDIVTLVRSPKISNLNRITIKSLIVIDVHAKDVSEDLIKNKVSSEFDFQWLAQMRYYW--------EDDKTWVRIINATVPFANEYLGNSDRLVITPLTDRCYRTLVGAYQLHLNGAPEGPAGTGKTETTKDLAKALAVQCKVFNCSDGLDYKAMGKFFKGLASCGAWACFDEFNRIELEVLSVVAQQILLIIQAVRSNATKFMFEGTELTLNPACYVCITMNPGYAGRSELPDNLKVLFRSVAMMVPDYAMIGEISLYSYGFVDARKLAVKIVTTYRLCSEQLSSQNHYDYGMRAVKTVLSACGNIKKQYPDEVEDILLLRSLIDVNLPKFLSFDVPLFEGIISDIFPGIKLPHIDYSLVESEFKRVCLEEV----LEPAPSFLLKVIQTYEMIIVRHGFMLVGEPLAGKSKTLQVLAKVLSALKIKAPQKSNYFQHVQMGIMNPKSITMNQLYGSFDPISYEWTDGLVAKIFRDFAMTPTPDRKWVIFDGPVDAVWIENMNTVLDDNKKLCLTSGEVITMSNEMSMVFEVMDLAQASPATVSRCGMIYMEPSTLGWRAFAKSWLKKADPRWADEEGVPYVMALMQWLLPPCQTFVRRFCSQFIKPGEFNCMLTTFDLFDMQIAEA-----------------------------IEENPEDYQKYLQTYFQAAILFALIWGVGGVLDTASREKFDVFLKKLWD-TDPPP---PEPLG---KMEITPPTEGLLVDYVFLYKQRGAWRYWPDLAKRMDVEE-TKT----GVIVPTVDTARY-IHLLKMHVEHKKRMLLVGPTGTGKTVYVQNYLMNKLDKEVFETGFITFTVMISANQCQDLLISKLQKWKRGIYGPPKGMQSVLFVDDMNMPVKEVYGAQPPLELLRQFFDYGHVYDLKDSSKVYIHNVLIMAACGLPGGSRQDVYARFLNHFNVYSINTFSDDSMFRIFLNVALNGFRRAGHGQDVFVVTNQIVSATQSIYKSVQSEIRATPSKSHYIFNLRDISRVVTGCTLVRKESVSDKKI--------FVRVWYHEAMRVFYDRLVDDVDRKWMFDKLNECLKANFKDKVETVFERYCVQGPDEAVFTMEAASNILFGVYFDEDSVPDE-------------RRYEEVPSVEVFLNLALTSLDDYNSTRRNKMDITLFTFALQHLNRICRIISIQGASALIIGLGGSGRQSLTKLATNMVQTSFFQPEITKNYGANDWHDDIKAILKEAGGMNKHTTFLITENQIKMELFLQDIDCLLNQGEVPNIFPIDEKQEVLEMVRLAAQGGNRNIDVSALQVFSFFVDRCKQKLHMILSFSPIGDALRTRVRLYPSLVNCCTIDWYDSWPEEALQMIAKMSLVDVNVPSEDIKLAIMDTCQYFHTTAARSTRAFCQMTGRHIYQTNASFIELIRSFQTLIERKQSETMLAKMRYIGGLDTLAQAAAAISIMQRDLNALQPKLVALAESSRKMMLEINKETLAASAAAEQVKRDEEVASVQAEAAQVLKQDCERDLAKAIPVLEDALAALNTLKPADITLVKSMKNPPPVIKLVMAAVCVIKGIPPERIPDPASGKMVQDYWGPSKRLLGEMNFLPGLKEFDKDNIPTEIVKRIHKEFIPNKDFDPKVVAKASSAAKGLCQWIIAMMMYDEVAKVVAPKKAKLAGAEKEYADTMEFLAQKRALALALEEKVALLNIELDKANAEMQKTEEHAESCRNKLLRAEALIGGLGGEKSRWNKAAEDLQELYDHLPGDVLISCGIIAYLSAVNLQYRSECVKDWFKKVTDLKIPCSSHYSITD--VLGLEVTIQNWQLDGLPNDEFSSENAIISANSSRYSLFIDPQAQANNWLKNME-RKNRLNCVKFNQSNYMKVIAEALEYGTPVIIENVQEELEVPLDPILMRQTFVQGGIKHISLGESVVPVNPNFRLYMTCNLRNPHFLPETFNKVTVINFALTQNALMDQLLSIVVAKERPDLQELRITLTTEAAANKGALRDAENMILKTLSAG-GDILENEAAIQILADSKGLSKDIVEKQEAAKETVAKIEAFRLNYKPVAVHSSILYYSITDLPNIDPMYQFSLNWYINLYMYSIETANKSKDLPRRIKFLVDGFTRNLYNNVCRSIFEKDKLLYSFILTARILLGTGQVEMRHFAHLVTNAKESTNIPPNPDPTWITETVWLNVLRLEELKELRGIVDHFKSHLHAWQAIYDHSSPEKQPLPPPWQDKTTAFEKIIVLKALRPDSVFLAVRLFIAESIGDQYVTPPEFDISKSYADSTALTPLVFILSPGADPLGSLLAFAEKMGQEET-FQSISLGQGQGPIATALIKNAQEMGYWVCLQNCHLAASWMPYLEYLWEN--MDTFNTTPNFRIWLTAYPTPQFPVTILQNGVKMTNEPPTGLKENLMRSYNSEPINDYEFYTGCAKQDRAFTRLLYGICFFHAVVQERRKYGPLGWNIAYGFNESDLQISVLQLSMLLNQYDHVPYDAISYLTSECNYGGRVTDNWDRRLIVTILADFCNAQAVTDNRYRFASDDRYILPRKTEHREILRYLD--ENLPSLAPPEVYGLHANSGITRDLQTTKTLLDSMILLLGSEAAGSAGAGVSVEQVILDTIKQIEREMPADMDIEAAAEKYPVDYNESMNTVVVQEMERFLKLQKEIRTTCRDLAMGIKGIIVMTPDLENVMTAMKFNRIPTKWMSKSYPCLKPLGSYVQDLYKRLNWLHDWHHHGKPPTFWLSGFFFTQAFLTGAMQNFARKYKIPIDTLTFDYDVLKVETKTSPPDDGVYCNGLYLEGARWEWRENTLVEQFPKVLIYAMPVIFFRPVGLVDVVEGSRYRCPLYKTAERKGTLSTTGHSTNYVVPLLLNTHVKASHWVKRSVALICQTSD 3964          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Fly
Match: kl-2 (gene:FBgn0001313 transcript:FBtr0346722)

HSP 1 Score: 1927.14 bits (4991), Expect = 0.000e+0
Identity = 1283/3831 (33.49%), Postives = 2041/3831 (53.28%), Query Frame = 3
Query: 1320 SNILRFIVRNSITE-----FVEFIQQYRDV-VCYEGYYDLFSGMAV-----SNVNSIL----RIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQF-SRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRD----YVKLNSEAPIKYSQ-------IYTNFRYLLNKTTEDHSHQFINADKQLLD-YEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTF--TWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEF--------------NQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSN--KVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKV---TNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKL------KFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQI--SRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEE-------FLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKE-LNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQF-LPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIF--MKKQFGCW-----TTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYN-LMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDE------VEIKQDV--REKIVIMCQHF------------HQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAED--AKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLD--SPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESIL-VTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHT-FWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPA-----DEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPS-SQLVQHWINRGLAALCQL 12494
            SNILR    ++IT+     F EF     D+ + + G+ ++F  M       S+ NS+      +H + D+ ++  L+        C  L   ID I   +S +  R+ N+L    E  P +   + +    ++   +K  L D     +  N EA I + +        + N   +L +TTE    + + A +   D +EA +E   +++D+ + +     ++  +++   I   +LD  ++ + + +  + + S    R+I        R++     T  + +  +++ E++   E+ + Q            L  Y +   ++I +        W+  +          L +  E   N  E+++K  V+     K  +KEF              N R  L       + L  +A K+ +C   ++ + ++  + +   Q   + L+++         +W+    +   ++ W  G   +++  E+E    +L+K    L K F    ++      AT K  ++ F+  LP+I AL NP +++RHW+ + +   V FD   + +  L  ++ +      ED+ ++S+ A+ E  +E +   +   W++  F    Y + G+  +  V+D   LLE+H+V+ S M+ + F+ PF + +++W+KTL  + + L   L VQ  WLYLE IF   DIR+Q+P E  +F  + E++RTI +K+       K  N+     LL      +  LE IQ+ L  YLE KR  FPRF+F+SN++LLEIL  +K P  VQ HLKK F+ + KL      K       +GM S + E V+F   I+    +G  E+W+ QVE  M   ++E++K       ++  +R +W+  WPGQ+VL  + + WT + T ++   ++ +         KK  + +S + E+ R ++L   +R+ +   I L++H RDV+ ++  S       F W SQ+R+YW  E ++       VIR   TE  YGYEY GN+ RLVITPLTDRCY TL  A+ L+ GG+P+GPAGTGKTET KDL KA+    +V NCS+GLDYKS+GK F GLAQSG W CFDEFNRI +EVLSV+AQQI +I  A+  +    +FEG  ++L  +  +FITMNPGYAGR+ELPDNLK +FR ++MMVPD  +IAE  L+S GF   R LA K+  +Y L  +QLS Q+HYD+G+R++ ++L  AG+ +R+L   TEE +V  ++ D+N+ +    D+PLF+GI+SD+FPGV  P IDY +    + E  R   L+P+   + K+I+++E    RH +MI+G +   K+  ++ L      +N +  +   +V    +NPKA+++  LYG ++  + EW DG+L+   R     E   +KW++FDGPVDA+WIENMN+V+DDNK L L++ E I M  + +++FE  DL  ASPATVSRCGM+Y +    G  P +  W+Q+  + EF D      +++ F++++P  LDF   +CK  V+   L  V ++ +L           G K                    +N I   N  L EE T      F   L+WS                    C   D  +++  R  +         P K T+FD+     ++ F  W     ++W+   E P           + I++PT DTVR  + ++++L     P+M VG  GTGK++   + M     NK F   ++  SAQT++  +Q+S  ++ ++R +  + P   K ++ F+DD +MP K+ YG+QPP+E++RQ ID+K+WF+RK    + +++ L+ +AM  P   R  ++SR    F ++ +     ET+  IF  ++     S +   ++ +   I   T +++ S+++  LPTP KSHY+FNLRD S+V QG  LL+S   K L  ++  N  +RLWVHE +RVF DRL+   D   F   I  ++   F+  FH L       +K P         FGDF   +                    + E    + L   M+  L+EYN       M+LV FR AIEHI RI R++ QP GH L +GIGGSGRQ   KLA FI +  +FQIE+T+ Y   D+R+D++ L + TG K   T F+F   QI E  FLE  N +L++G+I NLF++++      K +     +   + +T   +Y+ FI  VR  LH+ L FSPIG+ F S +R +P+L++  T NWF+ WP++AL  VA+  L        V  K+D   RE +VI  +              H SV+ +S+  Y  + R NYVT  +YL+L+  F  LL KK++E+ T+  R   GL K+  ++ ++SLM  EL+A   Q+   ++E E  I +IE +  E  + ++ V       +++ ++     +     ++L   MP+++AA++ALD L + DIS VK+   PP  ++ VMEAV IL G +P              W  AKK+L +  FL+ LK++D+D I +  +++I + Y  NP  +P K+  +S AC+ L  W+ A+E Y ++ ++V+PK+EKL  A    + + A L   + +L E++  + +L    + K     +L    E  + ++ERA  L+  L GE+ RW + ++ L + F+ + GD LL    ++YLG F   YR+E +  W    K + IP + E   +   V  D V +REW I GLP D  S +N VIVT  +RW L+IDPQ QAN WIK +E ERN+L  +      YLR LE  L+ G P LL+NVGE LD  +  +L +    QS    ++  D  + Y+  FRFYITT++ NPHY PE S K T+VNF +   GLE Q+LGI+  KEKP LE+++ +L++  A N+R L +++++IL++L+ S+G++L+D++    L  S+  S  +      A  TE EI+  R  YKP +   SILFF + D++ +DPMY +SL+ +I L+  SIE S  +  +  R++N+N + + AVY+N CR LFE+ KLLFS  +   I     K+ E  + F+L GGI LD      NP P W+SE++W+ +  L  +  F G +  F  + + W     +  P  E   G+W ++L+  +++ V+R L P+++   +  +I+  LG  YV+PP  DL+ +F ES S TP+IFVLSPGVDP   L   +E   ++   +  +SLGQGQ PIA   I + +K  NW+ L NCHL+ SW+P L K+     ++  +++  FRLWL+S P   FP+++LQ S+KMT EPP+G+++N+ R Y      +E   +    P  ++KLLF+LCFFH V+ ER+ +  +GWN+ Y FNDSD ++S   L +++N+YED    AL YL    NYGG +TD+ DRRL+++ +   +  + L +  F L+    Y +P    D+ SYL+ I+ FP    P+ FG H+NA++A    ET  LFE++L + +    +  +++ +T + DLA +IL   P     E+   K   +    +  VL+QE+ R+NKL+  +   L DL+  ++GL++M + LE++Y ++  G+VP  W + +Y SLKPL ++  DLI R+  F +W    +P   FW++ + F   F+T VLQ  AR  +  ID+L +DF +    E +  A       G +I  L+LE G W  ++  L +     L   LPVI+  P           Y CP Y    R G         ++V  + L S ++   +WI RG A L  L
Sbjct:  812 SNILRGFY-STITDLIFAVFKEFQAVIEDMPIEWYGFVNVFDDMLATAFLTSSKNSLNMLTNALHRDPDMAAAPILVMESDVRERCIVLTPDIDVIANLLSGYIDRIHNIL----EQFPRIGIKMKLPKEHQYESFSKAFLEDSESTQLICNIEAEINHEREEIDGYITFWNSHRMLWETTELEFTKRVKATQMTADIFEASIEYYSAMADDISYVDAITHVYFILMNQNYIKSSILDCIEKWQALNIKILLSHSFSLIRAIYRYMRKNERKMMMVPRTLKESLLAKQFFERI-INEVPLKQAGFPPTLELFAILDKYQVEIPEEIRVKVIGLEAAWHHYL--------KRLGEADEMLDNNREEFKKILVQQAEKFKIILKEFLDDFFLKLPTSANINPRIAL-------KFLRIIALKIEDCFTFEESLMRDLAVFNVN-QPESIDLRKLDFEVRIVKNIWELIFEWQTNWEGWKKGYFWKMNINEMEDTALNLYKEFTTLNKKFYDRHWE---MLEATTK-NVDSFRRTLPLITALKNPCMRERHWNRVRDVIHVNFDENSK-NFTLELIINLDFQAFSEDIQDISNPATMELQIENSIKNIATIWKKQSFEMAFYHD-GIYRIKNVEDCFQLLEEHMVQISAMKATRFVEPFITIVDYWEKTLSYISETLEKGLTVQRQWLYLENIFQGDDIRKQLPEEAKRFATITEEFRTISSKMFQAKTAVKATNLRPPPFLLNRFSRMDERLELIQRALEIYLEAKRQLFPRFYFISNDDLLEILGNSKRPDLVQTHLKKLFDNLYKLELKRVGKTLSRWQASGMHSDDGEYVEFMMVIY---IDGPSERWLKQVEEYMLVVMKEMLKLTRGSLKKLVGNREKWISLWPGQMVLTTAQIQWTTECTRSLIHCSMVDQKKPLRKLKKKQIKVLSKLSEMSR-KDLTKTMRLKVNTLITLEIHGRDVIERMYKSNCKDTGHFEWFSQLRFYWHRESEL------CVIRQTNTEHWYGYEYTGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIWVIVTNCSEGLDYKSIGKNFSGLAQSGCWGCFDEFNRINIEVLSVVAQQIMSIMAALSTKALELMFEGQMIKLKHTVGLFITMNPGYAGRTELPDNLKSMFRPISMMVPDNIIIAENLLFSDGFTNTRNLARKVYTLYELAKQQLSKQYHYDFGLRSMVALLRYAGRKRRQLPNTTEEEIVYLAMKDMNVARLTANDLPLFNGIMSDIFPGVSLPTIDYSEFNIAIYEEFREAGLQPITIAVKKVIELFETKNSRHSVMIIGDTGTAKSVTWRTLQNCFYRMNSQRFSGWEAVTVYPVNPKALNLAELYGEYNLSTGEWLDGVLSSIMRIICGDEEPTQKWLLFDGPVDAVWIENMNSVMDDNKLLTLVNSERITMPVQVSLLFEVGDLAVASPATVSRCGMVYNDYNDWGWKPFVNSWLQRLRIKEFAD-----FLRIHFDYMVPKILDFKRMRCKEPVRTNELNGVVSLCKLLEIF-------GTK--------------------VNGINPINLELLEEMTRLW---FMFCLVWSI-------------------CSSVDEDSRQ--RLDSFIRELESCFPIKDTVFDYFVDPNERTFLPWDSKLLSSWKCDFESP----------FYKIIVPTGDTVRYEYVVSKLLAE-EYPVMLVGNVGTGKTSTAISVMEACDKNK-FCILAVNMSAQTTAAGLQESIENRTEKRTKTQFVPIGGKRMICFMDDFNMPAKDIYGSQPPLELIRQWIDYKYWFNRKTQQKIYVQNTLLMAAMGPPGGGRQTISSRTQSRFVLLNLTFPSQETIIRIFGTMLCQKLES-YPNEVREMWLPITLCTINLYVSMISKMLPTPNKSHYLFNLRDISKVFQG--LLRSE--KEL--QNKKNFFLRLWVHECFRVFSDRLVDDSDQFWFVNTINDILGKHFEVTFHSL-----CPSKVPP-------FFGDFAHPQG-------------------FYEDLQVDFLRTFMKNQLEEYNNFPGMTRMNLVFFREAIEHIVRILRVISQPRGHILNMGIGGSGRQVLTKLAAFILEMAVFQIEVTKKYKTGDFREDLKNLYKVTGIKQRLTIFIFSSDQIAEVSFLEITNNMLSTGEI-NLFKSDE--FDELKPELERPAKKNGVLLTTEALYSYFILNVRDFLHVALCFSPIGENFRSYIRQYPALLSSTTPNWFRFWPQEALLEVASHFLIGFPLNVVVSGKEDEKHRESLVISTEAILQRDIAYVFSVIHSSVAKMSENMYAEVKRYNYVTSPNYLQLVSGFKKLLEKKRLEVSTASNRLRNGLSKISETQEKVSLMSEELKASSEQVKILARECEDFISMIEIQKSEATEQKEKVDA--EAVLIRRDEIICLELAATARADLEVVMPMIDAAVKALDALNKKDISEVKSYGRPPMKIEKVMEAVLILLGKEPT-------------WENAKKVLSESTFLNDLKNFDRDHISDKTLKRIAI-YTKNPELEPDKVAVVSLACKSLMQWIMAIENYGKVYRIVAPKQEKLDSAMKSLEEKQAALAAAKKKLEELQVVIEELYRQLEEKTNLLNELRAKEERLRKQLERAIILVESLSGERERWIETVNQLDLSFEKLPGDCLLSVAFMSYLGAFDTKYREELLVKWSLLIKDLLIPATLELKVTYFLV--DAVSIREWNIQGLPADDLSTENGVIVTQGSRWPLIIDPQMQANNWIKNME-ERNQLMTLDFGMADYLRQLERALKEGLPVLLQNVGEYLDQAINPILRQSFTIQSGERLLKFNDKYISYNNSFRFYITTKISNPHYPPEISSKTTIVNFALKQDGLEAQLLGIIVRKEKPALEEQKDELVMTIARNKRTLIDLDNEILRLLNESRGSLLDDDELFSTLQKSRQTSVLVKESLSIAEVTEVEIDAARQEYKPASERASILFFVLMDMSKIDPMYVFSLAAYILLFTQSIERSPRNQLVHERIQNINEYHSYAVYRNTCRGLFERHKLLFSIHMTAKILSNAGKLLEEEYDFILKGGIVLDKLGQAPNPAPWWISEQNWDNITELDKVSGFHGIIDSFEQHYKAWNGWYATTFPEQEDLVGEWNDKLTDFQKICVLRSLRPDRISFCLTQFIITKLGPRYVDPPVLDLKATFDESISQTPLIFVLSPGVDPAQSLISLSESVKMA-QRMYSLSLGQGQAPIATKLIMDGIKDGNWVFLANCHLSLSWMPTLDKMIAT--MQSMKLHKKFRLWLSSSPHPDFPISILQTSIKMTTEPPRGIKSNMKRLYNNI---NEANMENCSEPSKYKKLLFALCFFHTVLLERKKFLELGWNVIYSFNDSDFEVSEILLLLYLNEYEDTPWGALKYLIAGVNYGGHITDDWDRRLLITYINQFFCDQALQTRKFRLSTLPNYFIP-DDGDVQSYLDQIQMFPNFDKPDAFGQHSNADIASLIGETRMLFEALLSMQVQTNSTSSNENGETKVFDLAKEILMNTPDEINYEQT-AKIIGINRTPLEVVLLQEIERYNKLLVDMSTQLRDLRRGIQGLVVMSSDLEDIYLAVSEGRVPLQWLK-AYNSLKPLAAWARDLIHRVGHFNSWAKTLRPPILFWLAAYTFPTGFVTAVLQTSARATKTPIDELSWDFYVF-VEEDTAAARIIREGGGVYIRSLFLEGGGWLRKNQCLQDPLPMELICPLPVIHFKPVENLKKRCRGVYQCPAYYYPVRSG---------SFVIAVDLKSGNEKADYWIKRGTALLLSL 4457          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Fly
Match: Dnah3 (gene:FBgn0035581 transcript:FBtr0289982)

HSP 1 Score: 1872.06 bits (4848), Expect = 0.000e+0
Identity = 1004/2220 (45.23%), Postives = 1425/2220 (64.19%), Query Frame = 3
Query: 6024 NQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQ-SLIEKPDLDELIKTTEIHNILIPTVDT----VRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVA-------------------------NKSLDEVEIKQDV----REK------IVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFK-----ASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISG-ESKSSQTIIEDLA----SDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPA--DEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENS---------YHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            N+ +P+PK     R  M P+K    D+ F + +   W TWQ S           +  +I  +++PT +T      Q F +++        ++ VG TGTGKSA+I + +L ++P    L + + FSA+TS+  VQD+  SKLDRRR+G++ P   K   VF DD++MP K+ YG+Q P+E+LR  +DH +W D  D T + + D+ +  AM     S   +  RL RH  ++A+D F+D T+  IF  I DWHF+ G+   +  LS+ +  A   +++  +  FLPTPAKSHY F+LRD +RV QG +++    + +        KL RLW HETYRVF+DRL+  +D D    +     +   +      FG+     ++ T+ ++R L +G++++   +P               K Y+E    E L + M++YL EYN  S  PMDLV+FRFAIEH++R+ R+L+ P G+ L+VG+GGSGR+S+A+LA +I D  +  ++++++Y+++DWRDD+++++ +       T FLF D Q  +  ++EDIN +LN+GD+PNL++ ED+  I+E M  + +Q    ++     +Y  +I+R+R+ LH+ L FSPIGD+F  R+R +PSLINCCTI+W+  WPE+AL  V                              DE E++++     RE+      +V    +FHQSV D S+K Y  + R NYVTP++YLEL+K F     +K  EI   ++RY+ GLEKL+F+  Q+  MQ  L   QP+L   S+ET++++  IE ET E EK ++VV  +EA     A  A++IKDDCE++LAEA+P M AA+EAL+TLK  DI IVK+M+NPP GVKL MEAVC+++G+KP++K DPSG ++EDYW  + ++L D+KFLD LK++DKD IP   +++IR +YI +  F P KIK  S ACEG+C WVRA++VYD++ ++V PKK  LA AE     QM +L  K+ EL  +  KL KL + F  K +EK  LE+ I+  + K+ RAEKL+ GLGGEK RW +   +L     N++GDVLL  G  AYLG FT  YR   ++ W   CK   IP  S  TFSL++ LG P+ +R W + GLP D+FSV+N +IVT+++R+SLLIDPQ QANKWIK +E + N L+VIK SD  Y++VLE  + FG P L+ENVGE+LDS L  +L K   K     +I+ GD ++EY+ +FR YITT LRNP Y PE  V VT++NFMIT  GL +Q+L IV A E+P+L++++ QLIIESA NR  L  IE +IL++LSTS+GN+LEDE AI ILSSSK+LSE I  KQ  A  TE EI+  R  Y PV+ H +ILFF IS+LA++DPMYQYSLSWF+NL++++I  +  S  +  RLKNLN +FT+++Y N+CRSLFEKDKL+ S ++C+GI   Q +V++    F LTGGI   +   NP+  WL +KSW  +   ++LE  K   +       +W +  D+  P   + P      ++ +  L+VI+ L P+K++PAV ++I   L   +VEPP FDL  SF +S    P++F+LS G DPM+ L+ FA+ +N+    LK +SLGQGQGP AE  I E+ +   W++LQNCH+A SW+ +L +IC +  L     N ++RLW TSYPS+VFPV+VLQNSVKMTNEPPKGLRAN+ RS+T+ P+  + FF      +    + + + +F+L FFHAVVQERR +G +GWNIPYEFN+SDLKIS+ QL+MFIN  + +      YLTGECNYGGRVTD++DRRLI+SLL  +Y+   +  + + L++SGTY VPL  + LNS + ++  FP +  PEV+GLH NA++ +  +ETN L   +L+T    ++  ++ SS    ED A      +L +LP+ F I+E+   YPV+Y   MNTVL QELIRFN+L+  IRKSLV++  AV G I M   LE  + SMVIGK+P+ W + SYPSLKPLGSY+SDL+AR+ FFQ WIDNG+P  +W+SGFYFTQSF+TGVLQNY+R+NR  ID +  +F + +  E   P   D GA+I G+++E  RW+ +   + ES SKVL+D LPVI + P LK+  +   S         Y CPVYKT+ RRGVLSTTGHSTN+V  + L  S+   HWINRG A LCQL+D
Sbjct: 2204 NENFPKPKYFSLNRGQMFPEKLLFLDYRFDEAE--NWWTWQKSDDSASTTSNFPENAQISELIVPTKETGYISYWQEFCISK-----SYAMLVVGPTGTGKSAIITSNLL-AMPKFANLVNVINFSARTSAQMVQDTIMSKLDRRRKGVFGPSLGKKCTVFCDDVAMPSKDTYGSQAPLELLRTWLDHGYWSDLVDTTKIELVDMTLMCAMGTLGGSN-FIFPRLYRHMFVVAVDSFEDSTIVRIFTTIGDWHFSKGYPEKVALLSRGLSEAMVSVYRDAIRSFLPTPAKSHYSFSLRDITRVFQGIVMVPPKRMPDP------EKLGRLWAHETYRVFYDRLVDQQDRDRLLVMAVDACKSNLRFPLEQAFGERIEPGEKLTDNDLRNLFYGNYMEPDAEP---------------KFYDEGDTYEKLEKLMKYYLREYNSFSSTPMDLVMFRFAIEHVSRVSRVLQMPRGNILMVGMGGSGRRSSARLAAYIADCRLMTVQVSKSYTITDWRDDLKKILMSASFNLNHTVFLFSDAQATDEGYVEDINGILNTGDLPNLYQLEDKATIMENMANVAKQLGKILDTLPSEVYAYYIDRIREQLHIALAFSPIGDSFKERIRVYPSLINCCTIDWYMPWPEEALSRVGVYFVSSMNLNRPHGEETQEPVQSKDAADPDEEEVRRETVGVEREQTQLEADLVDCVMYFHQSVVDASEKCYLELNRRNYVTPSAYLELLKAFRTFYTRKLDEITRLRDRYTTGLEKLDFAAGQVGEMQTNLYDLQPKLKVLSEETDRIMVNIERETAEAEKKKEVVGADEAAANEAAAAAQAIKDDCETDLAEAIPAMEAALEALNTLKPADIFIVKSMKNPPYGVKLTMEAVCVIRGIKPDRKPDPSGHMVEDYWGPSMRMLSDMKFLDSLKTFDKDNIPPPIIKRIREKYIADRDFVPEKIKAASMACEGICRWVRAMDVYDKVARIVMPKKAALAEAEGELSQQMEKLNAKRAELQVILDKLQKLNDFFAEKSREKKRLEDEIDNCEKKLNRAEKLLGGLGGEKTRWSEAAKNLHESISNIVGDVLLAGGCTAYLGYFTTEYRVNILDDWNALCKRKHIP--SSETFSLATTLGHPMTIRAWSLAGLPADNFSVENGIIVTNSSRYSLLIDPQVQANKWIKNME-KNNNLKVIKQSDANYMQVLELAITFGQPVLIENVGEKLDSNLTPILEKNVIKHKGGLFIKSGDQMIEYNPNFRLYITTCLRNPRYPPEVMVMVTVLNFMITEQGLREQLLAIVVAHERPDLQEKKEQLIIESARNRDALYTIESKILEVLSTSEGNVLEDENAINILSSSKILSEDIQEKQVIAVATEIEIDAARQQYIPVSKHSAILFFCISELANVDPMYQYSLSWFLNLFVNTILKAPKSDQLSERLKNLNDYFTKSIYTNVCRSLFEKDKLVISLVMCLGILVSQGRVEKAALLFFLTGGIGYKTIPPNPLGAWLPDKSWASVCKAADLEGLKNLPQMMETYSDEWHNFYDASNPDQLQLPAP-HNTVNDMYFLIVIKSLRPDKLVPAVRAFITRNLDRSFVEPPPFDLAASFADSSPKIPLVFLLSAGSDPMASLFMFAKQRNMY-DKLKTISLGQGQGPRAEKMIMEAARHGQWVVLQNCHVAISWMGDLERICNDTTLTDGA-NHDYRLWCTSYPSAVFPVSVLQNSVKMTNEPPKGLRANMHRSFTSDPLMRDKFFTNAFLFSDSANKCWLRGVFALVFFHAVVQERREFGPLGWNIPYEFNESDLKISLLQLKMFINQSQSIPFRGHVYLTGECNYGGRVTDDKDRRLILSLLNMIYNPNTIEEDNYALSQSGTYRVPLSPTRLNS-IEYVSSFPLSPHPEVYGLHENADINRNVKETNALISGVLLTQTDLMASVKASSSGGAKEDPAIAICKQVLKQLPEEFNIDEVSKTYPVIYTNSMNTVLRQELIRFNRLLSYIRKSLVNVGKAVVGQIAMIPELERTHASMVIGKLPADWLKKSYPSLKPLGSYVSDLLARLAFFQEWIDNGEPMVYWISGFYFTQSFITGVLQNYSRKNRFQIDMILIEFAVTK-FEVQVPGTPDIGAYIRGIFIEGARWNRKTKEVDESFSKVLFDTLPVIYLRPVLKALEDLPRSTAGGEPETIYDCPVYKTSERRGVLSTTGHSTNFVMYLQLRCSRKPMHWINRGTACLCQLDD 4385          

HSP 2 Score: 1163.29 bits (3008), Expect = 0.000e+0
Identity = 710/1690 (42.01%), Postives = 1011/1690 (59.82%), Query Frame = 3
Query:  828 LIDTKQNFQTSVKKAILDYILLNKLEQKRLGLMM-PNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENIC-ESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMA----VSNVNSILRIHLNADLTSSHPLIFVPSFDRICD----------QLCQIIDNI--IGSVSQFS----------------------RLENVLFIKVEGTPSLPFILS-----MLNYEEFVISNK-------EKLRDYVKLNSEAPIKYSQ-IYTNFRYLLNKTTEDHSHQFINADK--QLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRN-----QLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSH-PEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLV-IRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNI---ENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEF-LDDEQRTTVQLLFNWLIPPSLDFIGRKCK 5699
            LID +++F+  VK++ L+Y+L + +E++RL L   P +  +  +   + W S  L+ K  + +    TH T+  L   +   Y +L ++ +  +     PL  + +    E+        L N W+  C +++     + + ++P S     R     F C+ +  S  L  ++  SI    + +  ++     E Y    + +     ++ + S++  H + +  +  P +   S   + D          Q+ Q ++N+  I  V+QF                         +++L +  E  P L F++S        +  F+  +        EK+   VK+N +    Y + +Y  +  L  K       +    +   +L   +  L+KL+++SD    L  F+P++LF+LD   +   L    +++    ++     +   NR+IC + + +  +  ++ E T ++V LQ Y+   R   +  ++ +++   + V+FLL +T L +D++ LN+ TF     +  +LD S   L   R+     L + + +F + LA  K  +  F  R       L +  E    +D +   +     E K IN EE LL   V + +  L EI+   EP +KLWK++  F K Y  WM      ++A+ V  + +++ K  Y+L++  ++ P  K   R A  ++ K+EKF++ LP++ ++C  GL++RHWD +S  +G  + P++   L DM+ + +   L  L E+++ A KE+ L      MQ DW++++F    Y+++  +IL ++DDIQ LL+DHI++T  M+ SPFI    S+ + W+  L  +++ +++W +VQ  W+YLEPIF S DI RQ+P+EG  F+ VD+ WR IM     D  VM   ++  +LE    +   LE + KGLN YLE+KRL+F RFFFLSN+ELLEILSETKDP+RVQPHL+KCFEGI  L F +   I  M+S E E V     I P  A GLVE W+ +VE  M DS++E M++A   Y  + R  WV  WPGQVV   S + WT +   AI++  L  +L+K++ QI+ +V+LVR  +L++ VRI +EA IVLDVH RDVV  L    +++  DF+WISQ+RYYW    K+N  N++ V + MV T+V YG EYLGN  RLV+TPLTDRCYRTLMGA+KL LGGAPEGPAGTGKTET KDLAKAVAK+CVVFNCSDGLDYK++GKFFKGLAQSGAWACFDEFNRIELEVLSV+AQQI TIQRAI  ++  F FE T L+LD +C+IFITMNPGYAGR+ELPDNLKVLFRTVAMMVPDYA+I EI+LYS GF  AR L+ KIV  Y+LCSEQLSSQ HYDYGMRAVKSVL A+  L+R    L E  +VL++I+DVNLPKFL  DI LF GI  DLFPGVE P+    D+ + L   L    L+  PW+L+KI+QIYEM+LVRHGLMIVG S  GKT A++ L+  L +++ +      E  V F IINPKAI++G LYGRFD VSHEW DG+LAKTFRE       ER W++FDGPVDA+WIEN+NTVLDDNKKLCLMSGEI+QMT   NM+FEP DLEQASPATVSRCGMIYMEP QLG   L K +I   + +  L D   T  + +  WL+P +L+F+  +CK
Sbjct:  458 LIDLQEDFRHYVKRSFLNYLLSSNMERRRLQLEREPPEFPILTISPPVSWRSNLLRGKARIGEVLMTTHPTVQALNRLWHDLYEDLVVVDLGQLLLAQRPLDADTVQVFIEKSCADVRDLLLNDWLPRCADLMNEMRGTWKDLVPMSGKYGGRA-AMLFRCIHSAMSRHLNSLISKSINYLFKVLCAFKGGNRIEKYSMFDAKLKRIPLMTLIASVVGAHFDHEPINMGPGVRPASNIYVYDEDDADPFQQPQVNQFVENVPDIDDVAQFELDHSNKLYIYPYMQELPRIFTEHFKSILAVGYE-IPRLEFVMSGGEPETKGFLHFIDEDHVDFLELCEKVEQIVKVNWQGVHVYLKPVYKYYFGLFQKLILPMVQKVWTENNLPELGAVQELLKKLQAVSDTTYYLRDFIPLNLFMLDNRHVKLSLRMYVREIYDFIIDFYKALNWNENRAICEELEEMSMKAGERPEETPEVVALQNYINDCREMRIFAIKDEIKNVLKRVVFLLTHTYLSSDELHLNSRTFILPGELEEVLDLSAARLAVVRDNLELALRERRMEFEKLLAQEKRTMDGFRIREIRDVLTLEELKERVDTVDLLFTTIENLSREAKAINTEETLLQIDV-SAFPLLAEIIEKMEPIEKLWKTSYEFEKDYLIWMFERFECLNADGVREQVENMHKIMYKLSRQLAYNPVAK---RAAEQMRMKIEKFRVYLPVLDSICRHGLEKRHWDQISKILGRKVNPKLFPTLKDMIDVDIMSILPQLEEIANAAGKEYDLNNGLRIMQADWRDVMFEVLQYRDSDTHILASLDDIQTLLDDHIMRTQAMKRSPFITALGSKADDWEARLLLIQNIIDAWTQVQITWMYLEPIFSSEDIMRQMPLEGRNFKAVDKLWRKIMKHTLKDRHVMAATEYPEMLEVFTKAIEDLETVTKGLNTYLEQKRLFFARFFFLSNDELLEILSETKDPMRVQPHLRKCFEGIGSLTFDDNMEIVEMVSDEEERVALVRKINPQLANGLVEMWLKEVEMVMLDSVKEQMREAWEDYAMVERISWVVSWPGQVVQGISCMAWTYEVEEAIETKELPAYLEKSNLQIADLVQLVR-TDLQAGVRIAVEALIVLDVHDRDVVKYLTDCRITNIQDFDWISQLRYYW----KVNEKNEDWVCVSMVVTDVEYGMEYLGNLPRLVVTPLTDRCYRTLMGALKLCLGGAPEGPAGTGKTETCKDLAKAVAKKCVVFNCSDGLDYKALGKFFKGLAQSGAWACFDEFNRIELEVLSVVAQQILTIQRAIGRKVVKFFFEDTMLKLDPTCSIFITMNPGYAGRTELPDNLKVLFRTVAMMVPDYAMIGEITLYSNGFDMARNLSQKIVQAYKLCSEQLSSQSHYDYGMRAVKSVLLASASLRRLYVDLPEPEIVLRAIVDVNLPKFLEQDISLFIGIYMDLFPGVELPMPQRGDILKWLHINLADRNLQATPWYLEKILQIYEMLLVRHGLMIVGGSMGGKTTAYQVLAQTLRNVSTDEEATLKEFPVTFRIINPKAITMGQLYGRFDPVSHEWYDGVLAKTFREQVQGPKGERAWVMFDGPVDAVWIENLNTVLDDNKKLCLMSGEIMQMTKLMNMMFEPADLEQASPATVSRCGMIYMEPSQLGWRALHKSFINVLVNKVGLGDIYMTLFEDMTEWLVPAALEFLP-QCK 2135          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309029)

HSP 1 Score: 1691.78 bits (4380), Expect = 0.000e+0
Identity = 1126/3377 (33.34%), Postives = 1781/3377 (52.74%), Query Frame = 3
Query: 2514 QTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSH-PEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRI------DTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILC--TVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSS-EALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKF--TEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYN--QISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLV---RITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLF-EGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMAL---GDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLP----EFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHK-FWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNS--GFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGE------IKLYNEITDEEALFQTMQFYLDEYNLMSKAP-MDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLD--EVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCIL--KGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVP-DWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYE---DVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKE-ISGESKSSQTIIEDLASDILSKLP---QIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRC-AIDKLDFDFRIMECH--EYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQL 12494
            QT Y +L +I        KL+K           + + P  EVD EE+  E         +L K     P +         +K  ++ F    P+++ + N  +K RHW  +      D+T  I         L ++L   L KH ED+ ++   A KE  +E    ++ N+W      F  +   G  +L   T  +    LED ++   ++ ++ +  PF  +I  W   L    + L  WL VQ  W+YLE +F   DI +Q+P E  +F  +D+ W+ IM +      V+     D+LL+ L    +  LE  QK L+ YLE+KR+ FPRFFF+S+  LLEIL +  D   +Q HL   F+    +KF   E   +  ++S+E E ++    I    AEG VE W+ Q+    + SL  +++ A    N    +   +++  P Q+ L    + WT  A  A+      + + + + +   ++  + D+  ++L    R   E  I + VH RD+   L    + S +DF W+ Q R+Y+  +L      D   I +      Y  EYLG T RLVITPLTDRCY TL  A+ L++GGAP GPAGTGKTET KD+ K +AK  VVFNCSD +DY+ +G+ +KGLAQSG+W CFDEFNRIEL VLSV AQQ+  +  A +++ + FLF +G  + ++    IFITMNPGYAGR ELP+NLK+ FRTVAMMVPD  +I  + L S GF+E  TLA K   +Y+LC EQL+ Q HYD+G+R + SVL   G  KR+    TE  +V++ + D+NL K +  D PLF  ++SDLFP       +Y +L   ++++     L   P ++ K+IQ+YE   VRHG+M +G S  GKT     L  A+   GD ++E+ +         NPKAI+   ++GR D  +++W+DGI +  +R+    ++ E  W++ DGPVD+IWIEN+N+VLDDNK L L +G+ + M     +IFEP +++ ASPATVSR GM+YM    L + P+++ W++   P     F D   +T V++ +NW +              VK     L  N++Q    +L+ +  V KK D+       + + ++D      I  + +    E  + L   +  +L W  G  L    + + + F ++       P   YP+              + TIFD  F     G W +W++L+  P +   + T +  +IL+P VD VR  + +  I  N  + +M +G  GTGK+ ++K FM   +  + ++  S  FS+ TS  Q Q +  S +++R    + PP  + L+VFIDDI++PE  ++G Q   EI+RQ +D K F+   K      I DV   +AM +P   R  + SRL R F +   +  D++++  IF+ I + H+N+  GF   ++ L K ++  T  ++Q      LPTPAK HYVF+LRD SR+ QG +   S V+       S + L+ LW HE  RVF DR  + +D + F   +  +V    +E+     GD  +    P        +F DF++   +P          +EGE       K+Y  +   E L + +  +L ++N M +   MDLV F  A+ H+ +I R++R P G  +LVG+GGSG+QS  KLA+FI  ++ FQI +TR+Y+V+++ +D++ L R  G +G  TTFLF D  IKE  FLE +N +L+SG I NLF  +++ EI++++  +++++N +   T  ++ + F+ R   NLH+   FSP+G+ F SR++ FP+L++ CTI+W   WP+DAL  VA   L   E+E    V+E++V         V++ S+++++   R  +VTP SYL  I  + N+   KQ E+    E+   GLEKL+ +   + +++ +L   + +L+E SK  E ++  +    ++ E V+  V   +             K   E  L  A P +  A  AL+T+K   I+ V+ +  PP  +  +M+ V IL  + L P    D      +  W  + K++    FL  L++Y KDTI +  M  +   Y     ++    + +     GL  W +A+  +  + K V P K  L + E+  +  M  L   +++L E E  L  +++ +     EK  L +   +   K+  A  LI GL  EK RW     +  I+   ++GDVLL  G ++Y GP+   +R   ++ W    K  +IP ++        V  D   V EW + GLP D  SV NA+I T ++ + LL+DPQ Q   WIK  + +RN+L++  L+ K +   LE+ L  G P L+E+VG +LD V+++VL K   K  ++E + +GD   +    F  YITT+L NP + PE S K ++++F +T  GLEDQ+LG V   EK +LE  R  L      N+R +KE+E  +L  LS+S+G++++DE  IE+L  +K  +E+++ K + +  TE +I   R  ++ VA  GSIL+F I ++++++ MYQ SL  F+ ++ HSI  S  SS  E R+  +  + T  VY+   RSL+E+ K LF+ +L I I      +    +   + GG SLD     P P  W+ + +W  +  +S LE F   L+   +N + W+   + + P  E+ P  +   L    +L++IR  CP++ I     YI   LG EY E    DLE  + ES+  TP + +LS G DP + +   A+ K++    LK VS+GQGQ   A   I ES+    W++LQN HL+   LP   +I  ++L++   I+ +FR+W+T+ P + FP+ +LQ ++K TNEPP+G+RA+L RSY +      D+  A++ P     LL+++ F H +VQERR +G +GWNIPYEFN +D   S++ +Q  +++ +    V  + L Y+ GE  YGGRVTD+ D+RL+ +   SV+  E LLS  F   +   Y VP  T  L  ++++I   P    PEVFGLH+NA++  +      + ++IL   PKE   G  ++ ++I+  LA D+L KLP     +++ E   +  +L    MN  L QE+ R  ++I+ +   L DLK A+ G I+M   L+E   +M   ++P  W + S+ S   LG + ++L+ R   F+ WI   +P  FW++GF+  Q FLT + Q   R ++  A+D +    +I   +  + ++   EG ++HGL+LE          L+ES  KVLY+ +PVI I     +       Y CP+Y+   R  +         YV +I   +    +HW  RG+A LC +
Sbjct: 1449 QTDYPELGQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHA-------LKKTIDDFNDMCPLLELMANKAMKPRHWQRI-----MDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAI---RAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGRERKVMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDL------DKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRM---------NPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEV-YNWGV------------QMVKLQMPVLQCNIVQQMLFILEGLIPV-KKEDEQAVSMSSKESHDEDLPPETSIEEKEDTCTPEHLHRL---YIFALAWGLGGYLSTSDRQRMNLFVKESF-----PQLDYPKGS----------AHENTIFD--FFVSPAGVWQSWKTLV-TPYMYPELSTPDYLSILVPIVDNVRIDYLIGTI-ANQERAVMVIGEQGTGKTVIMKNFM-KKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVIT------SESVLMALWKHECTRVFADRFTTFQDKEWFGSELACLV----REEL----GDSHSQMILPNP------VFVDFMRDAPEP--------TGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHP-CIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDE-MIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLV--DSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIK-CKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIV---LKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLS---LPFCSEII-DMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQDFLDYTSATQWP----PLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFT-SVWFCEPLLSNSFEFYKG--YKVP-GTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLP--MNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWES-TTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAINTTAGKDPKLYECPIYRKPQRTDL--------KYVGSIDFETEFNPKHWTLRGVALLCDI 4699          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Zebrafish
Match: dnah3 (dynein axonemal heavy chain 3 [Source:ZFIN;Acc:ZDB-GENE-091112-7])

HSP 1 Score: 3727.56 bits (9665), Expect = 0.000e+0
Identity = 1983/3905 (50.78%), Postives = 2723/3905 (69.73%), Query Frame = 3
Query:  825 FLIDTKQNFQTSVKKAILDYILLNKLEQKRLGL-MMPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICEST-PLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLI-FVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNK-EKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSH--QFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQ--LNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIEN-SVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDP--SGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRI--MECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
             L + +++++ S++K+I+DYILL+  E++RL +  +P +    V+R  +PW     +++ +  +  +  +  L+ L   +   +  LR ++ +++  +  PL   +  E+ ++  Q     L N+W+  C  + V+  D+   ++P+S      ++E+ F CVA L S  LR +V  S+ + ++F Q ++D      + + F  M  +      R  L   L    P I F PS     + + Q    II S     R+E  LF ++  T     +L  +  +E ++ +     R+  + N+  P +Y ++Y  + +LL     DH     F+        +  ++  ++++  + ASL   +P+ LF LD   +NQ L D+++ L  +    +  ++R  N+SIC +YD I  R+T +  +T +LVEL +Y++      +  L+ ++E+A + + FLL+YT +  +D+ L +T   W + I+  L+ S   L  +++ A   L K   Q  E L GL  ++  F  + +  L +   N ++L+ +   L   ++E +  N+EE LL    Q+ +  LQ I+  K+P+D+LW +A+ F    + WMNGP  +++AE V  +  ++W+T Y+L K F  PE   P R     K K++KFK +LPI+  +CNPGLK RHW+ +SN VGFD+ P  +TPL  M+ +GL K+ + L E+ + ASKE+SLEK+  +M  +W E+ F F PYK+TG ++L  VDDIQ+LL+DHI+KT TMR SPFI P E+E   W++ L R++D L+  L+ Q+ W+YLEPIF S DI  Q+P  G +F IVD  W+ I+ +   D+ V+   +  N+L  LQ S   LE+IQ+GLN YLE KRL+FPRFFFLSN+E+LEILSETKDPLRVQPHLKKCFEGI+KL+FT +  ITGM+S+E E V     I+P++A+G+VEKW+LQVE  M  S+R V+K+ +  Y+++ R +WV  WPGQVV+ AS + WT + ++AI+++TL  ++++++ QI+ IVELVR + L    R+TL A IV+DVHARDVV KL    VSS +DF WISQ+RY+W         +  +++RM+TT + YGYEYLGN+ RLVITPLTDRCYRTLMGA+KLNLGGAPEGPAGTGKTET+KDLAKA+AKQCVVFNCSDGLDYK+M KFFKGLAQSGAWACFDEFNRIE+EVLSV+AQQI +IQ+A+   ++ F+FEGTEL L+ +C +FITMNPGYAGR+ELPDNLK LFRTVAMMVPDY LI EISLYSMGF  +R+LA KIVA YRLCSEQLSSQ HYDYGMRAVKSVLTAAG LK K     E  ++L++++DVN+ KF+  D+PLF GII+DLFPGV     DY+ L + L + +  MKL+PVPWF+ KIIQ+YEM+LVRHG MIVG+   GKT A+K L+ ALGDL KE  IE  +V F IINPKA+++G LYG FD VSHEWSDG+LA +FR+ A   +D+R+WIIFDGP+DA+WIENMNTVLDDNKKLCLMSGEIIQM+ K ++IFEP DLEQASPATVSRCGMIYMEP QLG  PL   ++   LPE L DE RT +  LFNWL+ P LDFI  +C   V+   + L  ++++LY+ LLD++   G +S                            +  ++ T +L + F  +++WS G  ++ +S+ KFD F+R+L   T +    +PRP ++K  +N   P++GT++D+ F K+  G W  W   I K D   +    ++ +++IPT +T RQ FFL   L +   P++ VG TGTGKS +   F++ SL  + +    + FSA+TS++Q QD   SKLDRRR+G++ PP  K  ++++DD++MP KE YGAQPP+E+LRQ IDH  W+D+KD + L IEDVL  SAM  P   R  +T R  RH NI++ID FDDET+  IF  I DWHF++GF+ +  RL K++V AT  +++  +  FLPTP+KSHY+FNLRDF+RVI+G +L  S      T     +K+IRLW+HE YRVF+DRL+ ++D   FF ++K+     FK     L G  +   K   ++ +R L FGD+ K                +   K Y+EITD   L + M FYL E+N +SKAPM+LV+F+FAIEHI+RICR+L+Q NGH LLVGIGGSGRQSA KLATFI D+E+FQIE+T+ YS+SDWRD+++ L+  +G +G +TTFLF D QIK+  F+EDINMLLN+GD+PN+F  ++R +IIEKMQ I Q +  +I++T ++MYN FI+RV+ NLH+VL  SPIG+ F +RLR FPSLINCCTI+WFQ WP+DAL+MVANK L++++++ D+R ++V MC+ F +SV +LS+++Y  + R NYVTPTSYLELI TF  LLN K+ E+   + RY VGL+KL+F+ +Q+++MQ EL A QP+LIET+K+T++++  IE ETVEV+  +++V  +E      A  AK+IKD+CE +LAEAMP + AA+ ALDTLK  DI+++K MQNPP  VKLVME++C++KG+KPE+K DP  SGK++ED+W  +KK+LGD+KFL+ LK+++KD IP A ++KIR ++I++P F P  IK++SSACEGLC WVRA+EVY+R+ KVV+PKKEKL  AE     QM +L VK+ EL EVE +L  L + F+   Q+K DLE NIEL   K+ RAEKLI GLGGEK RW +    L I+++N+ GDVLL +  V+YLG FT+ YR EC + W   C    IP S + T      LG+ V +R WQI GLPVD FS DN +IV+++ RW L+IDPQGQANKWIK + ++ NKL VIKLSD  Y+R LEN +QFGTP LLENVGEELD+VLE VLLKQTFKQ  VEY++LG++ +EYS+DFRFYITT LRNPHYLPE +VKV L+NFMITP GLEDQ+LGIV  KEKPELE+++ QLI+ESA+N +QLKEIE+QILQ+LS+S+GNILEDE AI +LSSSK+LSE+IS KQ+ A+ TE+EI+  R GY+PVA H SILFF ISDLA++DPMYQYSL+WFINLY+ SI +S  S D++IR+ N+  HFT  VY N+CRSLFEKDKLLFS LL +GI +G+ +VD++VWRFLLTGG++L++P  NP P+WLS+KSW+E+   S L   +G  +    NI  WK I DS  P  E+ PG W   +  +ER+VV+RC  P+K++PAV  +IV  +G  Y+EPP FDL  S+ +S+  +P+IFVLSPG DP + L +FA+   +  +  + +SLGQGQGP+AE  I  +L   +W++LQNCHLATSW+P L KICEE++  ++  + +FRLWLTS PS  FPV+VLQN VKMTNEPPKGLRANLLRSY + PISD  FF +S R ++++KLLF LCFFHA+VQERR +G +GWNIPYEFN+SDL+ISIRQ+QMF+++YE+V LEALTYLTGECNYGGRVTD++DRRL+MSLL   Y  +L+  + + + E   Y VP   +   SY+++I+  P +A PEVFGLH+NA + K+ QETNQL + +L+TLP++ +  +KS Q ++++LA  +L+KLP  F IE +  KYP+LYEE MNTVL QELIRFN+L +V+R SL++ + A+RG ++M + LE V+ S+++GKVP++W+  SYPSLKPLGSY+SD +AR++F Q+WIDNG P  FWVS FYFTQSFLTGV QN+AR+    ID + F+F +   E H   KP D GA+I GL+LE  RW+ E   + ES  KVL+D LP+I + P   +    +N Y CPVYKT+ARRG LSTTGHSTNYV +I LPS Q  +HW+NRG+A LCQL++
Sbjct:   48 LLEEVQRDYEFSLRKSIVDYILLDPAERERLSISAVPQQFPSRVIRAPVPWSESYQEARSWQTENLFTVNPMLLHLEDLWMSSFSSLRFVNSDSLLSADLPLLPGEFEELVQRQCQNTKDELLNTWLPRCASLFVTFKDAWLPLLPKSSSIAPEKVEKLFRCVAALMSLQLRSLVIASLQDLLQFFQLHQD---GNDFGERFDEMQYTQ-----RPVLLVKLKLEDPRISFEPSLQGCWELIQQAFTQIISSAHNIPRVECKLFPEIGET----LMLRSVQADEMLVKDIINTARETFQRNTIGPQRYLEVYKKYTHLL-----DHQDIVNFLKTKHSQQGFTKKITAVQNVWKDIASLHATVPLSLFCLDAVNLNQDLCDKAEHLIELLTTFVMEENRELNKSICHRYDEITDRITSKPSSTEELVELNKYLKHTSEVTIHKLRHEIEEAVKRLDFLLDYTTIQAEDMKLFSTVIHWPELILSSLEFSRDKLNNQKDEAEIHLMKRIGQLEETLKGLDKEVDIFKIKEKITLEEIKHNVEKLNNIGISLEAALKEIETSNKEESLLDKE-QSQFPVLQTIIAKKQPYDQLWITALDFQTKSEMWMNGPFQQLNAETVSEDLGNMWRTMYKLAKSF--PERTAPGRVTENFKKKIDKFKQHLPILTTICNPGLKDRHWEMISNTVGFDVKPDENTPLIKMVELGLSKYSDQLEEIGASASKEYSLEKSLEKMTREWAELHFMFAPYKDTGTSVLSAVDDIQLLLDDHIIKTQTMRGSPFIKPIEAEAKAWEEKLQRMQDILDGMLQCQSMWMYLEPIFSSEDIIAQMPENGRKFAIVDSYWKNIVAESLKDTHVLVATEQPNMLGRLQESNTFLEEIQQGLNSYLETKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFTPDLEITGMISSEKEIVPLIETIYPVKAKGMVEKWLLQVENTMLMSIRAVIKQGMEQYSEMPRKKWVLLWPGQVVICASCIFWTSEVSDAIQNNTLPSYVEQSNAQITDIVELVRGK-LSGGARMTLGALIVIDVHARDVVCKLAQDGVSSLNDFQWISQLRYFW--------EDGEVMLRMITTAIRYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMSKFFKGLAQSGAWACFDEFNRIEVEVLSVVAQQILSIQQAVMRNMKTFMFEGTELSLNPTCCVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYGLIGEISLYSMGFTASRSLAQKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPEEDEIVLLLRALMDVNMAKFVAQDLPLFQGIITDLFPGVVLAKPDYELLLKALHDNIGKMKLQPVPWFISKIIQVYEMMLVRHGFMIVGEPMGGKTSAYKVLAGALGDLYKEGLIEEFAVDFRIINPKAVTMGQLYGCFDPVSHEWSDGVLATSFRQQAQCTNDDRQWIIFDGPIDAVWIENMNTVLDDNKKLCLMSGEIIQMSPKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWTPLRDSYMNT-LPESLADEHRTLIADLFNWLVQPCLDFIYHECGFLVQTSPIHLAYSLMRLYTCLLDEIFQEGAES----------------------------MTSQQMTLWLQSLFLFAVVWSLGGTVNGNSRNKFDTFYRNLLMGTIT---DHPRPMSVKLTKNNGFPERGTVYDYYFHKQGPGQWNNWTESIAKED-RVIPAGAKVSDLIIPTAETSRQLFFLRTYLSH-EVPVLIVGPTGTGKSVINNNFLM-SLSKERYTPICINFSARTSANQTQDIIMSKLDRRRKGVFGPPVGKKCIIYVDDLNMPAKEIYGAQPPIELLRQWIDHHHWYDKKDTSRLDIEDVLYMSAMGPPGGGRNDITGRFTRHLNILSIDTFDDETLSNIFTSITDWHFSNGFDASFYRLGKIMVQATMAVYKDAIESFLPTPSKSHYIFNLRDFARVIRGVMLCPS------THMQEGDKVIRLWIHEVYRVFYDRLVDNDDRGKFFNIVKERTSAYFKLSLDKLLGHLTLSGKVEDDS-IRSLFFGDYSKP---------------DSANKQYDEITDLSTLTEVMDFYLREFNNISKAPMNLVMFQFAIEHISRICRVLKQDNGHLLLVGIGGSGRQSATKLATFINDYELFQIELTKNYSMSDWRDNLKHLMLKSGIEGKKTTFLFSDSQIKDEAFVEDINMLLNTGDVPNIFPLDERADIIEKMQGIAQMEGKKIDVTPLSMYNFFIDRVKTNLHIVLAMSPIGEDFRNRLRMFPSLINCCTIDWFQAWPKDALEMVANKFLEDLDLEDDIRIEVVEMCKTFQESVRELSERYYSQLRRHNYVTPTSYLELILTFKALLNSKRSEVNELRNRYIVGLQKLDFASSQVAVMQQELTALQPELIETAKQTDQMMVKIEKETVEVDAKKELVSADEKVANEAAAAAKAIKDECEGDLAEAMPALEAALAALDTLKPADITVLKTMQNPPGPVKLVMESICVMKGIKPERKQDPGGSGKMIEDFWGPSKKILGDMKFLESLKTFNKDNIPPASIKKIREKFIDHPDFQPSVIKSVSSACEGLCKWVRAMEVYERVAKVVAPKKEKLKEAEEELAVQMQKLNVKRAELKEVEDRLQALNDTFEGMIQKKKDLEANIELCSQKLVRAEKLIGGLGGEKDRWTEAARLLGIKYNNLTGDVLLSSATVSYLGAFTVDYRVECQQQWLELCNRKKIPYSEDFTLGN--TLGNQVLIRSWQIAGLPVDLFSTDNGIIVSNSRRWPLMIDPQGQANKWIKNM-NKANKLSVIKLSDSNYVRSLENAIQFGTPVLLENVGEELDAVLEPVLLKQTFKQQGVEYMKLGENTIEYSRDFRFYITTGLRNPHYLPEVAVKVCLLNFMITPLGLEDQLLGIVATKEKPELEEKKNQLILESAANNKQLKEIENQILQVLSSSEGNILEDETAITVLSSSKLLSEEISEKQKIASVTESEIDETRMGYRPVAEHSSILFFCISDLANIDPMYQYSLTWFINLYLQSIAHSVPSDDLQIRIANILDHFTLRVYYNVCRSLFEKDKLLFSLLLTVGIMQGKGQVDDIVWRFLLTGGVALENPHPNPAPEWLSDKSWSEVVRASQLSRLEGLFEHVQENIALWKQIYDSGHPQDEELPGKWHTVVG-MERMVVLRCFRPDKLVPAVQKFIVDNIGRAYIEPPTFDLAESYSDSNCCSPLIFVLSPGSDPTAGLLKFADDLGMGGSRTQTISLGQGQGPVAEQLIKAALSVGHWVVLQNCHLATSWMPTLEKICEEVITPEN-THTSFRLWLTSQPSDKFPVSVLQNGVKMTNEPPKGLRANLLRSYLSDPISDPTFFNSSARQEIWQKLLFGLCFFHALVQERRTFGPLGWNIPYEFNESDLRISIRQIQMFLDEYEEVPLEALTYLTGECNYGGRVTDDKDRRLLMSLLSIFYSWQLIQQDQYRVCEGDLYYVP-SHAPYQSYVDYIRNLPISAEPEVFGLHSNANITKDNQETNQLLDGVLLTLPRQTNSGAKSPQEVVDELAEGMLAKLPCDFDIEMVTNKYPLLYEESMNTVLRQELIRFNRLSKVVRSSLLNTQKALRGQVVMSSELENVFNSLLVGKVPAMWAAKSYPSLKPLGSYVSDFLARLQFLQDWIDNGPPSVFWVSAFYFTQSFLTGVSQNFARKYTIPIDYIGFEFEVCKQETHMEEKPED-GAYIRGLFLEGARWNREHMVIGESVPKVLFDSLPIIWLKPGESATFLHQNVYVCPVYKTSARRGTLSTTGHSTNYVLSIELPSDQPQKHWVNRGVACLCQLDN 3859          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Zebrafish
Match: dnah7 (dynein, axonemal, heavy chain 7 [Source:ZFIN;Acc:ZDB-GENE-070912-282])

HSP 1 Score: 3443.28 bits (8927), Expect = 0.000e+0
Identity = 1843/3915 (47.08%), Postives = 2564/3915 (65.49%), Query Frame = 3
Query:  834 DTKQNFQTSVKKAILDYILLNKLEQKRLGLMMPNKISVPVLREEM-----PWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENI-CESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQY-RDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDE-AASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEF---NQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITP-RIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKS--HTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDL-NKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGA--IXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKC-ARNLMVP--KKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEIT--LKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDF-STDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDR--LXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSG--KLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLN 12497
            + ++++  S+KK I+D++L +  E K L         +P  R+EM     PW    LQ+++ ++   +  + T++++L  +   + +LRLI +E    E   + L+   ++  ++ ++ +  L N+W+ + ++I      +  +++P +    +  ++ F+NCVATL ++ L+ +   S+ ++   I Q    V  YE            +   +LR+ L+ +      + F P F      +  + + ++ S+S   R+E  L+ +  G P     L  +   E + + +EK+R  ++  S  P+K+  +Y  +  L+++  E+   QF+       +   E+ + + L+DE   S    + + +F L    + + L+ R++ L    +NHM    + FN  +C +YD+I  +  +    T +L+EL+ YV K+   E++ L+ KL+++   + FL++Y      DI LN+ TF  + R+  I D     + ++  +  + L+   ++ +E++   + Q++EF      ++LN  ++  Q L+    KL   +E+ + INQEE      V + Y Q + +     P+ +L+++A  F   + +W+ GP+  V+ ++VE +  +  +  Y+L K F   +   P++ A ++KA++E FK ++PI+Q LCNPGL++RHW+AMS  VGF + P   D  ++  L + L+ HL     +S  ASKE  LEKA  RM ++W  + F+  PY+ETG +IL ++D++Q+LL+DHIVKT TMR SPFI PFE+EI  W+  L  L++ ++ WLKVQ  WLYLEPIF S DI  Q+P EG +F  VD+ WR  M +V+ D  V+ V+  + +L+ ++ S  LLE I KGLN+YLEKKRLYFPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGI+ + FT+   IT M S+E E V+    I   +A G VEKW+L++E  M  S+ +V+ KA   Y    R  WV+ WPGQ VL  S V+WT+    AI      L+ +L++N+ QI  IV LVR + L    R+TL A +VLDVHARDV+A L+   V  E +F W+SQ+RYYW          + L  +M+   + YGYEYLGNT RLVITPLTDRCYRTL GA+ L+LGGAPEGPAGTGKTET+KDLAKA+AKQCVVFNCSDGLDY ++GKFFKGL  +GAWACFDEFNRI+LEVLSV+AQQI TIQR I    EM LFEGTEL+L+ +C +FITMNPGYAGRSELPDNLK LFRTVAMMVPDYALIAEI LYS GFV AR L+ KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     E+ ++L+SIIDVNLPKFL  D+PLF+GI SDLFPG++ P  DY  L   + E    M L+   +F +KI+QIYEM++VRHG M+VG+ F GKT A++ L+ AL D+  K L  EN V   +INPK+I++G LYG+FD VSHEWSDGILA ++R  A S+S +RKW+IFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+ + ++IFEP DLE ASPATVSRCGMIYMEP  LG  P++  W+   +P  L    +  +  LF+ ++P  L  I +  K      +  LV +++ L   ++D+    G +S                     K  ++ ++      ++L   F   L+WS GA    +   K         +  +++    ++   ++++  A+ L VP   +GT++++ F+K+  G W  W    E      + K  + + I++PT +TVR    L ++L   +KP +FVG TGTGKS  I  F+L+ L    +    + FSAQT++ Q Q+   SKLD+RR+G++ PP  K +VVF+DD++MP +E YGAQPPVE+LRQ +DH  W+D KD + + + D+ I  AM  P   R  VT R LRHFN + I+EFD++TM  IF  I+DWH    F        ++  I+ AT  ++Q    + LPTPAKSHY+FNLRDFSRVIQG  L +     +LT       + RLWVHE  RV++DRL+  +DC      +++V +    E FH LF    S  +   T  ++R LMF DF     DP           +GE + Y E+ D E L Q ++ +L+EYN +SKAPM+LVLFRFAIEH+ RI R+L+QP GH+LLVG+GGSGRQS  +LA  + + E+FQ+E++++Y VS+WRDD++ +++ +        FLF D QIK   FLED++ LLN+G++PNLF  +++  +    ++    + ++ Q + + + ++N F+ER R  LH+VL  SPIGD F SRLR FP+LINCCTI+WFQ WPEDAL+ VA++ L++VE+    RE  + MC+ FH S  DLS  F   + R NYVTPTSYLELI  F +LL +K+ E++  K RY VGL+KLE +  Q+S MQ EL+A QPQL   +KE E+++ +I+ E+ EV K  KVV+ +EA    +A  AK+IKD+C+++LA A+P++ AA+ ALDTL Q DI++VKAM+NPP GVKLVMEA+CILKG+KP++  DPSG  K +EDYW  AKKLLGD+KFL  L  Y+KD IP +YM  IR +YI NP F P KI+  S+A EGLC WV A++ YD++ KVV+PKKEKLA AE   +  M  L+ KQ  L EV+ KLAKLQE  +  + +K DLEN +E+   K+ERAE+LI GLGGEK RW +   +L   ++N+ GD+L+ A IVAYLG FT  +RQ   E W + CKS  IP S   +   S  LG+PV++R W I GLP DSFS+DNA+I+++  RW L+IDPQGQANKW+K +E + N L VIKLSD  ++R LENC+QFGTP LLENVGEELD +LE +LLKQTFKQ     IRLGD  +EY+ DFRFYITT+LRNPHYLPE SVKVTL+NFMITP G++DQ+LGIV A+E+P+LE+ +  LI++ A N+RQL+EIED+IL++LS S+GNILEDE A++ILSSSKVL+ +IS KQ  A  TE +I+  R GY P+A H +ILFF+I+DLA+++PMYQYSL+WFINL+I SI+NS+ S  +E RL+ L  HFT ++Y N+CRSLFEKDKLLFSF L + + K    VDE  WRFLLTGG+ LD+P  NP   WL + SW+E+  L  +E FKG  KD     + WK + DSK PH   FP +W+E+L   +R+++IRCL P+KV+P V  ++ G LG +++E P F+L  +F +S    P+IF+LSPG DPM+ L +F E +  +   L  +SLGQGQGPIA S I   +K   W++LQNCHLATSW+  L ++CEE  L     +P+FRLWLTSYPS  FPV VLQN VKMTNE PKGLR+N++RS+   PISD +FF +S +P VF+KLLFSLCFFHA+ QERR +G +GWNIPYEFN++DL+IS++QL MF++ YE++  +AL Y+TGECNYGGRVTD+ DRR + ++L   Y  E++    +    SG Y  P    D NSY+ + K  P N +PE+FG++ NA++ K+Q ET  LF+SIL+T  +   G + SS  ++ ++A+DIL+KLPQ F  +    KYP  Y + MNTVL+QE+ RFNKL++ IR S V+++ A++GL++M   LEEV  S++ G++P++W + SYPSLKPLG YISD + R+KF Q+W  +G P  FW+SGF+FTQ+FLTG  QNYARR    ID L FDF +ME  EY  P ++G +I GL+L+  RW      L ES  K+L+D +PVI + P  K  I     Y  PVYKT+ RRG LSTTGHSTNYV ++AL S    +HWI RG+A LCQLN
Sbjct:  187 EMREDYLLSIKKNIVDFVLQDPRENKEL-----KARDLPPHRQEMEIIPKPWKKSFLQAQKRMRNNLFTVNHTMLEVLGLWQVSFKKLRLIDVEAFHSEEESMELSVFQQLVNKHIERATGILLNTWIPEVQKIYHRG--NKRNLIPSN--SSVARLQSFYNCVATLMTSQLQSLALESMQDYTHLIAQNPHSVRVYE------------HPGFVLRLVLDQNT-----IKFEPDFKDFEVTVLNVYNAMLKSLSVIPRVETKLYSEWPG-PETHHTLKPIILPEILEAQQEKVRRVIRAESAEPLKHVHLYDKYAPLVSQQAEEDVTQFLLEQHSFQELMMEVIRYQQLADEIQCSTVKVVRLGMFELHSHDLVRALVKRAEGLLQKLVNHMLQGHQEFNNKLCEEYDTIANKALRSPSNTEELMELRAYVAKVEEEEILQLEMKLQESNNRLCFLVDYVTFSPTDIQLNSKTFQRHARMPSIFDQHRQIIKEKTGQFQDGLKLRCERILEDIKSYEQQVEEFVNFGDLSELNKYLKKAQSLNS---KLELVMEKIRGINQEEEAFDWPV-SQYPQRKTVQDQLLPYLRLYETAAEFQSQHHQWVTGPLTAVNPDKVEVDVGNYSRGLYKLEKTFQ--DLPKPLQIATSVKAEVEAFKEHIPIVQVLCNPGLRERHWEAMSAVVGFPLKPSEEDACVAHFLPLHLEAHLSAFESISEGASKEHGLEKAMERMVSEWAGMEFTLLPYRETGTSILSSLDEVQMLLDDHIVKTQTMRGSPFIKPFEAEIRDWEDKLLLLQEIMDEWLKVQGTWLYLEPIFSSPDIMAQMPEEGRRFTAVDKTWRDTMKQVSLDKHVLAVVAIEKMLDKMKHSNELLELILKGLNEYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASVVFTDVLDITHMRSSEGEVVELLDIISTSKARGQVEKWLLELENGMLRSIHKVIGKACEAYLNDLRINWVRAWPGQTVLCVSQVYWTKDIHEAIAKGPKALQAYLEQNNTQIDDIVTLVRGK-LSKQNRVTLGALVVLDVHARDVLASLVQKGVDDETNFEWLSQLRYYWI--------ENQLHTKMINAGLAYGYEYLGNTPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAIAKQCVVFNCSDGLDYIALGKFFKGLLSAGAWACFDEFNRIDLEVLSVVAQQILTIQRGISAHAEMLLFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYALIAEIVLYSCGFVRARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKFPEENEDVLLLRSIIDVNLPKFLAHDLPLFEGITSDLFPGIKLPKPDYSVLLEAIRENSAKMNLQVTDFFAEKILQIYEMMIVRHGFMLVGEPFGGKTSAYRVLAAALNDICEKNLMEENRVQITVINPKSITMGQLYGQFDPVSHEWSDGILAVSYRAFAISQSPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMSLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPVMLSWLNT-VPSTLSSMHKDLITGLFDRMLPACLQLIRKGTKELSPTSNTSLVKSLMNLMDCMMDEF---GDESQM-------------------KRMDQRDV-----CSWLEGIFVFCLLWSVGASCTEEGRVKFDGLVREMLVGGLSEETRTRHGILEHVEPPAKQLTVPLPTEGTLYEYRFLKEGPGRWELWTE--ELKAFPPIPKDVQFNEIIVPTENTVRYNA-LMKLLITHQKPTVFVGPTGTGKSVYILDFLLNRLEKDVYSPLLINFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKKMVVFVDDVNMPARETYGAQPPVELLRQWLDHWNWYDMKDCSMINLVDIQIMCAMGPPGGGRNPVTPRFLRHFNTVTINEFDNKTMFTIFSRILDWHLTIRFPFPKPFASVTSQIISATMSVYQEATKNLLPTPAKSHYLFNLRDFSRVIQGICLSRPETADDLT------AIKRLWVHEVLRVYYDRLVHPDDCAWMVGFLQEVSKSHLNEDFHQLFKHLDSNSDGLVTEDDLRSLMFCDF----HDP-----------KGEDRNYREVGDAEKLRQVVETHLEEYNNISKAPMNLVLFRFAIEHVCRISRILKQPRGHALLVGVGGSGRQSLTRLAAHMAEAELFQVEISKSYGVSEWRDDLKLIMQKSTSGDTHGVFLFTDTQIKMESFLEDVSNLLNTGEVPNLFAVDEKQEICERMRVLDRQRDRDKQTDGSTLALFNMFLERCRSQLHVVLAMSPIGDTFRSRLRRFPALINCCTIDWFQSWPEDALQAVASRFLEDVEMTNTAREGCISMCKSFHTSTIDLSAHFLSELQRYNYVTPTSYLELISMFKHLLQRKRTEVMKLKSRYEVGLQKLESAATQVSTMQGELEALQPQLRVATKEVEEMMVVIQHESEEVSKTEKVVRVDEAEANEQAMAAKAIKDECDADLAVAVPILEAALAALDTLTQQDITLVKAMKNPPAGVKLVMEAICILKGIKPDRIPDPSGSGKKVEDYWGPAKKLLGDMKFLQSLHEYNKDNIPVSYMSIIRNKYITNPDFVPEKIRTASAAAEGLCKWVCAMDSYDKVAKVVAPKKEKLAHAEEKLKVAMESLRKKQAALKEVQDKLAKLQETLETNKNKKADLENQVEMCSKKLERAEQLIGGLGGEKSRWSETAFNLGQLYNNLTGDILISAAIVAYLGAFTSSFRQRATEEWIDMCKSRGIPCSKNMSLMNS--LGEPVKIRSWTIAGLPSDSFSIDNAIIISNARRWPLMIDPQGQANKWLKNME-KSNSLHVIKLSDADFVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSVCIRLGDSTIEYAPDFRFYITTKLRNPHYLPEVSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALIVQGAENKRQLQEIEDKILEVLSASEGNILEDETAVQILSSSKVLANEISEKQAIAEVTELKIDQTRLGYTPIAIHSAILFFSIADLANIEPMYQYSLTWFINLFIMSIDNSQKSDLLEERLQILKDHFTYSLYCNVCRSLFEKDKLLFSFCLTVNLLKHNKLVDEKEWRFLLTGGVGLDNPHSNPC-TWLPKTSWDEICRLDEMERFKGLRKDLARLREGWKEVYDSKDPHHTDFPSEWQEKLGQFQRMLIIRCLRPDKVVPMVQEFVSGNLGQQFIEVPPFNLATAFADSHCCAPLIFILSPGSDPMAALLKFGEEQGFTGNRLTSLSLGQGQGPIAMSMIETGVKEGTWVVLQNCHLATSWMSTLERVCEE--LNADTTHPDFRLWLTSYPSPNFPVAVLQNGVKMTNEAPKGLRSNIIRSFCMDPISDPEFFDSSSKPAVFKKLLFSLCFFHALTQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEEIPFDALRYMTGECNYGGRVTDDWDRRTLRTILSIFYTSEIINDADYKFDPSGLYYSP-PEGDYNSYIEYTKTLPLNPSPEIFGMNANADITKDQVETQLLFDSILLTQSRSSGGSAASSDDMVFEVAADILNKLPQDFDTDAAMRKYPTSYNQSMNTVLVQEMGRFNKLLQTIRDSCVNIQKAIKGLVVMSAELEEVVSSILKGRIPAMWMKKSYPSLKPLGGYISDFLERLKFLQDWYMDGMPAVFWMSGFFFTQAFLTGGQQNYARRYTIPIDLLSFDFEVMEDKEYKNPPEDGVYIRGLFLDGARWDRRTKRLAESFPKILHDTMPVIWLKPMKKQDIPERQCYISPVYKTSERRGTLSTTGHSTNYVISMALNSDVPPEHWIRRGVALLCQLN 4000          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Zebrafish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 3374.72 bits (8749), Expect = 0.000e+0
Identity = 1815/3945 (46.01%), Postives = 2559/3945 (64.87%), Query Frame = 3
Query:  819 NQFLIDTKQNFQTSVKKAILDYILLNKLEQKRLGLMMPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTN-FRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMR---------------------------CAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKS--HTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKE-LNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTV-QLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQ--KYPRPKNLKCARNLMVP-----------KKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSG-FEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSG--KLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKAS-KRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVT-LPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENS-YHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            N+ L D  +    S  K ++ Y         R+  ++ N  S     ++    +  +QS+  +QK  +  H  +  +L      +  L LI + +   + P+    L        ++  + L  +W      +L S  D+++ + P+       +++ F+NC +TL SN L+ +V  S+T FV                 LF  +   N+N +    ++  +     + F P+F  +   + +I + I  ++ +   +++ L    EG  S+  I + L+ +   +  +  LR+ V++N E P K+ Q Y + + +L+N T +    + +  +    ++  ++E  ++LS E +SLP+ +   +  LDCE + Q L  ++  L  I +  + +     +  IC ++++I  R  K  ETT +++E+  Y+ +++T  +  L  ++ +A + + +L++  I   + + LN T   W   I PI D S   + + + +  N L   +++ +  L  +  +++EF + ++L+   +   ++  + ++L +  E    IN+EE L     +T Y +++ I    EP+ KL+   + + +   KWM+G  L+++ E +E E +   +  Y++ K F   + K  ++                           C++ +K ++++FK  +P++  LCNPG++ RHW+ MS   G D+TP   + L  +L   L  +LE    +S+ ASKEF LE+A   M   W  + F + PY++TGV+IL +VD+IQ +L+D IVKT TMR SPFI PFE+EI  W++ L  ++D ++ WLKVQ  WLYLEPIF S DI +Q+P EG  F+IV++ WR +M     D K++       L E LQ S  LLE I KGLN YLEKKRL+FPRFFFLSN+E+LEILSETKDP RVQPHLKKCFEGI+KL F     I  M S+E E V+F   I   EA G VEKW++QVE  M  S+R+V+ ++   Y +  R QWV++WPGQVVL AS ++WT +   AI+S  + L+++ ++   Q++ IVELVR + L    R TL A + +DVHARDV+ +L+   VSSE DF W++Q+RYYW        +NDN+ +R++  +V Y YEYLGN+ RLVITPLTDRCYRTL+GA  LNLGGAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY +MGKFFKGLA SGAWACFDEFNRIELEVLSV+AQQI  IQRAI  +LE F FEGTELRL+ +C + ITMNPGYAGRSELPDNLKVLFRTVAMMVP+YALIAEISLYS GF+ A+ L+ KIV  YRLCSEQLSSQ HYDYGMRAVK+VL AAG LK K     E+ ++L+SI DVN PKFL  DIPLF+GI SDLFPG+  P+ DY+              ++PV  FLDKIIQ YEM++VRHG M+VG+ F GKT     L+  L  +N+   N E  VI+  +NPK+I++G L+G+FD VSHEW+DGI+A TFRE ASSE+ ERKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQM+++ ++IFE  DL QASPATVSRCGMIYMEP QLG  PL+  W++  LP+ L  +  +T+ Q LF WL+PP+L  + ++C+  +   +   V ++ +L+  LL                               +  NE+   K  RT +++A F  +L+WS G                  C  TDS ++  K+ R      A N  +P           +KG ++D+ +  K  G W  W   I    L +  K T++ +I++PT+DTVR  + +   ++ GR P++ VG TGTGKS  +K  ++++L    FL   + FSA+TS++Q Q+   S+LD+RR+G+Y PP  K  ++F+DD++MP KE +GAQPPVE+LRQ  DH  W+D KD + + + D+ + SAM  P   R AVT R LRHFNI +I+ F DE+M  IF  I+ ++  +  F      +   IV AT +++Q  + + LPTPAKSHY FNLRDFSRV+QGCLLLK   L N         +IRL+VHE YRVF+DRL+  +D    F L   +V+  FK+ F  +F      NK      MR L+FGD++    D +E             +LY E+   E   + ++  LDEYN   K  M+LV+FR+ +EH++RI R+L+QP G++LLVG+GGSGRQS  +LATF+ +  +FQ E++++Y +++WR+D++RL++N G KG +T FL  D QIK+  FLED++ +LN+G++PN+F  +++ EI+E ++   Q  N  +E + + ++  F+ R ++NLH+V+ FSPIGDAF +RLR FPSLINCCTI+WFQ WPE+AL+ VANK L+ +++    R+++V +C+ FH S  DLS +F   +GR NYVTPTSYLELI  F  LL +++  ++++K RY+ GL+KL F+E+Q+S M+ EL   QP+L +   +  K++++IE E+VEVE   K+V+ +E    +KA +A+++K++CES+LAEA+P + AA+ ALDTLK  D++IVKAM+NPP GVKLVM AVC++K +KPE+  DPSG  + + DYW  +KKLLGD+ FL  LK YDKD IP   M KIR +Y+ NP FDP K+   SSA EGLC W+ A+EVYDR+ KVV+PKK  L VA+    T MA L  K+ EL EVE +LA LQ+  + K +EK  LE  ++L   K+ERAEKLI GLGGEK RW K  +DL   +DN+ GDVL+ AG++AYLG FT  +R +C ++W   CKS  IP  S   FSLS  LGDP+++R W I GLP DSFS+DN VIV+++ RW L+IDPQGQANKW+K  E + N L VIKL+D  Y+R LENC+QFGTP LLENVGEELD  LE +LLKQ FKQ  V+ IRLG+ V+EYS DFRFYITT+LRNPHYLPE + KV L+NFMITP GLEDQ+LGIV AKE+PELE+ R  LI++SA+N++QLKEIEDQIL+ L +S+GNILEDE AI+IL ++K++S +I+ KQ+ A KTE EI   R GY+ +A H SILFFTI+DLA++DPMYQYSL+WF+NLY++SI +S  S ++E RL+ L  +FT  +Y N+CRSLFEKDKLLFSFLLC  +   + +++   + FLLTGG+ L +   NP P+WL +KSW+E+   S+L    G  + F+ + + +  I DSK P     P  W ++L+ L+++++ RCL P+K+ PA+  ++   LG  +VEPP FDL  S+ +S+   P++FVLSPG DPM+ L +FA  KN+  +  K +SLGQGQGPIA   I  ++K   W+ LQNCHLA SW+  L KICE+  L     +PNFRLWLTSYPS  FPV +LQN VKMTNEPP GLR NLL+SY + PISD DFF    K+  V+EKLL+ +CFFHA+VQER+ +G +GWNIPY FN+SDL+ISIRQLQ+F+N+Y++V  EA+TYLTGECNYGGRVTD+ DRRL+M++L   Y+K+++    +  + SG Y  P   S    Y+  IK+ P    PEVFG+H N +++K+ Q+T  LF+S+L+T       G      + + D+A+DILSKLP  F IE   +K+PV YEE MNTVL+QE+ R+N L   IR SL +L  A++GL++M   LE V  S+++GKVP  W++ SYPSLKPLGSY++D +AR+KF Q+W D  +PH FW+SGF+FTQ+F+TG LQNYAR+    ID L F++ ++         ++G +IHGL+L+  RW  +   L E + KVL+D +P+I I PT K  ++  +S Y CP+YKT+ R+G LSTTGHSTN+V T+ LP+S+  QHWI RG+A LCQL+D
Sbjct:  145 NELLEDICKEVSESYLKVMIKY---------RVSTILKNPQSADTASQDWKGSADFVQSRREIQKNLHILHPAMKSVLDICYSTFSHLLLIDLSDCRSTGPVDCESLKNKVAVECERVEERLMKAWFPKIIHLLTSK-DTLQKVKPK-------KLDSFYNCASTLISNQLKALVEKSVTAFV----------------SLFDPL---NINKLPLFKMDL-IFDDEKMDFYPNFHDLELAVLEIANLISNTMQKVQTIQSWL---AEG--SISVIDAKLS-DHVQVWAQTTLRNAVRMNLEGPAKHFQSYVDRYDWLVNGTAQAQVDKLMEEEHSFDEHTKQVEWFRALSKEISSLPSLIHFDMVRLDCEELKQGLAKKANALSKIIVGKLVSSHHQCSLQICEEFEAIRDRALKVPETTEEMMEMITYINQVKTKGIEELNNRIMEAQQRMNYLMDVHIFNEEHLDLNTTVLLWPQNINPIFDQSDEVMDEAKLKGQNDLSGRREKLLLELDKVGRRMEEFAECSELDMIQQYAADVRTVLKRLQDIEESIDFINKEEALYQWE-KTSYPEVEVIKESIEPYQKLFTLVLKWQRTRKKWMDGSFLDLNGESIELEVEEYVREMYKMLKFFQQKQKKAELKKEKTAGLKKKTKEDQEDDKKESATILICSSVVK-QVKEFKEYIPLVSILCNPGIRPRHWEQMSEIAGQDLTPDSGSTLRKILKQNLTPYLELFEGISAGASKEFGLERAMQTMVEAWDTVSFHYHPYRDTGVSILSSVDEIQTMLDDQIVKTQTMRGSPFIKPFETEIKVWEERLIGIQDTIDEWLKVQHQWLYLEPIFSSEDIMKQMPEEGRLFQIVNKHWREVMANCVKDPKILAATSLPGLFEKLQESYNLLENIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPTRVQPHLKKCFEGIAKLDFLPNLDIQAMYSSEGERVEFIQLISTSEARGAVEKWLVQVEDIMLRSIRDVINRSRLAYPETKRSQWVREWPGQVVLCASQMYWTVEVHEAIRSSANGLKKYYEQLQNQLNDIVELVRGK-LPKQTRTTLGALVTIDVHARDVILELIEKGVSSETDFQWLAQLRYYW--------ANDNVRVRIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMRLEYFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPDENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPVADYKLFLECAHLCCENHNVQPVKVFLDKIIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNESGYNEEEKVIYQTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFASSETPERKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSSQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWTPLVLSWMKT-LPDPLQAQDNSTLLQQLFEWLLPPTLVLLRKQCREVIPSSNSNTVVSLTRLFEMLL------------------------------TRPVNEDPGNKNMRT-WIMAAFAFALVWSVGG-----------------CCDTDSRSRFDKFLREMISGKAENCPIPAAVSKWECPFDEKGLVYDYSYEFKGKGRWVHWNESISNAPLGD--KNTKVQDIIVPTIDTVRYTYLMDLCIQYGR-PLLLVGPTGTGKSVYVKEKLMNNLDKDLFLPFFINFSARTSANQTQNIIMSRLDKRRKGVYGPPMGKKCIIFVDDMNMPAKEVFGAQPPVELLRQYFDHGNWYDLKDTSKITLTDMQLISAMGPPGGGRNAVTPRFLRHFNICSINAFSDESMVRIFSNIVTFYLRTNEFPPDCFTVGNQIVSATLEVYQKAIENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLTN------KRTMIRLFVHEIYRVFYDRLVDDQDRAWLFTLTSNIVKQHFKDNFDSVFEHLKDGNKPLCEENMRNLLFGDYMMPDVDESE-------------RLYAEVPSVERFGEVVETCLDEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMSNMTLFQPEISKSYGMNEWREDLKRLMKNAGVKGEKTVFLLTDAQIKDEAFLEDVDSILNTGEVPNIFAVDEKQEIMEAVRPFAQAGNKNLEFSPLALFAYFVTRCKENLHIVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQPWPEEALERVANKFLETLDLSDLERKEVVPICKTFHTSAIDLSNRFLIELGRHNYVTPTSYLELIAAFRLLLTQRRDTVMSAKNRYTNGLDKLAFAESQVSEMKKELVDLQPKLEQAKIDNTKIMEVIEVESVEVEAKSKLVRVDEEAATLKANEAQALKNECESDLAEAIPALEAALSALDTLKPADVTIVKAMKNPPAGVKLVMAAVCVMKDIKPERINDPSGTGQKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPAQVMHKIRSEYMTNPDFDPTKVVKASSAAEGLCRWITAMEVYDRVAKVVAPKKANLIVAQESLATTMALLNQKRAELKEVEDRLAALQKTLEEKTEEKAQLEFQVDLCARKLERAEKLIGGLGGEKNRWLKAANDLQCTYDNLTGDVLISAGVIAYLGAFTARFRHDCTKMWAQLCKSKKIP--SSDDFSLSKTLGDPIKIRAWNIAGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERDHN-LNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQVFKQGGVDCIRLGESVIEYSADFRFYITTKLRNPHYLPELATKVCLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDQILETLQSSEGNILEDESAIQILDAAKLMSNEITKKQQIAEKTEIEIAESREGYRAIAKHSSILFFTIADLANIDPMYQYSLNWFVNLYVNSILDSNKSKNLEKRLRYLIDYFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYSEFMFLLTGGVGLQNSIPNPDPNWLPDKSWDEICRASDLPALNGIKESFIKSPESFLPIYDSKEPFNTALPKPWCDKLNELQKMIIYRCLRPDKIEPAISKFVTDKLGKIFVEPPPFDLSKSYNDSNCTIPLVFVLSPGADPMASLLKFANDKNMGGSQFKSISLGQGQGPIAVKLIRSAMKDGTWVCLQNCHLAVSWMSTLEKICED--LSPDTCHPNFRLWLTSYPSPRFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPISDADFFAGCPKKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNEYQEVPFEAITYLTGECNYGGRVTDDWDRRLLMTILADFYNKDVIDHPRYSFSPSGKYHAP-PKSIYEDYVEFIKKLPFTQHPEVFGMHENVDISKDLQQTKLLFDSLLLTQGGGSKGGGGSGGDSTLLDIANDILSKLPGNFDIESALVKFPVCYEESMNTVLVQEMQRYNNLSSTIRVSLQNLIKAIKGLVVMDAELEAVAGSLLVGKVPEKWAKCSYPSLKPLGSYVNDFLARLKFLQDWYDTQKPHVFWLSGFFFTQAFITGALQNYARKYSIPIDLLGFNYEVLPFDTSDSSPEDGVYIHGLFLDGARWDKKSGVLAEQYPKVLFDAVPIIWIKPTDKKAMDQPHSVYVCPLYKTSERKGTLSTTGHSTNFVITMMLPTSKRPQHWIKRGVALLCQLDD 3958          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Zebrafish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 3355.07 bits (8698), Expect = 0.000e+0
Identity = 1809/3894 (46.46%), Postives = 2536/3894 (65.13%), Query Frame = 3
Query:  969 PWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTN-FRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMR---------------------------CAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKS--HTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKE-LNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTV-QLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQ--KYPRPKNLKCARNLMVP-----------KKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSG-FEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSG--KLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKAS-KRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVT-LPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            PWH   +QS+  +QK  +  H  +  +L      +  L LI + +   + P+    L        ++  + L  +W      +L S  D+++ + P+       +++ F+NC +TL SN L+ +V  S+T FV                 LF  +   N+N +    ++  +     + F P+F  +   + +I + I  ++ +   +++ L    EG  S+  I + L+ +   +  +  LR+ V++N E P K+ Q Y + + +L+N T +    + +  +    ++   LE  ++LS E +SLP+ +   +  LDCE + Q L  ++  L  I L   ++   +F R IC ++++I  R  K  ETT +++E+  Y+ +++T  +  L  ++  +   + +L++  I   + + LN T   W   I PI D S   + + + +  N L   +++ +  L  +  +++EF + ++L+   +   ++  + ++L +  E    IN+EE L     +T Y +++ I    EP+ KL+   + + +   KWM+G  L+++ E +E E +   +  Y++ K F   + K  ++                           C++ +K ++++FK  +P++  LCNPG++ RHW+ MS   G D+TP   + L  +L   L  +LE    +S+ ASKEF LE+A   M   W  + F + PY++TGV+IL +VD+IQ +L+D IVKT TMR SPFI PFE+EI  W++ L  ++D ++ WLKVQ  WLYLEPIF S DI +Q+P EG  F+IV++ WR +M     D K++       L E LQ S  LLE I KGLN YLEKKRL+FPRFFFLSN+E+LEILSETKDP RVQPHLKKCFEGI+KL F     I  M S+E E V+F   I   EA G VEKW++QVE  M  S+R+V+ ++   Y +  R QWV++WPGQVVL AS ++WT +   AI+S  + L+++ ++   Q++ IVELVR + L    R TL A + +DVHARDV+ +L+   VSSE DF W++Q+RYYW        +NDN+ +R++  +V Y YEYLGN+ RLVITPLTDRCYRTL+GA  LNLGGAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY +MGKFFKGLA SGAWACFDEFNRIELEVLSV+AQQI  IQRAI  +LE F FEGTELRL+ +C + ITMNPGYAGRSELPDNLKVLFRTVAMMVP+YALIAEISLYS GF+ A+ L+ KIV  YRLCSEQLSSQ HYDYGMRAVK+VL AAG LK K     E+ ++L+SI DVN PKFL  DIPLF+GI SDLFPG+  P+ DY+              ++PV  FLDKIIQ YEM++VRHG M+VG+ F GKT     L+  L  +N+   N E  VI+  +NPK+I++G L+G+FD VSHEW+DGI+A TFRE ASSE+ ERKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQM+++ ++IFE  DL QASPATVSRCGMIYMEP QLG  PL+  W++  LP+ L  +  +T+ Q LF WL+PP+L  + ++C+  +   +   V ++ +L+  LL                               +  NE+   K  RT +++A F  +L+WS G                  C  TDS ++  K+ R      A N  +P           +KG ++D+ +  K  G W  W   I    L +  K T++ +I++PT+DTVR  + +   ++ GR P++ VG TGTGKS  +K  ++++L    FL   + FSA+TS++Q Q+   S+LD+RR+G+Y PP  K  ++F+DD++MP KE +GAQPPVE+LRQ  DH  W+D KD + + + D+ + SAM  P   R AVT R LRHFNI +I+ F DE+M  IF  I+ ++  +  F      +   IV AT +++Q  + + LPTPAKSHY FNLRDFSRV+QGCLLLK   L N         +IRL+VHE YRVF+DRL+  +D    F L   +V+  FK+ F  +F      NK      MR L+FGD++    D +E             +LY E+   E   + ++  LDEYN   K  M+LV+FR+ +EH++RI R+L+QP G++LLVG+GGSGRQS  +LATF+ +  +FQ E++++Y +++WR+D++RL++N G KG +T FL  D QIK+  FLED++ +LN+G++PN+F  +++ EI+E ++   Q  N  +E + + ++  F+ R ++NLH+V+ FSPIGDAF +RLR FPSLINCCTI+WFQ WPE+AL+ VANK L+ +++    R+++V +C+ FH S  DLS +F   +GR NYVTPTSYLELI  F  LL +++  ++++K RY+ GL+KL F+E+Q+S M+ EL   QP+L +   +  K++++IE E+VEVE   K+V+ +E    +KA +A+++K++CES+LAEA+P + AA+ ALDTLK  D++IVKAM+NPP GVKLVM AVC++K +KPE+  DPSG  + + DYW  +KKLLGD+ FL  LK YDKD IP   M KIR +Y+ NP FDP K+   SSA EGLC W+ A+EVYDR+ KVV+PKK  L VA+    T MA L  K+ EL EVE +LA LQ+  + K +EK  LE  ++L   K+ERAEKLI GLGGEK RW K  +DL   +DN+ GDVL+ AG++AYLG FT  +R +C ++W   CKS  IP  S   FSLS  LGDP+++R W I GLP DSFS+DN VIV+++ RW L+IDPQGQANKW+K  E + N L VIKL+D  Y+R LENC+QFGTP LLENVGEELD  LE +LLKQ FKQ  V+ IRLG+ V+EYS DFRFYITT+LRNPHYLPE + KV L+NFMITP GLEDQ+LGIV AKE+PELE+ R  LI++SA+N++QLKEIEDQIL+ L +S+GNILEDE AI+IL ++K++S +I+ KQ+ A KTE EI   R GY+ +A H SILFFTI+DLA++DPMYQYSL+WF+NLY++SI +S  S ++E RL+ L  +FT  +Y N+CRSLFEKDKLLFSFLLC  +   + +++   + FLLTGG+ L +   NP P+WL +KSW+E+   S+L    G    F+        I DSK P     P  W ++L+ L+++++ RCL P+K+ PA+  ++   LG  +VEPP FDL  S+ +S+   P++FVLSPG DPM+ L +FA  KN+  +  K +SLGQGQGPIA   I  ++K   W+ LQNCHLA SW+  L KICE+  L     +PNFRLWLTSYPS  FPV +LQN VKMTNEPP GLR NLL+SY + PISD DFF    K+  V+EKLL+ +CFFHA+VQER+ +G +GWNIPY FN+SDL+ISIRQLQ+F+N+Y++V  EA+TYLTGECNYGGRVTD+ DRRL+M++L   Y+K+++    +  + SG Y  P   S    Y+  IK+ P    PEVFG+H N +++K+ Q+T  LF+S+L+T       G      + + D+A+DILSKLP  F IE   +K+PV YEE MNTVL+QE+ R+N     IR SL +L  A++GL++M   LE V  S+++GKVP  W++ SYPSLKPLGSY++D +AR+KF Q+W D  +PH FW+SGF+FTQ+F+TG LQNYAR+    ID L F++ ++         ++G +IHGL+L+  RW  +   L E + KVL+D +P+I I P+  + I+  + Y CP+YKT+ R+G LSTTGHSTN+V T+ LP+S+  QHWI RG+A LCQL+D
Sbjct:  123 PWHDSFVQSRREIQKNLHILHPAMKSVLDICYSTFSHLLLIDLSDCRSTGPVDCESLKNKVAVECERVEERLMKAWFPKIIHLLTSK-DTLQKVKPK-------KLDSFYNCASTLISNQLKALVEKSVTAFVS----------------LFDPL---NINKLPLFKMDL-IFDDEKMDFYPNFHDLELAVLEIANLISNTMQKVQTIQSWL---AEG--SISVIDAKLS-DHVQVWAQTTLRNAVRMNLEGPAKHFQSYVDRYDWLVNGTAQAQVDKLMEEEHSFDEHTKVLEWFRALSKEISSLPSLIHFDMVRLDCEELKQGLAKKANALSKIIL---SDGVFLFFR-ICEEFEAIRDRALKVPETTEEMMEMITYINQVKTKGIEELNNRIMVSISQMNYLMDVHIFNEEHLDLNTTVLLWPQNINPIFDQSDEVMDEAKLKGQNDLSGRREKLLLELDKVGRRMEEFAECSELDMIQQYAADVRTVLKRLQDIEESIDFINKEEALYQWE-KTSYPEVEVIKESIEPYQKLFTLVLKWQRTRKKWMDGSFLDLNGESIELEVEEYVREMYKMLKFFQQKQKKAELKKEKTAGLKKKTKEDQEDDKKESATILICSSVVK-QVKEFKEYIPLVSILCNPGIRPRHWEQMSEIAGQDLTPDSGSTLRKILKQNLTPYLELFEGISAGASKEFGLERAMQTMVEAWDTVSFHYHPYRDTGVSILSSVDEIQTMLDDQIVKTQTMRGSPFIKPFETEIKVWEERLIGIQDTIDEWLKVQHQWLYLEPIFSSEDIMKQMPEEGRLFQIVNKHWREVMANCVKDPKILAATSLPGLFEKLQESYNLLENIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPTRVQPHLKKCFEGIAKLDFLPNLDIQAMYSSEGERVEFIQLISTSEARGAVEKWLVQVEDIMLRSIRDVINRSRLAYPETKRSQWVREWPGQVVLCASQMYWTVEVHEAIRSSANGLKKYYEQLQNQLNDIVELVRGK-LPKQTRTTLGALVTIDVHARDVILELIEKGVSSETDFQWLAQLRYYW--------ANDNVRVRIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMRLEYFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPDENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPVADYKLFLECAHLCCENHNVQPVKVFLDKIIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNESGYNEEEKVIYQTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFASSETPERKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSSQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWTPLVLSWMKT-LPDPLQAQDNSTLLQQLFEWLLPPTLVLLRKQCREVIPSSNSNTVVSLTRLFEMLL------------------------------TRPVNEDPGNKNMRT-WIMAAFAFALVWSVGG-----------------CCDTDSRSRFDKFLREMISGKAENCPIPAAVSKWECPFDEKGLVYDYSYEFKGKGRWVHWNESISNAPLGD--KNTKVQDIIVPTIDTVRYTYLMDLCIQYGR-PLLLVGPTGTGKSVYVKEKLMNNLDKDLFLPFFINFSARTSANQTQNIIMSRLDKRRKGVYGPPMGKKCIIFVDDMNMPAKEVFGAQPPVELLRQYFDHGNWYDLKDTSKITLTDMQLISAMGPPGGGRNAVTPRFLRHFNICSINAFSDESMVRIFSNIVTFYLRTNEFPPDCFTVGNQIVSATLEVYQKAIENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLTN------KRTMIRLFVHEIYRVFYDRLVDDQDRAWLFTLTSNIVKQHFKDNFDSVFEHLKDGNKPLCEENMRNLLFGDYMMPDVDESE-------------RLYAEVPSVERFGEVVETCLDEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMSNMTLFQPEISKSYGMNEWREDLKRLMKNAGVKGEKTVFLLTDAQIKDEAFLEDVDSILNTGEVPNIFAVDEKQEIMEAVRPFAQAGNKNLEFSPLALFAYFVTRCKENLHIVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQPWPEEALERVANKFLETLDLSDLERKEVVPICKTFHTSAIDLSNRFLIELGRHNYVTPTSYLELIAAFRLLLTQRRDTVMSAKNRYTNGLDKLAFAESQVSEMKKELVDLQPKLEQAKIDNTKIMEVIEVESVEVEAKSKLVRVDEEAATLKANEAQALKNECESDLAEAIPALEAALSALDTLKPADVTIVKAMKNPPAGVKLVMAAVCVMKDIKPERINDPSGTGQKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPAQVMHKIRSEYMTNPDFDPTKVVKASSAAEGLCRWITAMEVYDRVAKVVAPKKANLIVAQESLATTMALLNQKRAELKEVEDRLAALQKTLEEKTEEKAQLEFQVDLCARKLERAEKLIGGLGGEKNRWLKAANDLQCTYDNLTGDVLISAGVIAYLGAFTARFRHDCTKMWAQLCKSKKIP--SSDDFSLSKTLGDPIKIRAWNIAGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERDHN-LNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQVFKQGGVDCIRLGESVIEYSADFRFYITTKLRNPHYLPELATKVCLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDQILETLQSSEGNILEDESAIQILDAAKLMSNEITKKQQIAEKTEIEIAESREGYRAIAKHSSILFFTIADLANIDPMYQYSLNWFVNLYVNSILDSNKSKNLEKRLRYLIDYFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYSEFMFLLTGGVGLQNSIPNPDPNWLPDKSWDEICRASDLPALNGIKYSFL-------PIYDSKEPFNTALPKPWCDKLNELQKMIIYRCLRPDKIEPAISKFVTDKLGKIFVEPPPFDLSKSYNDSNCTIPLVFVLSPGADPMASLLKFANDKNMGGSQFKSISLGQGQGPIAVKLIRSAMKDGTWVCLQNCHLAVSWMSTLEKICED--LSPDTCHPNFRLWLTSYPSPRFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPISDADFFAGCPKKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNEYQEVPFEAITYLTGECNYGGRVTDDWDRRLLMTILADFYNKDVIDHPRYSFSPSGKYHAP-PKSIYEDYVEFIKKLPFTQHPEVFGMHENVDISKDLQQTKLLFDSLLLTQGGGSKGGGGSGGDSTLLDIANDILSKLPGNFDIESALVKFPVCYEESMNTVLVQEMQRYNN---TIRVSLQNLIKAIKGLVVMDAELEAVAGSLLVGKVPEKWAKCSYPSLKPLGSYVNDFLARLKFLQDWYDTQKPHVFWLSGFFFTQAFITGALQNYARKYSIPIDLLGFNYEVLPFDTSDSSPEDGVYIHGLFLDGARWDKKSGVLAEQYPKVLFDAVPIIWIKPS--TIISPHSVYVCPLYKTSERKGTLSTTGHSTNFVITMMLPTSKRPQHWIKRGVALLCQLDD 3878          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Zebrafish
Match: CR450723.1 (dynein, axonemal, heavy chain 12 [Source:NCBI gene;Acc:799461])

HSP 1 Score: 3348.91 bits (8682), Expect = 0.000e+0
Identity = 1801/3897 (46.22%), Postives = 2526/3897 (64.82%), Query Frame = 3
Query:  969 PWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTN-FRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMR---------------------------CAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKS--HTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNK-ELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTV-QLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQ--KYPRPKNLKCARNLMVP-----------KKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSG-FEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXA---GCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSG--KLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKAS-KRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVT-LPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            PWH   +QS+  +QK  +  H  +  +L      +  L LI + +   + P+    L        ++  + L  +W      +L S  D+++ + P+       +++ F+NC +TL SN L+ +V  S+T FV                 LF  +   N+N +    ++  +     + F P+F  +   + +I + I  ++ +   +++ L    EG  S+  I + L+ +   +  +  LR+ V++N E P K+ Q Y + + +L+N T +    + +  +    ++   LE  ++LS E +SLP+ +   +  LDCE + Q L  ++  L  I L   ++   +F R IC ++++I  R  K  ETT +++E+  Y+ +++T  +  L  ++  +   + +L++  I   + + LN T   W   I PI D S   + + + +  N L   +++ +  L  +  +++EF + ++L+   +   ++  + ++L +  E    IN+EE L     +T Y +++ I    EP+ KL+   + + +   KWM+G  L+++ E +E E +   +  Y++ K F   + K  +                            C++ +K ++++FK  +P++  LCNPG++ RHW+ MS   G D+TP   + L  +L   L  +LE    +S+ ASKEF LE+A   M   W  + F + PY++TGV+IL +VD+IQ +L+D IVKT TMR SPFI PFE+EI  W++ L  ++D ++ WLKVQ  WLYLEPIF S DI +Q+P EG  F+IV++ WR +M     D K++       L E LQ S  LLE I KGLN YLEKKRL+FPRFFFLSN+E+LEILSETKDP RVQPHLKKCFEGI+KL F     I  M S+E E V+F   I   EA G VEKW++QVE  M  S+R+V+ ++   Y +  R QWV++WPGQVVL AS ++WT +   AI+S  + L+++ ++   Q++ IVELVR + L    R TL A + +DVHARDV+ +L+   VSSE DF W++Q+RYYW        +NDN+ +R++  +V Y YEYLGN+ RLVITPLTDRCYRTL+GA  LNLGGAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY +MGKFFKGLA SGAWACFDEFNRIELEVLSV+AQQI  IQRAI  +LE F FEGTELRL+ +C + ITMNPGYAGRSELPDNLKVLFRTVAMMVP+YALIAEISLYS GF+ A+ L+ KIV  YRLCSEQLSSQ HYDYGMRAVK+VL AAG LK K     E+ ++L+SI DVN PKFL  DIPLF+GI SDLFPG+  P+ DY+              ++PV  FLDKIIQ YEM++VRHG M+VG+ F GKT     L+  L  +N+   N E  VI+  +NPK+I++G L+G+FD VSHEW+DGI+A TFRE ASSE+ ERKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQM+++ ++IFE  DL QASPATVSRCGMIYMEP QLG  PL+  W++  LP+ L  +  +T+ Q LF WL+PP+L  + ++C+  +   +   V ++ +L+  LL                               +  NE+   K  RT +++A F  +L+WS G                  C  TDS ++  K+ R      A N  +P           +KG ++D+ +  K  G W  W   I    L +  K T++ +I++PT+DTVR  + +   ++ GR P++ VG TGTGKS  +K  ++++L    FL   + FSA+TS++Q Q+   S+LD+RR+G+Y PP  K  ++F+DD++MP KE +GAQPPVE+LRQ  DH  W+D KD + + + D+ + SAM  P   R AVT R LRHFNI +I+ F DE+M  IF  I+ ++  +  F      +   IV AT +++Q  + + LPTPAKSHY FNLRDFSRV+QGCLLLK   L N         +IRL+VHE YRVF+DRL+  +D    F L   +V+  FK+ F  +F      NK      MR L+FGD++    D +E             +LY E+   E   + ++  LDEYN   K  M+LV+FR+ +EH++RI R+L+QP G++LLVG+GGSGRQS  +LATF+ +  +FQ E++++Y +++WR+D++RL++N G KG +T FL  D QIK+  FLED++ +LN+G++PN+F  +++ EI+E ++   Q  N  +E + + ++  F+ R ++NLH+V+ FSPIGDAF +RLR FPSLINCCTI+WFQ WPE+AL+ VANK L+ +++    R+++V +C+ FH S  DLS +F   +GR NYVTPTSYLELI  F  LL +++  ++++K RY+ GL+KL F+E+Q+S M+ EL   QP+L +   +  K++++   +++    V    K          +KA +A+++K++CES+LAEA+P + AA+ ALDTLK  D++IVKAM+NPP GVKLVM AVC++K +KPE+  DPSG  + + DYW  +KKLLGD+ FL  LK YDKD IP   M KIR +Y+ NP FDP K+   SSA EGLC W+ A+EVYDR+ KVV+PKK  L VA+    T MA L  K+ EL EVE +LA LQ+  + K +EK  LE  ++L   K+ERAEKLI GLGGEK RW K  +DL   +DN+ GDVL+ AG++AYLG FT  +R +C ++W   CKS  IP  S   FSLS  LGDP+++R W I GLP DSFS+DN VIV+++ RW L+IDPQGQANKW+K  E + N L VIKL+D  Y+R LENC+QFGTP LLENVGEELD  LE +LLKQ FKQ  V+ IRLG+ V+EYS DFRFYITT+LRNPHYLPE + KV L+NFMITP GLEDQ+LGIV AKE+PELE+ R  LI++SA+N++QLKEIEDQIL+ L +S+GNILEDE AI+IL ++K++S +I+ KQ+ A KTE EI   R GY+ +A H SILFFTI+DLA++DPMYQYSL+WF+NLY++SI +S  S ++E RL+ L  +FT  +Y N+CRSLFEKDKLLFSFLLC  +   + +++   + FLLTGG+ L +   NP P+WL +KSW+E+   S+L    G    F+        I DSK P     P  W ++L+ L+++++ RCL P+K+ PA+  ++   LG  +VEPP FDL  S+ +S+   P++FVLSPG DPM+ L +FA  KN+  +  K +SLGQGQGPIA   I  ++K   W+ LQNCHLA SW+  L KICE+  L     +PNFRLWLTSYPS  FPV +LQN VKMTNEPP GLR NLL+SY + PISD DFF    K+  V+EKLL+ +CFFHA+VQER+ +G +GWNIPY FN+SDL+ISIRQLQ+F+N+Y++V  EA+TYLTGECNYGGRVTD+ DRRL+M++L   Y+K+++    +  + SG Y  P   S    Y+  IK+ P    PEVFG+H N +++K+ Q+T  LF+S+L+T       G      + + D+A+DILSKLP  F IE   +K+PV YEE MNTVL+QE+ R+N     IR SL +L  A++GL++M   LE V  S+++GKVP  W++ SYPSLKPLGSY++D +AR+KF Q+W D  +PH FW+SGF+FTQ+F+TG LQNYAR+    ID L F++ ++         ++G +IHGL+L+  RW  +   L E + KVL+D +P+I I P+  + I+  + Y CP+YKT+ R+G LSTTGHSTN+V T+ LP+S+  QHWI RG+A LCQL+D
Sbjct:  112 PWHDSFVQSRREIQKNLHILHPAMKSVLDICYSTFSHLLLIDLSDCRSTGPVDCESLKNKVAVECERVEERLMKAWFPKIIHLLTSK-DTLQKVKPK-------KLDSFYNCASTLISNQLKALVEKSVTAFVS----------------LFDPV---NINKLPLFKMDL-IFDDEKMDFYPNFHDLELAVLEIANLISNTMQKVQTIQSWL---AEG--SISVIDAKLS-DHVQVWAQTTLRNAVRMNLEGPAKHFQSYVDRYDWLVNGTAQAQVDKLMEEEHSFDEHTKVLEWFRALSKEISSLPSLIHFDMVRLDCEELKQGLAKKANALSKIIL---SDGVFLFFR-ICEEFEAIRDRALKVPETTEEMMEMITYINQVKTKGIEELNNRIMVSISQMNYLMDVHIFNEEHLDLNTTVLLWPQNINPIFDQSDEVMDEAKLKGQNDLSGRREKLLLELDKVGRRMEEFAECSELDMIQQYAADVRTVLKRLQDIEESIDFINKEEALYQWE-KTSYPEVEVIKESIEPYQKLFTLVLKWQRTRKKWMDGSFLDLNGESIELEVEEYVREMYKMLKFFQQKQKKAELEKEKTAGLKKKTKEDQEDDKKESATILICSSVVK-QVKEFKEYIPLVSILCNPGIRPRHWEQMSEIAGQDLTPDSGSTLRKILKQNLTPYLELFEGISAGASKEFGLERAMQTMVEAWDTVSFHYHPYRDTGVSILSSVDEIQTMLDDQIVKTQTMRGSPFIKPFETEIKVWEERLIGIQDTIDEWLKVQHQWLYLEPIFSSEDIMKQMPEEGRLFQIVNKHWREVMANCVKDPKILAATSLPGLFEKLQESYNLLENIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPTRVQPHLKKCFEGIAKLDFLPNLDIQAMYSSEGERVEFIQLISTSEARGAVEKWLVQVEDIMLRSVRDVINRSRLAYPETKRSQWVREWPGQVVLCASQMYWTVEVHEAIRSSANGLKKYYEQLQNQLNDIVELVRGK-LPKQTRTTLGALVTIDVHARDVILELIEKGVSSETDFQWLAQLRYYW--------ANDNVRVRIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMRLEYFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPDENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPVADYKLFLECAHMCCENHNVQPVKVFLDKIIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNELGYNEEEKVIYQTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFASSETPERKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSSQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWTPLVLSWMKT-LPDPLQAQDNSTLLQQLFEWLLPPTLVLLRKQCREVIPSSNSNTVVSLTRLFEMLL------------------------------TRPLNEDPGNKNMRT-WIMAAFAFALVWSVGG-----------------CCDTDSRSRFDKFLREMISGKAENCPIPAAVSKWECPFDEKGLVYDYSYEFKGKGRWVHWNESISNAPLGD--KNTKVQDIIVPTIDTVRYTYLMDLCIQYGR-PLLLVGPTGTGKSIYVKEKLMNNLDKDLFLPFFINFSARTSANQTQNIIMSRLDKRRKGVYGPPMGKKCIIFVDDMNMPAKEVFGAQPPVELLRQYFDHGNWYDLKDTSKITLTDMQLISAMGPPGGGRNAVTPRFLRHFNICSINAFSDESMVRIFSNIVTFYLRTNEFPPDCFTVGNQIVSATLEVYQKAIENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLTN------KRTMIRLFVHEIYRVFYDRLVDDQDRAWLFTLTSNIVKQHFKDNFDSVFEHLKDGNKPLCEENMRNLLFGDYMMPDVDESE-------------RLYAEVPSVERFGEVVETCLDEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMSNMTLFQPEISKSYGMNEWREDLKRLMKNAGVKGEKTVFLLTDAQIKDEAFLEDVDSILNTGEVPNIFAVDEKQEIMEAVRPFAQAGNKNLEFSPLALFAYFVTRCKENLHIVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQPWPEEALERVANKFLETLDLSDLERQEVVPICKTFHTSAIDLSNRFLLELGRHNYVTPTSYLELIAAFRLLLTQRRDTVMSAKNRYTNGLDKLAFAESQVSEMKKELVDLQPKLEQAKIDNTKIMEVTFIQSMIRFSVEAKSKLVRVDEEAATLKANEAQALKNECESDLAEAIPALEAALSALDTLKPADVTIVKAMKNPPAGVKLVMAAVCVMKDIKPERINDPSGTGQKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPAQVMHKIRSEYMTNPDFDPTKVVKASSAAEGLCRWITAMEVYDRVAKVVAPKKANLIVAQESLATTMALLNQKRAELKEVEDRLAALQKTLEEKTEEKAQLEFQVDLCARKLERAEKLIGGLGGEKNRWLKAANDLQCTYDNLTGDVLISAGVIAYLGAFTARFRHDCTKMWAQLCKSKKIP--SSDDFSLSKTLGDPIKIRAWNIAGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERDHN-LNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQVFKQGGVDCIRLGESVIEYSADFRFYITTKLRNPHYLPELATKVCLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDQILETLQSSEGNILEDESAIQILDAAKLMSNEITKKQQIAEKTEIEIAESREGYRAIAKHSSILFFTIADLANIDPMYQYSLNWFVNLYVNSILDSNKSKNLEKRLRYLIDYFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYSEFMFLLTGGVGLQNSIPNPDPNWLPDKSWDEICRASDLPALNGIKYSFL-------PIYDSKEPFNTALPKPWCDKLNELQKMIIYRCLRPDKIEPAISKFVTDKLGKIFVEPPPFDLSKSYNDSNCTIPLVFVLSPGADPMASLLKFANDKNMGGSQFKSISLGQGQGPIAVKLIRSAMKDGTWVCLQNCHLAVSWMSTLEKICED--LSPDTCHPNFRLWLTSYPSPRFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPISDADFFAGCPKKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNEYQEVPFEAITYLTGECNYGGRVTDDWDRRLLMTILADFYNKDVIDHPRYSFSPSGKYHAP-PKSIYEDYVEFIKKLPFTQHPEVFGMHENVDISKDLQQTKLLFDSLLLTQGGGSKGGGGSGGDSTLLDIANDILSKLPGNFDIESALVKFPVCYEESMNTVLVQEMQRYNN---TIRVSLQNLIKAIKGLVVMDAELEAVAGSLLVGKVPEKWAKCSYPSLKPLGSYVNDFLARLKFLQDWYDTQKPHVFWLSGFFFTQAFITGALQNYARKYSIPIDLLGFNYEVLPFDTSDSSPEDGVYIHGLFLDGARWDKKSGVLAEQYPKVLFDAVPIIWIKPS--TIISPHSVYVCPLYKTSERKGTLSTTGHSTNFVITMMLPTSKRPQHWIKRGVALLCQLDD 3870          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 3885.88 bits (10076), Expect = 0.000e+0
Identity = 2039/3900 (52.28%), Postives = 2748/3900 (70.46%), Query Frame = 3
Query:  846 NFQTSVKKAILDYILLNKLEQKRLGLM-MPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICEST-PLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNK-EKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQ--LNDAVENEQELDKMAEKLNECIEEKKQIN-QEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNI-ENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEER-TNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTT-EIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPS--GKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADE----GAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            ++ TS++K I+DYIL +  E++RL +   P+   + V+R  +PWH    ++  + Q   +  +  ++ L   +  ++ +LR +  E +     PL   +  E+ +++ ++    L+N W+  C  +  S  D    ++P+   +   +++ FF C+A+L S  LR +V NS+ + + F   +++      + D +  M       IL + L  +      + F P+ +     +      I+ S     ++E  LF  ++ T +L   LS +  +E ++SN   K  +   LN   P KY  +Y  +  LLN+  +     F+  +  L  +  ++  +  L  E AS+   +P+ LF LD   +N+ L  R++ L+   +  + +++RV N+SIC++Y  I  ++ +   TT +LV L +++ K R   +  L+ ++ +AA  + FLL+Y  L  DD+ LN+T F W ++I  + + +   L  ++++A + L K + +F + L G   +I+ F +R    L++   N ++L+++   LN  + E + IN +EELL     Q P LQ    +  K PF++LW +A  FH   ++WMNG   +++AE++  E  ++W+  Y+L+K F+  +  GP R A  +K K++KFK++LPII  +CN G+K+RHW+ +S+ VG+DITP  DT L +ML  GL K++E L ++ + ASKE+SLEKA  +M+++W  I F F  Y+ET  +IL  VDDIQ+LL+DHI+KT TM  SPFI P E+E   W++TL  +++ +++WLK QA WLYLEPIF S DI  Q+P EG +F IVD  W+ IM +   D++V+   K DN+L  LQ S  LLE IQKGLN YLEKKRLYFPRFFFLSN+ELLEILSETKDPLRVQPHLKKCFEGI+KL+FTE+  ITGM+S+E+E V  +  I+P +A+G+VEKW+LQVE  M  S+R+V++  +  Y ++ R QWV  WPGQVV+  S+++WT++ + AI   TL  FL+K++QQI  IVELVR + L S  R TL A  V+DVHARDVVAKL   +VS+  DF WISQ+RY W           +++++M+TTEV YGYEYLGN+ RLVITPLTDRCYRTLMGA+KLNLGGAPEGPAGTGKTET+KDLAKA+AKQCVVFNCSDGLDYK+MGKFFKGLAQSGAWACFDEFNRIE+EVLSV+AQQI +IQ+AI   ++ F FEGTEL L+ +C++FITMNPGYAGR+ELPDNLK LFRTVAMMVPDYALI EISLYSMGF+++R+LA KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     E  ++L++++DVNL KFL  D+PLF GIISDLFPGV  P  DY    + L + +  +KL+PVPWF+ KIIQIYEM+LVRHG MIVG    GKTCA+K LS AL DL+   ++ E +V   +INPKAI++G LYG FD VSHEW+DG+LA TFRE ASS +D+RKWIIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+ K ++IFEP DLEQASPATVSRCGMIYMEP QLG  PL   ++   LPE L  E R  +  +FNWL+ P LDFI  +CK  V    + L  +M++LY+ LLD++ N  ++                           NE +  ++ T +L   F  S++W+ G  ++ DS+ KFD F+R+L    D   + +PRPK++K  +N + P+KG+++D  F K+  G W  W   I K +L  +I TT ++ +++IPT++T RQ FFL   L++   P++FVG TGTGKSA+  +F++  LP   ++ +S+ FSA+TS++Q QD  FSKLDRRR+G + PP  K  VVF+DD++MP KE YGAQPP+E+LRQ IDH  W+DRKD + L I DVL  SAM  P   R  +T R  RH NI+ ID FDDET+  IF  I DWHF+ GF+I   R  K+++ AT  I+++ + +FLPTP+KSHYVFNLRDFSRV++G LL     L++       +KLIRLW+HE YRVF+DRLI  ED  +FF ++K+     FK+         +   K   +  +R L FGD+ K   D                K+Y+EITD + L   M+ YL+EYN +SKAPM LV+FRFAIEHI+RICR+L+Q NGH LLVGIGGSGRQSA KLATF+  FE+FQIE+T+ Y++S+WRDD+++++   G  G  T FLF D+QIK+  F+EDINMLLN+GDIPN+F  +++ EI+EKMQ I + +  +IE T + MYN FIE+V+ NLH+VL  SPIGDAF +RLR FPSLINCCTI+WFQ WP DAL+MVANK L++V +  D+R+++V MC++F ++V  +S ++Y  + R NYVTPTSYLELI TF  LLN K+ E+ T + RY VGLEKLEF+ +Q+S+MQ EL A QP+LI+TS ETEK++  IE ET+EV+  +++V  +E      A  +K+IKD+CE +LAEAMP + AA+ ALDTL Q+DI++VK+M NPP  VKLVME++C++K +KP++K DPS  GK++ED+W  +KK+LGDLKFLD LK++DKD I  A M+KIR ++I+NP F P  IKN+SSACEGLC WVRA+EVYDR+ KVV+PK+E+L  AE     QM QL  K+ EL  VE +L  L +   +   +K +LENNIEL   K+ RAEKLI+GLGGEK RW +    L IR++N+ GDVLL +G VAYLG FT+ YR EC   WQ  CK   IP      FSLSS LGDPV+VR WQI GLPVDSFSVDN +IV+++ R+ L+IDPQGQANKWIK +E + NKL VIKLSD  Y R LEN +QFG P LLEN+GEE+D+VLE +LLKQTFKQ  VEYIRLG++++EYS+DFR Y+TTRLRNPHYLPE +VKV L+NFMITP GL+DQ+LGIV AKEKPELE+++ QLI+ESA+N++QLKEIED+IL++LS+S+GNILEDE AI++LSSSK+LSE+IS KQ+ A+ TE EI+  R GYKPVA H SI+FF ISDLA+++PMYQYSL+WFINLYIHS+ +SE S ++  R++N+  HFT ++Y N+CRSLFEKDKLLFS LL IGI KG++K+++ VWRFLLTGG++LD+P  NP   WLS+KSW E+   SNLEP  G++     NI KWK+I DS  P  EK P  W+E L+ + RLVV+RCL P+K++PAV  +I   +G +++EPP FDL  S+ +S+   P+IFVLSPG DPM+ L +FA+   +   +++ +SLGQGQGPIAE  I+ ++K  +W++LQNCHLATSW+  L KICEE+++ ++  +  FRLWLTSYPS  FPV++LQN +KMTNEPPKG+RANLLRSY   P+SD  FF + ++PQ+++KLLF LCFFHA+VQERRN+G +GWNIPYEFN+SDL+IS+RQLQMF+N+YE+V  EALTYLTGECNYGGRVTD++DRRL++ LL  VY+K+ +  + + L+   TY VP   +   S +++I+  P    PEVFGLH NA++ K+ QETNQLF  +L+TLP++ SG  +S Q I+EDLA DIL+KLP+ F +E++  KYPV+YEE MNTVL QELIRFN+L  V+R SL++L  A++G +LM   LE V+ SM++GKVPS+W+  SYPSLKPLGSY++DL++R++F Q WIDNG P  FW+SGFYFTQSFLTGV QNYAR+    ID + F F   E   Y    DE    GA++ GL+LE  RW  +   + ES  K+LYD LP+I + P   S     N+Y CPVYKT+ARRG LSTTGHSTNYV +I LPS +  +HW NRG+AALCQL+D
Sbjct:  221 DYYTSLRKTIVDYILKDPEEKERLFIANTPHPFPLRVIRAPVPWHISYNEAHGWNQDHLFTVNPMVLSLQELWINQFDDLRFVRTEELLSGCLPLLPAEFEEVVQRHCREAHTALRNKWIPACASLFTSQKDKWIHLVPQHDNDSTLQVQEFFACIASLMSLQLRGMVINSLQDLLSFFTLHQN---GNDFGDTYEEMKFC-TPQILIVKLRVE---EPKIAFEPALEECWALIKCCFLEILKSAEGLPKVEVDLFPDLQ-TENL--TLSSVTQDESLVSNYINKTMEVFNLNIVGPQKYLNVYKKYSDLLNQKAQQDISSFLKEEHSLHAFTKKINSISQLRGEIASMHITVPLALFCLDALRLNEDLCARAQTLKDQLIQFVVDENRVLNKSICSKYSLIADKVNEVPSTTEELVALIDFLRKSRDVTVYKLKDEISEAASRLAFLLDYATLQYDDLKLNSTVFYWPEQIETVFEVNNNRLMAKKDQAEDDLNKRRSEFEKKLQGYVTEIEAFKKRENMTLDEMKANVEKLNELDRNLNAALAEFEAINVEEELLEWEKSQFPLLQTA--MLNKVPFEQLWITAYNFHCKSEEWMNGAFQDLNAEDITEEVGNMWRNMYKLSKTFA--DMAGPKRVAENMKIKIDKFKMHLPIISVICNRGIKKRHWEQISDVVGYDITPAPDTSLLNMLEYGLSKYIERLEQIGASASKEYSLEKALEKMKSEWSNINFVFIRYRETSTSILSAVDDIQLLLDDHIIKTQTMCGSPFIKPIEAEAREWEQTLVLIQEIMDAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKNIMVEAVKDTRVLIATKQDNMLGRLQESNVLLEDIQKGLNTYLEKKRLYFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTEDLQITGMISSENEIVPLSQKIYPAKAKGMVEKWLLQVEENMLSSMRQVIRDGIDGYVEVPRKQWVLQWPGQVVICVSSIYWTKEVSEAIAEGTLPAFLEKSNQQIGEIVELVRGK-LSSGARATLGALTVIDVHARDVVAKLAQDKVSNLSDFQWISQLRYSW--------EGQDVMVKMITTEVKYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQSGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRNMKTFFFEGTELTLNPTCSVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYDLFIQALKDNIAKLKLQPVPWFIGKIIQIYEMMLVRHGFMIVGDPMGGKTCAYKVLSGALDDLHAANSMDEYAVELKVINPKAITMGQLYGCFDPVSHEWTDGVLATTFREQASSTTDDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSAKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLQDSYMNT-LPENLTSEHREMISDMFNWLLQPCLDFIRSECKFLVFTSPIHLAYSMMRLYTCLLDEIVNSSEEG--------------------------NEPMSSQQITLWLQGLFLFSVVWTIGGTINTDSRKKFDIFYRNLLMGLD---EHHPRPKSVKLTKNNLFPEKGSVYDFYFHKQASGQWNMWTDYITKEEL--IIPTTAKVSDLIIPTMETARQTFFLKTYLEHS-VPMLFVGPTGTGKSAITNSFLI-KLPKNKYVANSINFSARTSANQTQDIIFSKLDRRRKGQFGPPVGKQAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGHWYDRKDTSRLDILDVLFVSAMGPPGGGRNDITGRFTRHLNIVTIDAFDDETLTKIFGSIADWHFSKGFDIAFLRTGKLMIQATMAIYKAAVENFLPTPSKSHYVFNLRDFSRVVRGVLLCPHTHLQD------SDKLIRLWIHEVYRVFYDRLIDPEDRQVFFNMVKETTSNCFKQSVDKALSHLAPTGKV-VDDNIRSLFFGDYFKPDSD---------------TKIYDEITDLKHLTSVMEHYLEEYNNVSKAPMSLVMFRFAIEHISRICRVLKQDNGHLLLVGIGGSGRQSATKLATFMNSFELFQIEITKNYTISEWRDDVKKVMLQAGVAGKNTVFLFCDNQIKDEGFVEDINMLLNTGDIPNIFPADEKAEIVEKMQAIARTEGRKIEATPLAMYNFFIEKVKANLHMVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQTWPTDALEMVANKFLEDVALDDDIRKEVVSMCKYFQETVKQMSDRYYNTLRRHNYVTPTSYLELILTFKTLLNSKRQEVETMRNRYMVGLEKLEFASSQVSVMQKELTALQPELIKTSAETEKMMIKIEKETIEVDAKKELVSADEKVANEAAAASKAIKDECEGDLAEAMPALEAALSALDTLNQSDITLVKSMTNPPAPVKLVMESICVMKAIKPDRKPDPSGTGKMVEDFWGPSKKVLGDLKFLDGLKAFDKDNISPAVMKKIREKFIDNPDFQPSVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLKEAEGKLFIQMQQLNTKRAELKAVEDRLQALNDELSDMNNKKMELENNIELCSQKLVRAEKLISGLGGEKDRWTEAARLLGIRYNNLTGDVLLSSGTVAYLGAFTVDYRHECQNQWQILCKEKKIPC--SDDFSLSSTLGDPVKVRAWQIAGLPVDSFSVDNGIIVSNSRRFPLMIDPQGQANKWIKNME-KANKLFVIKLSDASYTRTLENAIQFGNPVLLENLGEEIDAVLEPLLLKQTFKQQGVEYIRLGENIIEYSKDFRLYMTTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAANKKQLKEIEDKILEVLSSSQGNILEDETAIKVLSSSKLLSEEISEKQQIASATEKEIDSTRMGYKPVAVHSSIIFFCISDLANIEPMYQYSLTWFINLYIHSLAHSEKSENLHERIENIIGHFTISIYNNVCRSLFEKDKLLFSLLLTIGIMKGEDKINDDVWRFLLTGGVALDNPYPNPASLWLSDKSWAEIVRASNLEPLSGFMNHVKDNISKWKTIYDSLKPQDEKLPDKWQE-LNGINRLVVLRCLRPDKMVPAVQEFISENMGKKFIEPPTFDLAGSYNDSNCCAPLIFVLSPGADPMAGLLKFADDLGMGGESIQTISLGQGQGPIAERMIHTAIKKGSWVVLQNCHLATSWMSALEKICEEIIVPEN-THEKFRLWLTSYPSDKFPVSILQNGIKMTNEPPKGVRANLLRSYLNDPVSDPTFFNSCQKPQMWQKLLFGLCFFHALVQERRNFGPLGWNIPYEFNESDLRISMRQLQMFLNEYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLCLLSIVYNKD-IQQDKYRLSTGDTYCVPSYGT-YQSCVDYIRSLPLITHPEVFGLHENADITKDNQETNQLFSGVLLTLPRQTSGSGRSPQEIVEDLAKDILNKLPKDFNLEKVMEKYPVVYEESMNTVLRQELIRFNRLTAVVRSSLINLGKAIKGQVLMSAELENVFNSMLVGKVPSMWASKSYPSLKPLGSYVADLLSRLQFLQGWIDNGPPKVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFQF---EVTRYRNDVDEAPADGAYVKGLFLEGARWDQQAMQIGESLPKILYDPLPIIWLKPGESSKFQHTNTYLCPVYKTSARRGTLSTTGHSTNYVLSIELPSDRPEKHWTNRGVAALCQLDD 4031          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 3860.84 bits (10011), Expect = 0.000e+0
Identity = 2034/3904 (52.10%), Postives = 2738/3904 (70.13%), Query Frame = 3
Query:  846 NFQTSVKKAILDYILLNKLEQKRLGLM-MPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICEST-PLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLP---FILSMLNYEEFVISNK-EKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQ--LNDAVENEQELDKMAEKLNECIEEKKQIN-QEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNI-ENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEER-TNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTT-EIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLH-LVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPS--GKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADE----GAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            ++ TS++K I+DYIL +  E++RL +   P+   + V+R  +PWH    ++  + Q   +  +  ++ L   +  ++ +LR +  E +     PL   +  E+ +++ ++    L+N W+  C  +  S  D    ++P+   +   +++ FF C+A+L S  LR +V NS+ + + F   +++      + D +  M       IL + L  +      + F P+ +  C  L +     I     F   E  L ++V+  P L      LS +  +E ++SN   K  +   LN   P KY  +Y  +  LLN+  +     F+  +  L  +  ++  +  L  E AS+   +P+ LF LD   +N+ L  R++ L+   +  + +++RV N+SIC++Y  I  ++ +   TT +LV L +++ K R   +  L+ ++ +AA  + FLL+Y  L           F W ++I  + + +   L  ++++A + L K + +F + L G   +I+ F +R    L++   N ++L+++   LN  + E + IN +EELL     Q P LQ    +  K PF++LW +A  FH   ++WMNG   +++AE++  E  ++W+  Y+L+K F+  +  GP R A  +K K++KFK++LPII  +CN G+K+RHW+ +S+ VG+DITP  DT L +ML  GL K++E L ++ + ASKE+SLEKA  +M+++W  I F F  Y+ET  +IL  VDDIQ+LL+DHI+KT TM  SPFI P E+E   W++TL  +++ +++WLK QA WLYLEPIF S DI  Q+P EG +F IVD  W+ IM +   D++V+   K DN+L  LQ S  LLE IQKGLN YLEKKRLYFPRFFFLSN+ELLEILSETKDPLRVQPHLKKCFEGI+KL+FTE+  ITGM+S+E+E V  +  I+P +A+G+VEKW+LQVE  M  S+R+V++  +  Y ++ R QWV  WPGQVV+  S+++WT++ + AI   TL  FL+K++QQI  IVELVR + L S  R TL A  V+DVHARDVVAKL   +VS+  DF WISQ+RY W           +++++M+TTEV YGYEYLGN+ RLVITPLTDRCYRTLMGA+KLNLGGAPEGPAGTGKTET+KDLAKA+AKQCVVFNCSDGLDYK+MGKFFKGLAQSGAWACFDEFNRIE+EVLSV+AQQI +IQ+AI   ++ F FEGTEL L+ +C++FITMNPGYAGR+ELPDNLK LFRTVAMMVPDYALI EISLYSMGF+++R+LA KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     E  ++L++++DVNL KFL  D+PLF GIISDLFPGV  P  DY    + L + +  +KL+PVPWF+ KIIQIYEM+LVRHG MIVG    GKTCA+K LS AL DL+   ++ E +V   +INPKAI++G LYG FD VSHEW+DG+LA TFRE ASS +D+RKWIIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+ K ++IFEP DLEQASPATVSRCGMIYMEP QLG  PL   ++   LPE L  E R  +  +FNWL+ P LDFI  +CK  V    + L  +M++LY+ LLD++ N  ++                           NE +  ++ T +L   F  S++W+ G  ++ DS+ KFD F+R+L    D   + +PRPK++K  +N + P+KG+++D  F K+  G W  W   I K +L  +I TT ++ +++IPT++T RQ FFL   L++   P++FVG TGTGKSA+  +F++  LP   ++ +S+ FSA+TS++Q QD  FSKLDRRR+G + PP  K  VVF+DD++MP KE YGAQPP+E+LRQ IDH  W+DRKD + L I DVL  SAM  P   R  +T R  RH NI+ ID FDDET+  IF  I DWHF+ GF+I   R  K+++ AT  I+++ + +FLPTP+KSHYVFNLRDFSRV++G LL     L++       +KLIRLW+HE YRVF+DRLI  ED  +FF ++K+     FK+         +   K   +  +R L FGD+ K   D                K+Y+EITD + L   M+ YL+EYN +SKAPM LV+FRFAIEHI+RICR+L+Q NGH LLVGIGGSGRQSA KLATF+  FE+FQIE+T+ Y++S+WRDD+++++   G  G  T FLF D+QIK+  F+EDINMLLN+GDIPN+F  +++ EI+EKMQ I + +  +IE T + MYN FIE+V+ NL    L+ SPIGDAF +RLR FPSLINCCTI+WFQ WP DAL+MVANK L++V +  D+R+++V MC++F ++V  +S ++Y  + R NYVTPTSYLELI TF  LLN K+ E+ T + RY VGLEKLEF+ +Q+S+MQ EL A QP+LI+TS ETEK++  IE ET+EV+  +++V  +E      A  +K+IKD+CE +LAEAMP + AA+ ALDTL Q+DI++VK+M NPP  VKLVME++C++K +KP++K DPS  GK++ED+W  +KK+LGDLKFLD LK++DKD I  A M+KIR ++I+NP F P  IKN+SSACEGLC WVRA+EVYDR+ KVV+PK+E+L  AE     QM QL  K+ EL  VE +L  L +   +   +K +LENNIEL   K+ RAEKLI+GLGGEK RW +    L IR++N+ GDVLL +G VAYLG FT+ YR EC   WQ  CK   IP      FSLSS LGDPV+VR WQI GLPVDSFSVDN +IV+++ R+ L+IDPQGQANKWIK +E + NKL VIKLSD  Y R LEN +QFG P LLEN+GEE+D+VLE +LLKQTFKQ  VEYIRLG++++EYS+DFR Y+TTRLRNPHYLPE +VKV L+NFMITP GL+DQ+LGIV AKEKPELE+++ QLI+ESA+N++QLKEIED+IL++LS+S+GNILEDE AI++LSSSK+LSE+IS KQ+ A+ TE EI+  R GYKPVA H SI+FF ISDLA+++PMYQYSL+WFINLYIHS+ +SE S ++  R++N+  HFT ++Y N+CRSLFEKDKLLFS LL IGI KG++K+++ VWRFLLTGG++LD+P  NP   WLS+KSW E+   SNLEP  G++     NI KWK+I DS  P  EK P  W+E L+ + RLVV+RCL P+K++PAV  +I   +G +++EPP FDL  S+ +S+   P+IFVLSPG DPM+ L +FA+   +   +++ +SLGQGQGPIAE  I+ ++K  +W++LQNCHLATSW+  L KICEE+++ ++  +  FRLWLTSYPS  FPV++LQN +KMTNEPPKG+RANLLRSY   P+SD  FF + ++PQ+++KLLF LCFFHA+VQERRN+G +GWNIPYEFN+SDL+IS+RQLQMF+N+YE+V  EALTYLTGECNYGGRVTD++DRRL++ LL  VY+K+ +  + + L+   TY VP   +   S +++I+  P    PEVFGLH NA++ K+ QETNQLF  +L+TLP++ SG  +S Q I+EDLA DIL+KLP+ F +E++  KYPV+YEE MNTVL QELIRFN+L  V+R SL++L  A++G +LM   LE V+ SM++GKVPS+W+  SYPSLKPLGSY++DL++R++F Q WIDNG P  FW+SGFYFTQSFLTGV QNYAR+    ID + F F   E   Y    DE    GA++ GL+LE  RW  +   + ES  K+LYD LP+I + P   S     N+Y CPVYKT+ARRG LSTTGHSTNYV +I LPS +  +HW NRG+AALCQL+D
Sbjct:  213 DYYTSLRKTIVDYILKDPEEKERLFIANTPHPFPLRVIRAPVPWHISYNEAHGWNQDHLFTVNPMVLSLQELWINQFDDLRFVRTEELLSGCLPLLPAEFEEVVQRHCREAHTALRNKWIPACASLFTSQKDKWIHLVPQHDNDSTLQVQEFFACIASLMSLQLRGMVINSLQDLLSFFTLHQN---GNDFGDTYEEMKFC-TPQILIVKLRVE---EPKIAFEPALEE-CWALIKCCFLEILKSHYFVNFELYLQVEVDLFPDLQTENLTLSSVTQDESLVSNYINKTMEVFNLNIVGPQKYLNVYKKYSDLLNQKAQQDISSFLKEEHSLHAFTKKINSISQLRGEIASMHITVPLALFCLDALRLNEDLCARAQTLKDQLIQFVVDENRVLNKSICSKYSLIADKVNEVPSTTEELVALIDFLRKSRDVTVYKLKDEISEAASRLAFLLDYATL---------QFFYWPEQIETVFEVNNNRLMAKKDQAEDDLNKRRSEFEKKLQGYVTEIEAFKKRENMTLDEMKANVEKLNELDRNLNAALAEFEAINVEEELLEWEKSQFPLLQTA--MLNKVPFEQLWITAYNFHCKSEEWMNGAFQDLNAEDITEEVGNMWRNMYKLSKTFA--DMAGPKRVAENMKIKIDKFKMHLPIISVICNRGIKKRHWEQISDVVGYDITPAPDTSLLNMLEYGLSKYIERLEQIGASASKEYSLEKALEKMKSEWSNINFVFIRYRETSTSILSAVDDIQLLLDDHIIKTQTMCGSPFIKPIEAEAREWEQTLVLIQEIMDAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKNIMVEAVKDTRVLIATKQDNMLGRLQESNVLLEDIQKGLNTYLEKKRLYFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTEDLQITGMISSENEIVPLSQKIYPAKAKGMVEKWLLQVEENMLSSMRQVIRDGIDGYVEVPRKQWVLQWPGQVVICVSSIYWTKEVSEAIAEGTLPAFLEKSNQQIGEIVELVRGK-LSSGARATLGALTVIDVHARDVVAKLAQDKVSNLSDFQWISQLRYSW--------EGQDVMVKMITTEVKYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQSGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRNMKTFFFEGTELTLNPTCSVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYDLFIQALKDNIAKLKLQPVPWFIGKIIQIYEMMLVRHGFMIVGDPMGGKTCAYKVLSGALDDLHAANSMDEYAVELKVINPKAITMGQLYGCFDPVSHEWTDGVLATTFREQASSTTDDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSAKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLQDSYMNT-LPENLTSEHREMISDMFNWLLQPCLDFIRSECKFLVFTSPIHLAYSMMRLYTCLLDEIVNSSEEG--------------------------NEPMSSQQITLWLQGLFLFSVVWTIGGTINTDSRKKFDIFYRNLLMGLD---EHHPRPKSVKLTKNNLFPEKGSVYDFYFHKQASGQWNMWTDYITKEEL--IIPTTAKVSDLIIPTMETARQTFFLKTYLEHS-VPMLFVGPTGTGKSAITNSFLI-KLPKNKYVANSINFSARTSANQTQDIIFSKLDRRRKGQFGPPVGKQAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGHWYDRKDTSRLDILDVLFVSAMGPPGGGRNDITGRFTRHLNIVTIDAFDDETLTKIFGSIADWHFSKGFDIAFLRTGKLMIQATMAIYKAAVENFLPTPSKSHYVFNLRDFSRVVRGVLLCPHTHLQD------SDKLIRLWIHEVYRVFYDRLIDPEDRQVFFNMVKETTSNCFKQSVDKALSHLAPTGKV-VDDNIRSLFFGDYFKPDSD---------------TKIYDEITDLKHLTSVMEHYLEEYNNVSKAPMSLVMFRFAIEHISRICRVLKQDNGHLLLVGIGGSGRQSATKLATFMNSFELFQIEITKNYTISEWRDDVKKVMLQAGVAGKNTVFLFCDNQIKDEGFVEDINMLLNTGDIPNIFPADEKAEIVEKMQAIARTEGRKIEATPLAMYNFFIEKVKANLSFFALSMSPIGDAFRNRLRMFPSLINCCTIDWFQTWPTDALEMVANKFLEDVALDDDIRKEVVSMCKYFQETVKQMSDRYYNTLRRHNYVTPTSYLELILTFKTLLNSKRQEVETMRNRYMVGLEKLEFASSQVSVMQKELTALQPELIKTSAETEKMMIKIEKETIEVDAKKELVSADEKVANEAAAASKAIKDECEGDLAEAMPALEAALSALDTLNQSDITLVKSMTNPPAPVKLVMESICVMKAIKPDRKPDPSGTGKMVEDFWGPSKKVLGDLKFLDGLKAFDKDNISPAVMKKIREKFIDNPDFQPSVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLKEAEGKLFIQMQQLNTKRAELKAVEDRLQALNDELSDMNNKKMELENNIELCSQKLVRAEKLISGLGGEKDRWTEAARLLGIRYNNLTGDVLLSSGTVAYLGAFTVDYRHECQNQWQILCKEKKIPC--SDDFSLSSTLGDPVKVRAWQIAGLPVDSFSVDNGIIVSNSRRFPLMIDPQGQANKWIKNME-KANKLFVIKLSDASYTRTLENAIQFGNPVLLENLGEEIDAVLEPLLLKQTFKQQGVEYIRLGENIIEYSKDFRLYMTTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAANKKQLKEIEDKILEVLSSSQGNILEDETAIKVLSSSKLLSEEISEKQQIASATEKEIDSTRMGYKPVAVHSSIIFFCISDLANIEPMYQYSLTWFINLYIHSLAHSEKSENLHERIENIIGHFTISIYNNVCRSLFEKDKLLFSLLLTIGIMKGEDKINDDVWRFLLTGGVALDNPYPNPASLWLSDKSWAEIVRASNLEPLSGFMNHVKDNISKWKTIYDSLKPQDEKLPDKWQE-LNGINRLVVLRCLRPDKMVPAVQEFISENMGKKFIEPPTFDLAGSYNDSNCCAPLIFVLSPGADPMAGLLKFADDLGMGGESIQTISLGQGQGPIAERMIHTAIKKGSWVVLQNCHLATSWMSALEKICEEIIVPEN-THEKFRLWLTSYPSDKFPVSILQNGIKMTNEPPKGVRANLLRSYLNDPVSDPTFFNSCQKPQMWQKLLFGLCFFHALVQERRNFGPLGWNIPYEFNESDLRISMRQLQMFLNEYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLCLLSIVYNKD-IQQDKYRLSTGDTYCVPSYGT-YQSCVDYIRSLPLITHPEVFGLHENADITKDNQETNQLFSGVLLTLPRQTSGSGRSPQEIVEDLAKDILNKLPKDFNLEKVMEKYPVVYEESMNTVLRQELIRFNRLTAVVRSSLINLGKAIKGQVLMSAELENVFNSMLVGKVPSMWASKSYPSLKPLGSYVADLLSRLQFLQGWIDNGPPKVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFQF---EVTRYRNDVDEAPADGAYVKGLFLEGARWDQQAMQIGESLPKILYDPLPIIWLKPGESSKFQHTNTYLCPVYKTSARRGTLSTTGHSTNYVLSIELPSDRPEKHWTNRGVAALCQLDD 4020          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 3622.79 bits (9393), Expect = 0.000e+0
Identity = 1870/3296 (56.74%), Postives = 2426/3296 (73.60%), Query Frame = 3
Query: 2622 GPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEER-TNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPS--GKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            G   +++AE++  E  ++W+  Y+L+K F+  +  GP R A  +K K++KFK++LPII  +CN G+K+RHW+ +S+ VG+DITP  DT L ++L            ++ + ASKE+SLEKA  +M+++W  I F F  Y+ET  +IL  VDDIQ+LL+DHI+KT TM  SPFI P E+E   W++TL  +++ +++WLK QA WLYLEPIF S DI  Q+P EG +F IVD  W+ IM +V  D++V+   K DN+L  LQ S  LLE IQKGLN YLEKKRLYFPRFFFLSN+ELLEILSETKDPLRVQPHLKKCFEGI+KL+FTE+  ITGM+S+E+E V  +  I+P +A+G+VEKW+LQVE  M  S+R+V++  +  Y ++ R QWV  WPGQVV+  S+++WT++ + AI   TL  FL+K++QQI  IVELVR + L S  R TL A  V+DVHARDVVAKL   +VS+  DF WISQ+RY W           +++++M+TTEV YGYEYLGN+ RLVITPLTDRCYRTLMGA+KLNLGGAPEGPAGTGKTET+KDLAKA+AKQCVVFNCSDGLDYK+MGKFFKGLAQSGAWACFDEFNRIE+EVLSV+AQQI +IQ+AI   ++ F FEGTEL L+ +C++FITMNPGYAGR+ELPDNLK LFRTVAMMVPDYALI EISLYSMGF+++R+LA KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     E  ++L++++DVNL KFL  D+PLF GIISDLFPGV  P  DY    + L + +  +KL+PVPWF+ KIIQIYEM+LVRHG MIVG    GKTCA+K LS AL DL+  + ++      +INPKAI++G LYG FD VSHEW+DG+LA TFRE ASS +D+RKWIIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+ K ++IFEP DLEQASPATVSRCGMIYMEP QLG  PL   ++   LPE L  E R  +  +FNWL+ P LDFI  +CK  V    + L  +M++LY+ LLD++ N  ++                           NE +  ++ T +L   F  S++W+ G  ++ DS+ KFD F+R+L    D   + +PRPK++K  +N + P+KG+++D  F K+  G W  W   I K +L            +IPT   VR+ FFL   L++   P++FVG TGTGKSA+  +F++  LP   ++ +S+ FSA+TS++Q QD  FSKLDRRR+G + PP  K  VVF+DD++MP KE YGAQPP+E+LRQ IDH  W+DRKD + L I DVL  SAM  P   R  +T R  RH NI+ ID FDDET+  IF  I DWHF+ GF+I       +++ AT  I+++ + +FLPTP+KSHYVFNLRDFSRV++G LL     L         +KLIRLW+HE YRVF+DRLI  ED  +FF ++K+     FK+         +   K   +  +R L FGD+ K   D                K+Y+EITD + L   M+ YL+EYN +SKAPM LV+FRFAIEHI+RICR+L+Q NGH LLVGIGGSGRQSA KLATF+  FE+FQIE+T+ Y++S+WRDD+++++   G  G  T FLF D+QIK+  F+EDINMLLN+GDIPN+F  +++ EI+EKMQ I + +  +IE T + MYN FIE+V+ NLH+VL  SPIGDAF +RLR FPSLINCCTI+WFQ WP DAL+MVANK L++V +  D+R+++V MC++F ++V  +S ++Y  + R NYVTPTSYLELI TF  LLN K+ E+ T + RY VGLEKLEF+ +Q+S+MQ EL A QP+LI+TS ETEK++  IE ET+EV+  +++V  +E      A  +K+IKD+CE +LAEAMP + AA+ ALDTL Q+DI++VK+M NPP  VKLVME++C++K +KP++K DPS  GK++ED+W  +KK+LGDLKFLD LK++DKD I  A M+KIR ++I+NP F P  IKN+SSACEGLC WVRA+EVYDR+ KVV+PK+E+L  AE     QM QL  K+ EL  VE +L  L +   +   +K +LENNIEL   K+ RAEKLI+GLGGEK RW +    L IR++N+ GDVLL +G VAYLG FT+ YR EC   WQ  CK   IP      FSLSS LGDPV+VR WQI GLPVDSFSVDN +IV+++ R+ L+IDPQGQANKWIK +E + NKL VIKLSD  Y R LEN +QFG P LLEN+GEE+D+VLE +LLKQTFKQ  VEYIRLG++++EYS+DFR Y+TTRLRNPHYLPE +VKV L+NFMITP GL+DQ+LGIV AKEKPELE+++ QLI+ESA+N++QLKEIED+IL++LS+S+GNILEDE AI++LSSSK+LSE+IS KQ+ A+ TE EI+  R GYKPVA H SI+FF ISDLA+++PMYQYSL+WFINLYIHS+ +SE S ++  R++N+  HFT ++Y N+CRSLFEKDKLLFS LL IGI KG++K+++ VWRFLLTGG++LD+P  NP   WLS+KSW E+   SNLEP  G++     NI KWK+I DS  P  EK P  W+E L+ + RLVV+RCL P+K++PAV  +I   +G +++EPP FDL  S+ +S+   P+IFVLSPG DPM+ L +FA+   +   +++ +SLGQGQGPIAE  I+ ++K  +W++LQNCHLATSW+  L KICEE+++ ++  +  FRLWLTSYPS  FPV++LQN +KMTNEPPKG+RANLLRSY   P+SD  FF + ++PQ+++KLLF LCFFHA+VQERRN+G +GWNIPYEFN+SDL+IS+RQLQMF+N+YE+V  EALTYLTGECNYGGRVTD++DRRL++ LL  VY+K+ +  + + L+   TY VP   +   S +++I+  P    PEVFGLH NA++ K+ QETNQLF  +L+TLP++ SG  +S Q I+EDLA DIL+KLP+ F +E++  KYPV+YEE MNTVL QELIRFN+L  V+R SL++L  A++G +LM   LE V+ SM++GKVPS+W+  SYPSLKPLGSY++DL++R++F Q WIDNG P  FW+SGFYFTQSFLTGV QNYAR+    ID + F F      E + PAD GA++ GL+LE  RW  +   + ES  K+LYD LP+I + P   S     N+Y CPVYKT+ARRG LSTTGHSTNYV +I LPS +  +HW NRG+AALCQL+D
Sbjct:  201 GAFQDLNAEDITEEVGNMWRNMYKLSKTFA--DMAGPKRVAENMKIKIDKFKMHLPIISVICNRGIKKRHWEQISDVVGYDITPAPDTSLLNILE-----------QIGASASKEYSLEKALEKMKSEWSNINFVFIRYRETSTSILSAVDDIQLLLDDHIIKTQTMCGSPFIKPIEAEAREWEQTLVLIQEIMDAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKNIMVEV-KDTRVLIATKQDNMLGRLQESNVLLEDIQKGLNTYLEKKRLYFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTEDLQITGMISSENEIVPLSQKIYPAKAKGMVEKWLLQVEENMLSSMRQVIRDGIDGYVEVPRKQWVLQWPGQVVICVSSIYWTKEVSEAIAEGTLPAFLEKSNQQIGEIVELVRGK-LSSGARATLGALTVIDVHARDVVAKLAQDKVSNLSDFQWISQLRYSW--------EGQDVMVKMITTEVKYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQSGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRNMKTFFFEGTELTLNPTCSVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYDLFIQALKDNIAKLKLQPVPWFIGKIIQIYEMMLVRHGFMIVGDPMGGKTCAYKVLSGALDDLHYAVELK------VINPKAITMGQLYGCFDPVSHEWTDGVLATTFREQASSTTDDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSAKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLQDSYMNT-LPENLTSEHREMISDMFNWLLQPCLDFIRSECKFLVFTSPIHLAYSMMRLYTCLLDEIVNSSEEG--------------------------NEPMSSQQITLWLQGLFLFSVVWTIGGTINTDSRKKFDIFYRNLLMGLD---EHHPRPKSVKLTKNNLFPEKGSVYDFYFHKQASGQWNMWTDYITKEEL------------IIPTTAKVRKTFFLKTYLEHS-VPMLFVGPTGTGKSAITNSFLI-KLPKNKYVANSINFSARTSANQTQDIIFSKLDRRRKGQFGPPVGKQAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGHWYDRKDTSRLDILDVLFVSAMGPPGGGRNDITGRFTRHLNIVTIDAFDDETLTKIFGSIADWHFSKGFDI-------LMIQATMAIYKAAVENFLPTPSKSHYVFNLRDFSRVVRGVLLCPHTHL---------DKLIRLWIHEVYRVFYDRLIDPEDRQVFFNMVKETTSNCFKQSVDKALSHLAPTGKV-VDDNIRSLFFGDYFKPDSD---------------TKIYDEITDLKHLTSVMEHYLEEYNNVSKAPMSLVMFRFAIEHISRICRVLKQDNGHLLLVGIGGSGRQSATKLATFMNSFELFQIEITKNYTISEWRDDVKKVMLQAGVAGKNTVFLFCDNQIKDEGFVEDINMLLNTGDIPNIFPADEKAEIVEKMQAIARTEGRKIEATPLAMYNFFIEKVKANLHMVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQTWPTDALEMVANKFLEDVALDDDIRKEVVSMCKYFQETVKQMSDRYYNTLRRHNYVTPTSYLELILTFKTLLNSKRQEVETMRNRYMVGLEKLEFASSQVSVMQKELTALQPELIKTSAETEKMMIKIEKETIEVDAKKELVSADEKVANEAAAASKAIKDECEGDLAEAMPALEAALSALDTLNQSDITLVKSMTNPPAPVKLVMESICVMKAIKPDRKPDPSGTGKMVEDFWGPSKKVLGDLKFLDGLKAFDKDNISPAVMKKIREKFIDNPDFQPSVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLKEAEGKLFIQMQQLNTKRAELKAVEDRLQALNDELSDMNNKKMELENNIELCSQKLVRAEKLISGLGGEKDRWTEAARLLGIRYNNLTGDVLLSSGTVAYLGAFTVDYRHECQNQWQILCKEKKIPC--SDDFSLSSTLGDPVKVRAWQIAGLPVDSFSVDNGIIVSNSRRFPLMIDPQGQANKWIKNME-KANKLFVIKLSDASYTRTLENAIQFGNPVLLENLGEEIDAVLEPLLLKQTFKQQGVEYIRLGENIIEYSKDFRLYMTTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAANKKQLKEIEDKILEVLSSSQGNILEDETAIKVLSSSKLLSEEISEKQQIASATEKEIDSTRMGYKPVAVHSSIIFFCISDLANIEPMYQYSLTWFINLYIHSLAHSEKSENLHERIENIIGHFTISIYNNVCRSLFEKDKLLFSLLLTIGIMKGEDKINDDVWRFLLTGGVALDNPYPNPASLWLSDKSWAEIVRASNLEPLSGFMNHVKDNISKWKTIYDSLKPQDEKLPDKWQE-LNGINRLVVLRCLRPDKMVPAVQEFISENMGKKFIEPPTFDLAGSYNDSNCCAPLIFVLSPGADPMAGLLKFADDLGMGGESIQTISLGQGQGPIAERMIHTAIKKGSWVVLQNCHLATSWMSALEKICEEIIVPEN-THEKFRLWLTSYPSDKFPVSILQNGIKMTNEPPKGVRANLLRSYLNDPVSDPTFFNSCQKPQMWQKLLFGLCFFHALVQERRNFGPLGWNIPYEFNESDLRISMRQLQMFLNEYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLCLLSIVYNKD-IQQDKYRLSTGDTYCVPSYGT-YQSCVDYIRSLPLITHPEVFGLHENADITKDNQETNQLFSGVLLTLPRQTSGSGRSPQEIVEDLAKDILNKLPKDFNLEKVMEKYPVVYEESMNTVLRQELIRFNRLTAVVRSSLINLGKAIKGQVLMSAELENVFNSMLVGKVPSMWASKSYPSLKPLGSYVADLLSRLQFLQGWIDNGPPKVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFQF------EVNAPAD-GAYVKGLFLEGARWDQQAMQIGESLPKILYDPLPIIWLKPGESSKFQHTNTYLCPVYKTSARRGTLSTTGHSTNYVLSIELPSDRPEKHWTNRGVAALCQLDD 3377          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 3518.78 bits (9123), Expect = 0.000e+0
Identity = 1836/3296 (55.70%), Postives = 2382/3296 (72.27%), Query Frame = 3
Query: 2622 GPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEER-TNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSG--KLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            G   +++AE++  E  ++W+  Y+L+K F+  +  GP R A  +K K++KFK++LPII  +CN G+K+RHW+ +S+ VG+DITP  DT L ++L            ++ + ASKE+SLEKA  +M+++W  I F F  Y+ET  +IL  VDDIQ+LL+DHI+KT TM  SPFI P E+E   W++TL  +++ +++WLK QA WLYLEPIF S DI  Q+P EG +F IVD  W+ IM         +  +  DN+L  LQ S  LLE IQKGLN YLEKKRLYFPRFFFLSN+ELLEILSETKDPLRVQPHLKKCFEGI+KL+FTE+  ITGM+S+E+E V  +  I+P +A+G+VEKW+LQVE  M  S+R+V++  +  Y ++ R QWV  WPGQVV+  S+++WT++ + AI   TL  FL+K++QQI  IVELVR + L S  R TL A  V+DVHARDVVAKL   +VS+  DF WISQ+RY W           +++++M+TTEV YGYEYLGN+ RLVITPLTDRCYRTLMGA+KLNLGGAPEGPAGTGKTET+KDLAKA+AKQCVVFNCSDGLDYK+MGKFFKGLAQSGAWACFDEFNRIE+EVLSV+AQQI +IQ+AI   ++ F FEGTEL L+ +C++FITMNPGYAGR+ELPDNLK LFRTVAMMVPDYALI EISLYSMGF+++R+LA KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     E  ++L++++DVNL KFL  D+PLF GIISDLFPGV  P  DY    + L + +  +KL+PVPWF+ KIIQIYEM+LVRHG MIVG    GKTCA+K LS AL DL+  + ++      +INPKAI++G LYG FD VSHEW+DG+LA TFRE ASS +D+RKWIIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+ K ++IFEP DLEQASPATVSRCGMIYMEP QLG  PL   ++   LPE L  E R  V +  + L            K+  K    QL+++++     ++D++ N  ++                           NE +  ++ T +L   F  S++W+ G  ++ DS+ KFD F+R+L    D   + +PRPK++K  +N + P+KGT                                         ++ TV Q FFL   L++   P++FVG TGTGKSA+  +F++  LP   ++ +S+ FSA+TS++Q QD  FSKLDRRR+G + PP  K  VVF+DD++MP KE YGAQPP+E+LRQ IDH  W+DRKD + L I DVL  SAM  P   R  +T R  RH NI+ ID FDDET+  IF  I DWHF+ GF+I       +++ AT  I+++ + +FLPTP+KSHYVFNLRDFSRV++G LL     L         +KLIRLW+HE YRVF+DRLI  ED  +FF ++K+     FK+         +   K   +  +R L FGD+ K   D                K+Y+EITD + L   M+ YL+EYN +SKAPM LV+FRFAIEHI+RICR+L+Q NGH LLVGIGGSGRQSA KLATF+  FE+FQIE+T+ Y++S+WRDD+++++   G  G  T FLF D+QIK+  F+EDINMLLN+GDIPN+F  +++ EI+EKMQ I + +  +IE T + MYN FIE+V+ NLH+VL  SPIGDAF +RLR FPSLINCCTI+WFQ WP DAL+MVANK L++V +  D+R+++V MC++F ++V  +S ++Y  + R NYVTPTSYLELI TF  LLN K+ E+ T + RY VGLEKLEF+ +Q+S+MQ EL A QP+LI+TS ETEK++  IE ET+EV+  +++V  +E      A  +K+IKD+CE +LAEAMP + AA+ ALDTL Q+DI++VK+M NPP  VKLVME++C++K +KP++K DPSG  K++ED+W  +KK+LGDLKFLD LK++DKD I  A M+KIR ++I+NP F P  IKN+SSACEGLC WVRA+EVYDR+ KVV+PK+E+L  AE     QM QL  K+ EL  VE +L  L +   +   +K +LENNIEL   K+ RAEKLI+GLGGEK RW +    L IR++N+ GDVLL +G VAYLG FT+ YR EC   WQ  CK   IP S + + S    LGDPV+VR WQI GLPVDSFSVDN +IV+++ R+ L+IDPQGQANKWIK +E + NKL VIKLSD  Y R LEN +QFG P LLEN+GEE+D+VLE +LLKQTFKQ  VEYIRLG++++EYS+DFR Y+TTRLRNPHYLPE +VKV L+NFMITP GL+DQ+LGIV AKEKPELE+++ QLI+ESA+N++QLKEIED+IL++LS+S+GNILEDE AI++LSSSK+LSE+IS KQ+ A+ TE EI+  R GYKPVA H SI+FF ISDLA+++PMYQYSL+WFINLYIHS+ +SE S ++  R++N+  HFT ++Y N+CRSLFEKDKLLFS LL IGI KG++K+++ VWRFLLTGG++LD+P  NP   WLS+KSW E+   SNLEP  G++     NI KWK+I DS  P  EK P  W+E L+ + RLVV+RCL P+K++PAV  +I   +G +++EPP FDL  S+ +S+   P+IFVLSPG DPM+ L +FA+   +   +++ +SLGQGQGPIAE  I+ ++K  +W++LQNCHLATSW+  L KICEE+++ ++  +  FRLWLTSYPS  FPV++LQN +KMTNEPPKG+RANLLRSY   P+SD  FF + ++PQ+++KLLF LCFFHA+VQERRN+G +GWNIPYEFN+SDL+IS+RQLQMF+N+YE+V  EALTYLTGECNYGGRVTD++DRRL++ LL  VY+K++   +  PL                  + H         PEVFGLH NA++ K+ QETNQLF  +L+TLP++ SG  +S Q I+EDLA DIL+KLP+ F +E++  KYPV+YEE MNTVL QELIRFN+L  V+R SL++L  A++G +LM   LE V+ SM++GKVPS+W+  SYPSLKPLGSY++DL++R++F Q WIDNG P  FW+SGFYFTQSFLTGV QNYAR+    ID + F F      E + PAD GA++ GL+LE  RW  +   + ES  K+LYD LP+I + P   S     N+Y CPVYKT+ARRG LSTTGHSTNYV +I LPS +  +HW NRG+AALCQL+D
Sbjct:  273 GAFQDLNAEDITEEVGNMWRNMYKLSKTFA--DMAGPKRVAENMKIKIDKFKMHLPIISVICNRGIKKRHWEQISDVVGYDITPAPDTSLLNILE-----------QIGASASKEYSLEKALEKMKSEWSNINFVFIRYRETSTSILSAVDDIQLLLDDHIIKTQTMCGSPFIKPIEAEAREWEQTLVLIQEIMDAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKNIM---------VEAVSTDNMLGRLQESNVLLEDIQKGLNTYLEKKRLYFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTEDLQITGMISSENEIVPLSQKIYPAKAKGMVEKWLLQVEENMLSSMRQVIRDGIDGYVEVPRKQWVLQWPGQVVICVSSIYWTKEVSEAIAEGTLPAFLEKSNQQIGEIVELVRGK-LSSGARATLGALTVIDVHARDVVAKLAQDKVSNLSDFQWISQLRYSW--------EGQDVMVKMITTEVKYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQSGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRNMKTFFFEGTELTLNPTCSVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYDLFIQALKDNIAKLKLQPVPWFIGKIIQIYEMMLVRHGFMIVGDPMGGKTCAYKVLSGALDDLHYAVELK------VINPKAITMGQLYGCFDPVSHEWTDGVLATTFREQASSTTDDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSAKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLQDSYMNT-LPENLTSEHREMVGIHVSLL---------ESDKTLTK----QLLSDVV-FPCFIVDEIVNSSEEG--------------------------NEPMSSQQITLWLQGLFLFSVVWTIGGTINTDSRKKFDIFYRNLLMGLD---EHHPRPKSVKLTKNNLFPEKGT-----------------------------------------SLSTV-QTFFLKTYLEHSV-PMLFVGPTGTGKSAITNSFLI-KLPKNKYVANSINFSARTSANQTQDIIFSKLDRRRKGQFGPPVGKQAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGHWYDRKDTSRLDILDVLFVSAMGPPGGGRNDITGRFTRHLNIVTIDAFDDETLTKIFGSIADWHFSKGFDI-------LMIQATMAIYKAAVENFLPTPSKSHYVFNLRDFSRVVRGVLLCPHTHL---------DKLIRLWIHEVYRVFYDRLIDPEDRQVFFNMVKETTSNCFKQSVDKALSHLAPTGKV-VDDNIRSLFFGDYFKPDSD---------------TKIYDEITDLKHLTSVMEHYLEEYNNVSKAPMSLVMFRFAIEHISRICRVLKQDNGHLLLVGIGGSGRQSATKLATFMNSFELFQIEITKNYTISEWRDDVKKVMLQAGVAGKNTVFLFCDNQIKDEGFVEDINMLLNTGDIPNIFPADEKAEIVEKMQAIARTEGRKIEATPLAMYNFFIEKVKANLHMVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQTWPTDALEMVANKFLEDVALDDDIRKEVVSMCKYFQETVKQMSDRYYNTLRRHNYVTPTSYLELILTFKTLLNSKRQEVETMRNRYMVGLEKLEFASSQVSVMQKELTALQPELIKTSAETEKMMIKIEKETIEVDAKKELVSADEKVANEAAAASKAIKDECEGDLAEAMPALEAALSALDTLNQSDITLVKSMTNPPAPVKLVMESICVMKAIKPDRKPDPSGTGKMVEDFWGPSKKVLGDLKFLDGLKAFDKDNISPAVMKKIREKFIDNPDFQPSVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLKEAEGKLFIQMQQLNTKRAELKAVEDRLQALNDELSDMNNKKMELENNIELCSQKLVRAEKLISGLGGEKDRWTEAARLLGIRYNNLTGDVLLSSGTVAYLGAFTVDYRHECQNQWQILCKEKKIPCSDDFSLSS--TLGDPVKVRAWQIAGLPVDSFSVDNGIIVSNSRRFPLMIDPQGQANKWIKNME-KANKLFVIKLSDASYTRTLENAIQFGNPVLLENLGEEIDAVLEPLLLKQTFKQQGVEYIRLGENIIEYSKDFRLYMTTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAANKKQLKEIEDKILEVLSSSQGNILEDETAIKVLSSSKLLSEEISEKQQIASATEKEIDSTRMGYKPVAVHSSIIFFCISDLANIEPMYQYSLTWFINLYIHSLAHSEKSENLHERIENIIGHFTISIYNNVCRSLFEKDKLLFSLLLTIGIMKGEDKINDDVWRFLLTGGVALDNPYPNPASLWLSDKSWAEIVRASNLEPLSGFMNHVKDNISKWKTIYDSLKPQDEKLPDKWQE-LNGINRLVVLRCLRPDKMVPAVQEFISENMGKKFIEPPTFDLAGSYNDSNCCAPLIFVLSPGADPMAGLLKFADDLGMGGESIQTISLGQGQGPIAERMIHTAIKKGSWVVLQNCHLATSWMSALEKICEEIIVPEN-THEKFRLWLTSYPSDKFPVSILQNGIKMTNEPPKGVRANLLRSYLNDPVSDPTFFNSCQKPQMWQKLLFGLCFFHALVQERRNFGPLGWNIPYEFNESDLRISMRQLQMFLNEYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLCLLSIVYNKDIQQDKSLPL------------------ITH---------PEVFGLHENADITKDNQETNQLFSGVLLTLPRQTSGSGRSPQEIVEDLAKDILNKLPKDFNLEKVMEKYPVVYEESMNTVLRQELIRFNRLTAVVRSSLINLGKAIKGQVLMSAELENVFNSMLVGKVPSMWASKSYPSLKPLGSYVADLLSRLQFLQGWIDNGPPKVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFQF------EVNAPAD-GAYVKGLFLEGARWDQQAMQIGESLPKILYDPLPIIWLKPGESSKFQHTNTYLCPVYKTSARRGTLSTTGHSTNYVLSIELPSDRPEKHWTNRGVAALCQLDD 3372          

HSP 2 Score: 54.299 bits (129), Expect = 8.181e-6
Identity = 46/178 (25.84%), Postives = 82/178 (46.07%), Query Frame = 3
Query:  846 NFQTSVKKAILDYILLNKLEQKRLGLM-MPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSN-FTKKYWELRLISIENICESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEF 1373
            ++ TS++K I+DYIL +  E++RL +   P+   + V+R  +PWH    ++  + Q      H   V  ++N F   Y+          CE     L  L +  E      S +    W+  C  +  S  D    ++P+   +   +++ FF C+A+L S  LR +V NS+ + + F
Sbjct:   81 DYYTSLRKTIVDYILKDPEEKERLFIANTPHPFPLRVIRAPVPWHISYNEAHGWNQD-----HLFTVNPMNNPFVLIYF----------CEFVECKLGVLDKSAENLPSNFSVF---RWIPACASLFTSQKDKWIHLVPQHDNDSTLQVQEFFACIASLMSLQLRGMVINSLQDLLSF 240          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 3515.7 bits (9115), Expect = 0.000e+0
Identity = 1841/3305 (55.70%), Postives = 2397/3305 (72.53%), Query Frame = 3
Query: 2622 GPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTL------EEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEER-TNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKF--HVL-FGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSG--KLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            G   +++AE++  E  ++W+  Y+L+K F+  +  GP R A  +K K++KFK++LPII  +CN G+K+RHW+ +S+ VG+DITP  DT L ++L            ++ + ASKE+SLEKA  +M+++W  I F F  Y+ET  +IL  VDDIQ+LL+DHI+KT TM  SPFI P E+E   W++TL  +++ +++WLK QA WLYLEPIF S DI  Q+P EG +F IVD  W+ IM  V  D++V+   K DN+L  LQ S  LLE IQKGLN YLEKKRLYFPRFFFLSN+ELLEILSETKDPLRVQPHLKKCFEGI+KL+FTE+  ITGM+S+E+E V  +  I+P +A+G+VEKW+LQVE  M  S+R+V++  +  Y ++ R QWV  WPGQVV+  S+++WT++ + AI    L      + FL+K++QQI  IVELVR + L S  R TL A  V+DVHARDVVAKL   +VS+  DF WISQ+RY W           +++++M+TTEV YGYEYLGN+ RLVITPLTDRCYRTLMGA+KLNLGGAPEGPAGTGKTET+KDLAKA+AKQCVVFNCSDGLDYK+MGKFFKGLAQSGAWACFDEFNRIE+EVLSV+AQQI +IQ+AI   ++ F FEGTEL L+ +C++FITMNPGYAGR+ELPDNLK LFRTVAMMVPDYALI EISLYSMGF+++R+LA KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     E  ++L++++DVNL KFL  D+PLF GIISDLFPGV  P  DY    + L + +  +KL+PVPWF+ KIIQIYEM+LVRHG MIVG    GKTCA+K LS AL DL+  + ++      +INPKAI++G LYG FD VSHEW+DG+LA TFRE ASS +D+RKWIIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+ K ++IFEP DLEQASPATVSRCGMIYMEP QLG  PL   ++   LPE L  E R  V +  + L            K+  K    QL+++++     ++D++ N  ++                           NE +  ++ T +L   F  S++W+ G  ++ DS+ KFD F+R+L    D   + +PRPK++K  +N + P+KGT                                         ++ TV Q FFL   L++   P++FVG TGTGKSA+  +F++  LP   ++ +S+ FSA+TS++Q QD  FSKLDRRR+G + PP  K  VVF+DD++MP KE YGAQPP+E+LRQ IDH  W+DRKD + L I DVL  SAM  P   R  +T R  RH NI+ ID FDDET+  IF  I DWHF+ GF+I       +++ AT  I+++ + +FLPTP+KSHYVFNLRDFSRV++G LL     L         +KLIRLW+HE YRVF+DRLI  ED  +FF ++K+     FK+    H+   G    DN       +R L FGD+ K   D                K+Y+EITD + L   M+ YL+EYN +SKAPM LV+FRFAIEHI+RICR+L+Q NGH LLVGIGGSGRQSA KLATF+  FE+FQIE+T+ Y++S+WRDD+++++   G  G  T FLF D+QIK+  F+EDINMLLN+GDIPN+F  +++ EI+EKMQ I + +  +IE T + MYN FIE+V+ NLH+VL  SPIGDAF +RLR FPSLINCCTI+WFQ WP DAL+MVANK L++V +  D+R+++V MC++F ++V  +S ++Y  + R NYVTPTSYLELI TF  LLN K+ E+ T + RY VGLEKLEF+ +Q+S+MQ EL A QP+LI+TS ETEK++  IE ET+EV+  +++V  +E      A  +K+IKD+CE +LAEAMP + AA+ ALDTL Q+DI++VK+M NPP  VKLVME++C++K +KP++K DPSG  K++ED+W  +KK+LGDLKFLD LK++DKD I  A M+KIR ++I+NP F P  IKN+SSACEGLC WVRA+EVYDR+ KVV+PK+E+L  AE     QM QL  K+ EL  VE +L  L +   +   +K +LENNIEL   K+ RAEKLI+GLGGEK RW +    L IR++N+ GDVLL +G VAYLG FT+ YR EC   WQ  CK   IP S + + S    LGDPV+VR WQI GLPVDSFSVDN +IV+++ R+ L+IDPQGQANKWIK +E + NKL VIKLSD  Y R LEN +QFG P LLEN+GEE+D+VLE +LLKQTFKQ  VEYIRLG++++EYS+DFR Y+TTRLRNPHYLPE +VKV L+NFMITP GL+DQ+LGIV AKEKPELE+++ QLI+ESA+N++QLKEIED+IL++LS+S+GNILEDE AI++LSSSK+LSE+IS KQ+ A+ TE EI+  R GYKPVA H SI+FF ISDLA+++PMYQYSL+WFINLYIHS+ +SE S ++  R++N+  HFT ++Y N+CRSLFEKDKLLFS LL IGI KG++K+++ VWRFLLTGG++LD+P  NP   WLS+KSW E+   SNLEP  G++     NI KWK+I DS  P  EK P  W+E L+ + RLVV+RCL P+K++PAV  +I   +G +++EPP FDL  S+ +S+   P+IFVLSPG DPM+ L +FA+   +   +++ +SLGQGQGPIAE  I+ ++K  +W++LQNCHLATSW+  L KICEE+++ ++  +  FRLWLTSYPS  FPV++LQN +KMTNEPPKG+RANLLRSY   P+SD  FF + ++PQ+++KLLF LCFFHA+VQERRN+G +GWNIPYEFN+SDL+IS+RQLQMF+N+YE+V  EALTYLTGECNYGGRVTD++DRRL++ LL  VY+K+ +  + + L+   TY VP   +   S +++I+  P    PEVFGLH NA++ K+ QETNQLF  +L+TLP++ SG+  SS     DLA DIL+KLP+ F +E++  KYPV+YEE MNTVL QELIRFN+L  V+R SL++L  A++G +LM   LE V+ SM++GKVPS+W+  SYPSLKPLGSY++DL++R++F Q WIDNG P  FW+SGFYFTQSFLTGV QNYAR+    ID + F +R    ++  +   +GA++ GL+LE  RW  +   + ES  K+LYD LP+I + P   S     N+Y CPVYKT+ARRG LSTTGHSTNYV +I LPS +  +HW NRG+AALCQL+D
Sbjct:  144 GAFQDLNAEDITEEVGNMWRNMYKLSKTFA--DMAGPKRVAENMKIKIDKFKMHLPIISVICNRGIKKRHWEQISDVVGYDITPAPDTSLLNILE-----------QIGASASKEYSLEKALEKMKSEWSNINFVFIRYRETSTSILSAVDDIQLLLDDHIIKTQTMCGSPFIKPIEAEAREWEQTLVLIQEIMDAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKNIM--VEADTRVLIATKQDNMLGRLQESNVLLEDIQKGLNTYLEKKRLYFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTEDLQITGMISSENEIVPLSQKIYPAKAKGMVEKWLLQVEENMLSSMRQVIRDGIDGYVEV-RTQWVLQWPGQVVICVSSIYWTKEVSEAIHKVGLISYFLPQAFLEKSNQQIGEIVELVRGK-LSSGARATLGALTVIDVHARDVVAKLAQDKVSNLSDFQWISQLRYSW--------EGQDVMVKMITTEVKYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQSGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRNMKTFFFEGTELTLNPTCSVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYDLFIQALKDNIAKLKLQPVPWFIGKIIQIYEMMLVRHGFMIVGDPMGGKTCAYKVLSGALDDLHYAVELK------VINPKAITMGQLYGCFDPVSHEWTDGVLATTFREQASSTTDDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSAKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLQDSYMNT-LPENLTSEHREMVGIHVSLL---------ESDKTLTK----QLLSDVV-FPCFIVDEIVNSSEEG--------------------------NEPMSSQQITLWLQGLFLFSVVWTIGGTINTDSRKKFDIFYRNLLMGLD---EHHPRPKSVKLTKNNLFPEKGT-----------------------------------------SLSTV-QTFFLKTYLEHS-VPMLFVGPTGTGKSAITNSFLI-KLPKNKYVANSINFSARTSANQTQDIIFSKLDRRRKGQFGPPVGKQAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGHWYDRKDTSRLDILDVLFVSAMGPPGGGRNDITGRFTRHLNIVTIDAFDDETLTKIFGSIADWHFSKGFDI-------LMIQATMAIYKAAVENFLPTPSKSHYVFNLRDFSRVVRGVLLCPHTHL---------DKLIRLWIHEVYRVFYDRLIDPEDRQVFFNMVKETTSNCFKQSALSHLAPTGKVVDDN-------IRSLFFGDYFKPDSD---------------TKIYDEITDLKHLTSVMEHYLEEYNNVSKAPMSLVMFRFAIEHISRICRVLKQDNGHLLLVGIGGSGRQSATKLATFMNSFELFQIEITKNYTISEWRDDVKKVMLQAGVAGKNTVFLFCDNQIKDEGFVEDINMLLNTGDIPNIFPADEKAEIVEKMQAIARTEGRKIEATPLAMYNFFIEKVKANLHMVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQTWPTDALEMVANKFLEDVALDDDIRKEVVSMCKYFQETVKQMSDRYYNTLRRHNYVTPTSYLELILTFKTLLNSKRQEVETMRNRYMVGLEKLEFASSQVSVMQKELTALQPELIKTSAETEKMMIKIEKETIEVDAKKELVSADEKVANEAAAASKAIKDECEGDLAEAMPALEAALSALDTLNQSDITLVKSMTNPPAPVKLVMESICVMKAIKPDRKPDPSGTGKMVEDFWGPSKKVLGDLKFLDGLKAFDKDNISPAVMKKIREKFIDNPDFQPSVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLKEAEGKLFIQMQQLNTKRAELKAVEDRLQALNDELSDMNNKKMELENNIELCSQKLVRAEKLISGLGGEKDRWTEAARLLGIRYNNLTGDVLLSSGTVAYLGAFTVDYRHECQNQWQILCKEKKIPCSDDFSLSS--TLGDPVKVRAWQIAGLPVDSFSVDNGIIVSNSRRFPLMIDPQGQANKWIKNME-KANKLFVIKLSDASYTRTLENAIQFGNPVLLENLGEEIDAVLEPLLLKQTFKQQGVEYIRLGENIIEYSKDFRLYMTTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAANKKQLKEIEDKILEVLSSSQGNILEDETAIKVLSSSKLLSEEISEKQQIASATEKEIDSTRMGYKPVAVHSSIIFFCISDLANIEPMYQYSLTWFINLYIHSLAHSEKSENLHERIENIIGHFTISIYNNVCRSLFEKDKLLFSLLLTIGIMKGEDKINDDVWRFLLTGGVALDNPYPNPASLWLSDKSWAEIVRASNLEPLSGFMNHVKDNISKWKTIYDSLKPQDEKLPDKWQE-LNGINRLVVLRCLRPDKMVPAVQEFISENMGKKFIEPPTFDLAGSYNDSNCCAPLIFVLSPGADPMAGLLKFADDLGMGGESIQTISLGQGQGPIAERMIHTAIKKGSWVVLQNCHLATSWMSALEKICEEIIVPEN-THEKFRLWLTSYPSDKFPVSILQNGIKMTNEPPKGVRANLLRSYLNDPVSDPTFFNSCQKPQMWQKLLFGLCFFHALVQERRNFGPLGWNIPYEFNESDLRISMRQLQMFLNEYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLCLLSIVYNKD-IQQDKYRLSTGDTYCVPSYGT-YQSCVDYIRSLPLITHPEVFGLHENADITKDNQETNQLFSGVLLTLPRQTSGKIMSS-----DLAKDILNKLPKDFNLEKVMEKYPVVYEESMNTVLRQELIRFNRLTAVVRSSLINLGKAIKGQVLMSAELENVFNSMLVGKVPSMWASKSYPSLKPLGSYVADLLSRLQFLQGWIDNGPPKVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFQYR----NDVDEAPADGAYVKGLFLEGARWDQQAMQIGESLPKILYDPLPIIWLKPGESSKFQHTNTYLCPVYKTSARRGTLSTTGHSTNYVLSIELPSDRPEKHWTNRGVAALCQLDD 3275          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Mouse
Match: Dnah3 (dynein, axonemal, heavy chain 3 [Source:MGI Symbol;Acc:MGI:2683040])

HSP 1 Score: 3756.07 bits (9739), Expect = 0.000e+0
Identity = 1979/3904 (50.69%), Postives = 2710/3904 (69.42%), Query Frame = 3
Query:  834 DTKQNFQTSVKKAILDYILLNKLEQKRLGLM-MPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICEST-PLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYY---DLFSGMAVSNVNSILRIHLNADLTSSHPLI-FVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISN-KEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLN--DAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIEN-SVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSF-GAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSG--KLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIM--ECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            + + ++  S+ K+I+DYIL++ +E+KRL +  +P      V+R  +PWH+    +K++ ++  +  +  + KL   +  ++  LR +   ++     PL  ++  E+ +++ ++    L   W+  C ++ V+  +      P++  +  R +E +F  VA+  S  LR +V  S+ + V F   ++D   ++  Y   D F       +  ++ I L        P+I F P+FD     +      II +     ++E++LF  ++G      IL  +N EE ++S+  ++  +  K N   P KY  +Y  +  LL+   E    +F+    ++ D+   +  +K   +E AS+   +P+ +F LD   +N  L +R++ L+   + +  + +R  N SIC QY +I  ++++    T++LV L EY++K     +  L+ +L  A+  + FL++Y  LP +DI LN+  F W D+I  + +SS   L  +R++A   L K   +F   L G   +++ F +R  +   +   N ++L  +++ L+  + E + IN+EE LL     + +  LQ ++  K P+++LW +A  F    ++WMNGP+  ++AE++  E  ++W+T Y+LTK     +   P R A  +K K+EKFK ++PI+   CNPG+K RHW  +S+ VG++I P   T L++ML  G  K ++ L  + + ASKE+SLEK   +M+ DW  + FSF  Y++T  +ILC VDDIQ++L+DH++KT TM  S FI P E+E   W++ L R+++ L++WLK Q  WLYLEPIF S DI  Q+P EG +F  VD  W+++M +  ND++VM       + E LQ +  LLE IQ+GLNDYLEKKRL+FPRFFFLSN+ELLEILSETKDPLRVQPHLKKCFEGI+KL+FT+   I GM+S+E E V F   I+P++A+G+VEKW+ QVE  M  S+R+V++  +  Y Q+ R  WV +WPGQVV+  S++ WT + + A+   TL +FLKK++ QI+ IVELVR + L S  R+TL A  V+DVHARDVVAKL    ++S +DF WISQ+RYYW        +  N+ ++M+TTE  YGYEYLGN+ RLVITPLTDRCYRTLMGA+KLNLGGAPEGPAGTGKTET+KDLAKA+AKQCVVFNCSDGLDYK+MGKFFKGLAQ+GAWACFDEFNRIE+EVLSV+AQQI +IQ+AI  +L+ F+FEGTEL L+ +C +FITMNPGYAGR+ELPDNLK LFRTVAMMVPDYALI EISLYSMGF+++R+LA KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     E  ++L++++DVNL KFL  D+PLF GIISDLFPGV  P  DY+     L   +R MKL+PVPWF+ KIIQIYEM+LVRHG MIVG    GKT A+K L+ ALGDL+    +E  +V F IINPKAI++G LYG FD VSHEW+DG+LA  FRE ASS +D+RKWIIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM++K ++IFEP DLEQASPATVSRCGMIYME  QLG  PL   ++   LP  L  E    V+ +F WL+ P LDF    CK  V+   + L  +M++LYSSLLD++R++ ++  +                    ++++   L      +L   F  SL+W+  G I  +  K     F   +  M D    + PRPK++K  +N + P++G+I+D  F+K+  G W  W   I K + + +    ++ +++IPT++T RQ FFL   L +   PI+FVG TGTGKSA+   F+L  LP   +  + + FSA+TS++Q QD   SKLDRRR+GL+ PP  K  VVF+DD++MP KE YGAQPP+E+LRQ IDH +WFD+KD   L I DVL+ +AM  P   R  +T R  RH NII+I+ F+DE +  IF  I DWHF  GF++   R  K++V AT  I+++ + +FLPTP+KSHYVFNLRDFSRVIQG LL     L++L       K IRLW+HE YRVF+DRLI ++D   FF L+K+     FK+    +    S   K  T+  +R L FGD+LK + D                K+Y+EI D   L   M++YLDE+N +SKAPM LV+F+FAIEHI+RICR+L+Q  GH LLVGIGGSGRQSA KL+TF+  +E++QIE+T+ Y+ SDWR+D+++++  +G     T FLF D+QIK   F+EDINMLLN+GD+PN+F  +++ +++EKMQ   + +  ++E T ++MYN FIERVRKNLH+VL  SPIGDAF +RLR FPSLINCCTI+WFQ WP DAL++VANK L++VE+  ++R ++V MC++F +SV  LS  +Y  + R NYVTPTSYLELI TF  LLN K+ E+ T + RY  GL+KLEF+ +Q+++MQVEL A QPQLI+TS++T  ++  IE ET E +  + +V+ +E      A  +++IK++CE +LAEAMP + AA+ ALDTL  +DI++VK+MQNPP  VKLVME++C++KGLKPE+K DPSG  K++EDYW  ++K+LGDLKFL+ LK+YDKD IP   M++IR ++I++P F P  IKN+SSACEGLC WVRA+EVYDR+ KVV+PK+E+L  AE   + QM +L  K+ EL  VE +L  L + F+   ++K  LE NIE+   K+ RAEKLI+GLGGEK RW +    L IR+DN+ GDVLL +G VAYLG FT+ YR +C   W   CK   IP      FSLS+ LGDP+++R WQI GLPVDSFSVDN +IV+++ RW L+IDPQGQANKW+K +E + NKL VIK SD  Y+R LEN LQFGTP LLENVGEELD+ +E +LLK TFKQ  VEY+RLG++++EYS++F+FYITTRLRNPHYLPE +VKV L+NFMITP GL+DQ+LGIV AKEKPELE+++ +LI+ESA N++QLKEIED+IL++LS  +GNILEDE AI+ILSSSKVLSE+IS KQE A+ TE +I+  R GYKPVA H + +FF ISDLA ++PMYQYSL+WFINLY+ S+ NS  S ++++R++ +  HFT ++Y N+CRSLFEKDKLLFS LL +G+ K +  +DE VW FLLTGG++LD+P  NP P+WLSEKSW E+   S+L+  KG ++D + NI+ WK I DS  PH E  P  W   L  LE++ ++RCL P+K++PA+ ++I   +G  ++E P FDL+ S+ +S    P+IF+LSPG DPM+ L +FA+  ++  T  + +SLGQGQGPIA + I +++    W++LQNCHLATSW+P L KICEE+++ ++  N  FRLWLTSYPS  FPV++LQN +KMTNEPPKGLRANLLRSY   PISD  FF++  +P +++KLLF LCFFHA+VQERRNYG++GWNIPYEFN+SDL+IS+RQ+QMF+NDYE+V  EALTYLTGECNYGGRVTD++DRRL++SLL   Y KE + ++ + +     Y++P   S   SY+ +++  P  A PEVFGLH NA++ K+ QETNQLF+ +L+TLP++  G  KS Q ++E+LA DILSKLP  F +EE+  KYPV+Y+E MNTVL QELIRFN+L +V+R+SL+DL  A++G +LM + LEEV+ SM++GKVP++W+  SYPSLKPLG Y++DL+AR+ FFQ WID G P  FW+SGFYFTQSFLTGV QNYAR+    ID + F+F +   E    + P D GA+I GL+LE  RW      + ES  K+LYD LP+I + P   +    ++ Y CPVYKT+ARRG+LSTTGHSTNYV +I LP+    +HWINRG+A+LCQL++
Sbjct:  255 EKESDYYYSLMKSIVDYILMDPMEKKRLFIKSIPRLFPHRVIRAPVPWHNIYQSTKKWNEEHLHTVNPMMYKLKELWFAEFQNLRFVRTADLLAGKLPLLPHEYKEVVQKHCREARHILLTKWIPTCAQLFVTQKEHWVHFAPKNDYDSSRNIEEYFASVASFMSLQLRDLVIKSLRDLVSFFMIHKDGNDFKEPYQEMDFF-------IPQLIMIKLEV----RDPIIVFNPTFDDCWQLIKNSFLEIIKNSDGIPKVESILFPDLKG---YNMILGTVNPEESLVSDFLDQTLEVFKKNQVGPYKYLNVYKKYDDLLDNMAEKGISEFLKEKHEIEDFVTSINSIKKRKNEIASMHITVPLAMFCLDAVFLNYDLCERAQNLKDNLILYQVDVNRETNTSICNQYSTIADKVSEIPANTAELVALIEYLKKSSDVTVFKLRRQLRDASERLEFLMDYADLPNEDIKLNSNLFLWPDQIEDVFESSRNLLMSKRDQAEMDLIKRCSEFESRLEGYSKELEMFRKREVMTTEEMKNNVEKLHDLSKNLDLALTEFELINKEEELLEKEKSS-FPLLQTLMINKIPYEQLWVTAYEFSTKSEEWMNGPLYLMNAEQIAEEIGNMWRTTYKLTKTLI--DVPAPKRLAENVKLKIEKFKQHIPILNIACNPGMKDRHWQQISDIVGYEIKPTETTCLANMLEYGFGKFVDKLEPIGAAASKEYSLEKNLEKMKADWVNMCFSFVKYRDTDTSILCAVDDIQLILDDHVIKTQTMCGSVFIKPIEAECRKWEEKLVRVQENLDAWLKCQVTWLYLEPIFSSEDIIAQMPEEGKKFTTVDTYWKSLMAQAVNDTRVMVAADQPRMTEKLQEANVLLEDIQRGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTDNLEIKGMISSEKETVPFIQTIYPVKAKGMVEKWLQQVEQVMLASMRQVIENGIEAYVQVPRNAWVLEWPGQVVICVSSIFWTREVSEALVEDTLTDFLKKSNDQIAQIVELVRGK-LSSGARLTLGALTVIDVHARDVVAKLRHDHINSLNDFQWISQLRYYW--------TEKNVHVQMITTEALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRKLKRFIFEGTELSLNPTCAVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYEVFLEALNNNIRKMKLQPVPWFIGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLAAALGDLHAANQMEEFAVEFKIINPKAITMGQLYGCFDAVSHEWTDGVLANAFREQASSITDDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSSKMSLIFEPADLEQASPATVSRCGMIYMEAHQLGWKPLKDSYMDT-LPRCLTKEHTELVEDMFTWLVQPCLDFSRLHCKFVVQTSPIHLAFSMMRLYSSLLDEIRDIQEEEMEIY----------------EGLSSQQIFL------WLQGLFLFSLVWTLAGTINAESRKKFDVFFRNLIMGMDD----RNPRPKSVKLTKNNIFPERGSIYDFYFLKQGGGHWNAWTEYITKEE-ETIPANAKVSDLIIPTMETARQSFFLKTYLDH-EIPILFVGPTGTGKSAITNDFLL-HLPKNVYQPNFINFSARTSANQTQDIIMSKLDRRRKGLFGPPIGKKAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGYWFDKKDTNRLDIVDVLLVTAMGPPGGGRNDITGRFTRHLNIISINAFEDEILTKIFSSIADWHFGKGFDVMFLRYGKMLVQATQTIYRAAVENFLPTPSKSHYVFNLRDFSRVIQGVLLCPHTHLQDL------EKFIRLWIHEVYRVFYDRLIDNDDRQTFFNLVKETTSNCFKQTMEKVLIHLSPTGKI-TDDNIRSLFFGDYLKPESDQ---------------KIYDEIIDLRGLTVVMEYYLDEFNSVSKAPMSLVMFKFAIEHISRICRVLKQKKGHLLLVGIGGSGRQSATKLSTFMNSYELYQIEITKNYTNSDWREDLKKIMLQSGVATKSTVFLFSDNQIKHESFVEDINMLLNTGDVPNIFPADEKADLVEKMQTAARTEGEKVEATPLSMYNFFIERVRKNLHIVLAMSPIGDAFRTRLRMFPSLINCCTIDWFQSWPTDALELVANKFLEDVELDDNIRAEVVSMCKYFQESVKKLSVDYYNTLLRHNYVTPTSYLELILTFKTLLNSKRQEVDTIRNRYLAGLQKLEFASSQVAVMQVELTALQPQLIQTSEDTAMMMVKIELETKEADAKKLLVQADEKEANAAAAISQAIKNECEGDLAEAMPALEAALAALDTLNPSDITLVKSMQNPPGPVKLVMESICVMKGLKPERKPDPSGSGKMIEDYWGVSRKILGDLKFLESLKTYDKDNIPSVIMKRIRERFIDHPDFQPAVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLREAEGKLEIQMQKLNQKRAELKLVEDRLQDLNDEFELMNRKKNSLEKNIEICSQKLVRAEKLISGLGGEKDRWTEAARQLGIRYDNLTGDVLLASGTVAYLGAFTVDYRAQCQNEWLVSCKDKVIP--GSVDFSLSNTLGDPIKIRAWQIAGLPVDSFSVDNGIIVSNSRRWPLMIDPQGQANKWVKNME-KTNKLSVIKFSDTNYVRTLENALQFGTPVLLENVGEELDAFIEPILLKATFKQQGVEYMRLGENIIEYSREFKFYITTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNKLILESAQNKKQLKEIEDKILEVLSLCEGNILEDETAIKILSSSKVLSEEISEKQEIASVTETQIDETRMGYKPVAVHSAAIFFCISDLAHIEPMYQYSLTWFINLYVQSLANSNKSDELDLRIEYIIEHFTLSIYNNVCRSLFEKDKLLFSLLLTVGLLKERKAIDEEVWYFLLTGGVALDNPFPNPAPEWLSEKSWGEIVRASSLQKLKGLMEDVMQNIKVWKDIYDSAWPHEESLPSPW-FFLQTLEKIAILRCLRPDKIVPAIQNFICETMGKIFIEAPTFDLQGSYGDSSCCVPLIFILSPGADPMAGLLKFADDVSMGGTKTQTISLGQGQGPIAANMINKAIHEGTWVVLQNCHLATSWMPALEKICEEVIVPEN-TNSEFRLWLTSYPSEKFPVSILQNGIKMTNEPPKGLRANLLRSYLNDPISDPLFFQSCTKPVIWQKLLFGLCFFHAIVQERRNYGALGWNIPYEFNESDLRISMRQIQMFLNDYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLSLLSMFYCKE-IETDNYHIAPGDAYVIPPYGS-YQSYIEYLRTLPITAHPEVFGLHENADITKDNQETNQLFQGVLLTLPRQSGGSGKSPQEVVEELAQDILSKLPNDFNLEEVMKKYPVVYKESMNTVLRQELIRFNRLTKVVRRSLIDLGRAIKGQVLMSSELEEVFNSMLVGKVPAMWAAKSYPSLKPLGGYVADLLARLTFFQEWIDKGPPVVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFEFEVTPKETTMENIPED-GAYIKGLFLEGARWDRSTSQIGESLPKILYDPLPIIWLKPGESASFLHQDIYVCPVYKTSARRGILSTTGHSTNYVLSIELPTDMPQKHWINRGVASLCQLDN 4072          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Mouse
Match: Dnah3 (dynein, axonemal, heavy chain 3 [Source:MGI Symbol;Acc:MGI:2683040])

HSP 1 Score: 3713.31 bits (9628), Expect = 0.000e+0
Identity = 1971/3926 (50.20%), Postives = 2699/3926 (68.75%), Query Frame = 3
Query:  834 DTKQNFQTSVKKAILDYILLNKLEQKRLGLM-MPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICEST-PLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYY---DLFSGMAVSNVNSILRIHLNADLTSSHPLI-FVPSFDR----ICDQLCQIIDNIIG---------------SVSQFSRLENVLFIKVEGTPSLP---FILSMLNYEEFVISN-KEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLN--DAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIEN-SVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSF-GAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSG--KLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIM--ECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            + + ++  S+ K+I+DYIL++ +E+KRL +  +P      V+R  +PWH+    +K++ ++  +  +  + KL   +  ++  LR +   ++     PL  ++  E+ +++ ++    L   W+  C ++ V+  +      P++  +  R +E +F  VA+  S  LR +V  S+ + V F   ++D   ++  Y   D F       +  ++ I L        P+I F P+FD     I +   +II N  G                VS   R+ +VL ++    P L     IL  +N EE ++S+  ++  +  K N   P KY  +Y  +  LL+   E    +F+    ++ D+   +  +K   +E AS+   +P+ +F LD   +N  L +R++ L+   + +  + +R  N SIC QY +I  ++++    T++LV L EY++K     +  L+ +L  A+  + FL++Y  LP++ I               + +SS   L  +R++A   L K   +F   L G   +++ F +R  +   +   N ++L  +++ L+  + E + IN+EE LL     + +  LQ ++  K P+++LW +A  F    ++WMNGP+  ++AE++  E  ++W+T Y+LTK     +   P R A  +K K+EKFK ++PI+   CNPG+K RHW  +S+ VG++I P   T L++ML  G  K ++ L  + + ASKE+SLEK   +M+ DW  + FSF  Y++T  +ILC VDDIQ++L+DH++KT TM  S FI P E+E   W++ L R+++ L++WLK Q  WLYLEPIF S DI  Q+P EG +F  VD  W+++M +  ND++VM       + E LQ +  LLE IQ+GLNDYLEKKRL+FPRFFFLSN+ELLEILSETKDPLRVQPHLKKCFEGI+KL+FT+   I GM+S+E E V F   I+P++A+G+VEKW+ QVE  M  S+R+V++  +  Y Q+ R  WV +WPGQVV+  S++ WT + + A+   TL +FLKK++ QI+ IVELVR + L S  R+TL A  V+DVHARDVVAKL    ++S +DF WISQ+RYYW        +  N+ ++M+TTE  YGYEYLGN+ RLVITPLTDRCYRTLMGA+KLNLGGAPEGPAGTGKTET+KDLAKA+AKQCVVFNCSDGLDYK+MGKFFKGLAQ+GAWACFDEFNRIE+EVLSV+AQQI +IQ+AI  +L+ F+FEGTEL L+ +C +FITMNPGYAGR+ELPDNLK LFRTVAMMVPDYALI EISLYSMGF+++R+LA KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     E  ++L++++DVNL KFL  D+PLF GIISDLFPGV  P  DY+     L   +R MKL+PVPWF+ KIIQIYEM+LVRHG MIVG    GKT A+K L+ ALGDL+    +E  +V F IINPKAI++G LYG FD VSHEW+DG+LA  FRE ASS +D+RKWIIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM++K ++IFEP DLEQASPATVSRCGMIYME  QLG  PL   ++   LP  L  E    V+ +F WL+ P LDF    CK  V+   + L  +M++LYSSLLD++R++ ++  +                    ++++   L      +L   F  SL+W+  G I  +  K     F   +  M D    + PRPK++K  +N + P++G+I+D  F+K+  G W  W   I K + + +    ++ +++IPT++T RQ FFL   L +   PI+FVG TGTGKSA+   F+L  LP   +  + + FSA+TS++Q QD   SKLDRRR+GL+ PP  K  VVF+DD++MP KE YGAQPP+E+LRQ IDH +WFD+KD   L I DVL+ +AM  P   R  +T R  RH NII+I+ F+DE +  IF  I DWHF  GF++   R  K++V AT  I+++ + +FLPTP+KSHYVFNLRDFSRVIQG LL     L++L       K IRLW+HE YRVF+DRLI ++D   FF L+K+     FK+    +    S   K  T+  +R L FGD+LK + D                K+Y+EI D   L   M++YLDE+N +SKAPM LV+F+FAIEHI+RICR+L+Q  GH LLVGIGGSGRQSA KL+TF+  +E++QIE+T+ Y+ SDWR+D+++++  +G     T FLF D+QIK   F+EDINMLLN+GD+PN+F  +++ +++EKMQ   + +  ++E T ++MYN FIER     +  L  SPIGDAF +RLR FPSLINCCTI+WFQ WP DAL++VANK L++VE+  ++R ++V MC++F +SV  LS  +Y  + R NYVTPTSYLELI TF  LLN K+ E+ T + RY  GL+KLEF+ +Q+++MQVEL A QPQLI+TS++T  ++  IE ET E +  + +V+ +E      A  +++IK++CE +LAEAMP + AA+ ALDTL  +DI++VK+MQNPP  VKLVME++C++KGLKPE+K DPSG  K++EDYW  ++K+LGDLKFL+ LK+YDKD IP   M++IR ++I++P F P  IKN+SSACEGLC WVRA+EVYDR+ KVV+PK+E+L  AE   + QM +L  K+ EL  VE +L  L + F+   ++K  LE NIE+   K+ RAEKLI+GLGGEK RW +    L IR+DN+ GDVLL +G VAYLG FT+ YR +C   W   CK   IP      FSLS+ LGDP+++R WQI GLPVDSFSVDN +IV+++ RW L+IDPQGQANKW+K +E + NKL VIK SD  Y+R LEN LQFGTP LLENVGEELD+ +E +LLK TFKQ  VEY+RLG++++EYS++F+FYITTRLRNPHYLPE +VKV L+NFMITP GL+DQ+LGIV AKEKPELE+++ +LI+ESA N++QLKEIED+IL++LS  +GNILEDE AI+ILSSSKVLSE+IS KQE A+ TE +I+  R GYKPVA H + +FF ISDLA ++PMYQYSL+WFINLY+ S+ NS  S ++++R++ +  HFT ++Y N+CRSLFEKDKLLFS LL +G+ K +  +DE VW FLLTGG++LD+P  NP P+WLSEKSW E+   S+L+  KG ++D + NI+ WK I DS  PH E  P  W   L  LE++ ++RCL P+K++PA+ ++I   +G  ++E P FDL+ S+ +S    P+IF+LSPG DPM+ L +FA+  ++  T  + +SLGQGQGPIA + I +++    W++LQNCHLATSW+P L KICEE+++ ++  N  FRLWLTSYPS  FPV++LQN +KMTNEPPKGLRANLLRSY   PISD  FF++  +P +++KLLF LCFFHA+VQERRNYG++GWNIPYEFN+SDL+IS+RQ+QMF+NDYE+V  EALTYLTGECNYGGRVTD++DRRL++SLL   Y KE + ++ + +     Y++P   S   SY+ +++  P  A PEVFGLH NA++ K+ QETNQLF+ +L+TLP++  G  KS Q ++E+LA DILSKLP  F +EE+  KYPV+Y+E MNTVL QELIRFN+L +V+R+SL+DL  A++G +LM + LEEV+ SM++GKVP++W+  SYPSLKPLG Y++DL+AR+ FFQ WID G P  FW+SGFYFTQSFLTGV QNYAR+    ID + F+F +   E    + P D GA+I GL+LE  RW      + ES  K+LYD LP+I + P   +    ++ Y CPVYKT+ARRG+LSTTGHSTNYV +I LP+    +HWINRG+A+LCQL++
Sbjct:  254 EKESDYYYSLMKSIVDYILMDPMEKKRLFIKSIPRLFPHRVIRAPVPWHNIYQSTKKWNEEHLHTVNPMMYKLKELWFAEFQNLRFVRTADLLAGKLPLLPHEYKEVVQKHCREARHILLTKWIPTCAQLFVTQKEHWVHFAPKNDYDSSRNIEEYFASVASFMSLQLRDLVIKSLRDLVSFFMIHKDGNDFKEPYQEMDFF-------IPQLIMIKLEV----RDPIIVFNPTFDDCWQLIKNSFLEIIKNSDGIPKVYLCWKPLASYICVSPHLRMTSVLQVESILFPDLKGYNMILGTVNPEESLVSDFLDQTLEVFKKNQVGPYKYLNVYKKYDDLLDNMAEKGISEFLKEKHEIEDFVTSINSIKKRKNEIASMHITVPLAMFCLDAVFLNYDLCERAQNLKDNLILYQVDVNRETNTSICNQYSTIADKVSEIPANTAELVALIEYLKKSSDVTVFKLRRQLRDASERLEFLMDYADLPSESIE-------------DVFESSRNLLMSKRDQAEMDLIKRCSEFESRLEGYSKELEMFRKREVMTTEEMKNNVEKLHDLSKNLDLALTEFELINKEEELLEKEKSS-FPLLQTLMINKIPYEQLWVTAYEFSTKSEEWMNGPLYLMNAEQIAEEIGNMWRTTYKLTKTLI--DVPAPKRLAENVKLKIEKFKQHIPILNIACNPGMKDRHWQQISDIVGYEIKPTETTCLANMLEYGFGKFVDKLEPIGAAASKEYSLEKNLEKMKADWVNMCFSFVKYRDTDTSILCAVDDIQLILDDHVIKTQTMCGSVFIKPIEAECRKWEEKLVRVQENLDAWLKCQVTWLYLEPIFSSEDIIAQMPEEGKKFTTVDTYWKSLMAQAVNDTRVMVAADQPRMTEKLQEANVLLEDIQRGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTDNLEIKGMISSEKETVPFIQTIYPVKAKGMVEKWLQQVEQVMLASMRQVIENGIEAYVQVPRNAWVLEWPGQVVICVSSIFWTREVSEALVEDTLTDFLKKSNDQIAQIVELVRGK-LSSGARLTLGALTVIDVHARDVVAKLRHDHINSLNDFQWISQLRYYW--------TEKNVHVQMITTEALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRKLKRFIFEGTELSLNPTCAVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYEVFLEALNNNIRKMKLQPVPWFIGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLAAALGDLHAANQMEEFAVEFKIINPKAITMGQLYGCFDAVSHEWTDGVLANAFREQASSITDDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSSKMSLIFEPADLEQASPATVSRCGMIYMEAHQLGWKPLKDSYMDT-LPRCLTKEHTELVEDMFTWLVQPCLDFSRLHCKFVVQTSPIHLAFSMMRLYSSLLDEIRDIQEEEMEIY----------------EGLSSQQIFL------WLQGLFLFSLVWTLAGTINAESRKKFDVFFRNLIMGMDD----RNPRPKSVKLTKNNIFPERGSIYDFYFLKQGGGHWNAWTEYITKEE-ETIPANAKVSDLIIPTMETARQSFFLKTYLDH-EIPILFVGPTGTGKSAITNDFLL-HLPKNVYQPNFINFSARTSANQTQDIIMSKLDRRRKGLFGPPIGKKAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGYWFDKKDTNRLDIVDVLLVTAMGPPGGGRNDITGRFTRHLNIISINAFEDEILTKIFSSIADWHFGKGFDVMFLRYGKMLVQATQTIYRAAVENFLPTPSKSHYVFNLRDFSRVIQGVLLCPHTHLQDL------EKFIRLWIHEVYRVFYDRLIDNDDRQTFFNLVKETTSNCFKQTMEKVLIHLSPTGKI-TDDNIRSLFFGDYLKPESDQ---------------KIYDEIIDLRGLTVVMEYYLDEFNSVSKAPMSLVMFKFAIEHISRICRVLKQKKGHLLLVGIGGSGRQSATKLSTFMNSYELYQIEITKNYTNSDWREDLKKIMLQSGVATKSTVFLFSDNQIKHESFVEDINMLLNTGDVPNIFPADEKADLVEKMQTAARTEGEKVEATPLSMYNFFIERGTNRAYFSLAMSPIGDAFRTRLRMFPSLINCCTIDWFQSWPTDALELVANKFLEDVELDDNIRAEVVSMCKYFQESVKKLSVDYYNTLLRHNYVTPTSYLELILTFKTLLNSKRQEVDTIRNRYLAGLQKLEFASSQVAVMQVELTALQPQLIQTSEDTAMMMVKIELETKEADAKKLLVQADEKEANAAAAISQAIKNECEGDLAEAMPALEAALAALDTLNPSDITLVKSMQNPPGPVKLVMESICVMKGLKPERKPDPSGSGKMIEDYWGVSRKILGDLKFLESLKTYDKDNIPSVIMKRIRERFIDHPDFQPAVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLREAEGKLEIQMQKLNQKRAELKLVEDRLQDLNDEFELMNRKKNSLEKNIEICSQKLVRAEKLISGLGGEKDRWTEAARQLGIRYDNLTGDVLLASGTVAYLGAFTVDYRAQCQNEWLVSCKDKVIP--GSVDFSLSNTLGDPIKIRAWQIAGLPVDSFSVDNGIIVSNSRRWPLMIDPQGQANKWVKNME-KTNKLSVIKFSDTNYVRTLENALQFGTPVLLENVGEELDAFIEPILLKATFKQQGVEYMRLGENIIEYSREFKFYITTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNKLILESAQNKKQLKEIEDKILEVLSLCEGNILEDETAIKILSSSKVLSEEISEKQEIASVTETQIDETRMGYKPVAVHSAAIFFCISDLAHIEPMYQYSLTWFINLYVQSLANSNKSDELDLRIEYIIEHFTLSIYNNVCRSLFEKDKLLFSLLLTVGLLKERKAIDEEVWYFLLTGGVALDNPFPNPAPEWLSEKSWGEIVRASSLQKLKGLMEDVMQNIKVWKDIYDSAWPHEESLPSPW-FFLQTLEKIAILRCLRPDKIVPAIQNFICETMGKIFIEAPTFDLQGSYGDSSCCVPLIFILSPGADPMAGLLKFADDVSMGGTKTQTISLGQGQGPIAANMINKAIHEGTWVVLQNCHLATSWMPALEKICEEVIVPEN-TNSEFRLWLTSYPSEKFPVSILQNGIKMTNEPPKGLRANLLRSYLNDPISDPLFFQSCTKPVIWQKLLFGLCFFHAIVQERRNYGALGWNIPYEFNESDLRISMRQIQMFLNDYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLSLLSMFYCKE-IETDNYHIAPGDAYVIPPYGS-YQSYIEYLRTLPITAHPEVFGLHENADITKDNQETNQLFQGVLLTLPRQSGGSGKSPQEVVEELAQDILSKLPNDFNLEEVMKKYPVVYKESMNTVLRQELIRFNRLTKVVRRSLIDLGRAIKGQVLMSSELEEVFNSMLVGKVPAMWAAKSYPSLKPLGGYVADLLARLTFFQEWIDKGPPVVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFEFEVTPKETTMENIPED-GAYIKGLFLEGARWDRSTSQIGESLPKILYDPLPIIWLKPGESASFLHQDIYVCPVYKTSARRGILSTTGHSTNYVLSIELPTDMPQKHWINRGVASLCQLDN 4083          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Mouse
Match: Dnah7c (dynein, axonemal, heavy chain 7C [Source:MGI Symbol;Acc:MGI:3639762])

HSP 1 Score: 3411.31 bits (8844), Expect = 0.000e+0
Identity = 1850/3930 (47.07%), Postives = 2572/3930 (65.45%), Query Frame = 3
Query:  813 VTNQFLI---DTKQNFQTSVKKAILDYILLNKLEQKRLGLMM---PNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICE-STPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAA-SLPTFLPMHLFILDCETINQWLLDRS-----KQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAAT--IKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAI-KSH-TLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDL-NKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCE--MTDSPNQKYPRPKNLK--CARNLMV--PKKGTIFDHIFMKKQFGCWTTW-QSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSL--TFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEIT--LKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFG--DFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLF--ENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDP--SGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLN 12497
            +TN  ++   + ++++  SVKK+I+D++L +  E+   G +    P++  + VL +  PW    L +  Y++      +  ++ +L  +   + +LRL+ IE   +    L L++   I  ++ +   + L  +W  + + I        +    +S  +    ++ FFNC ATL +  L+ ++  S+ +F + I Q  +           S  A  +   I+R+ L+ D  S     F P F+   D L  I + +I +VS   R+E  L+ + E + S P  L  +   E +  +KEK+R+ +   S AP ++ ++Y  +++L+    E    +F+   +       E+ K + L +E   +    + + +F + CE + + L+ R+     K +  ++ NH    +      +C +++ I  +       T++L+E++  ++K+ T +++ L+ +L  +   + FL+        DI LNN+ F W  R+  I D     +  + E+    L+   ++FVE L     Q++EF+    L D     Q+   +  KL+   ++  Q N EE      V + Y Q ++I     P+ +L+++AV F   +  W  GP  +V+ ++VE +  + W+  Y+L KVF    +  P   A T  +++ +E+FK  +P+IQ +CNPGL  RHW+AMS  VG+ + P  D+ +   + M L+  L+    +S  ASKE+SLEKA  +M  +W  + F   PY+E+G  IL +VDDIQ+LL+DHI+KT TMR SPFI P+E ++  W+  L  L++ L+ WLKVQA WLYLEPIF S DI  Q+P EG +F+ VD+ WR +M  V  D +V+ V+  + +LE L+ S  LLE I KGLN+YLEKKRL+FPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGI+K++FTE   IT M S+E E V+    I   +A G VEKW++++E  M  S+ +V++ A+  Y + SR  WV+DWPGQ VL  S   WT +   AI K H  LE++L K +QQI  IV LVR + L    R+TL A +VLDVHARDV+A L   ++S + DF W+SQ+RYYW          +NL  +M+   + YGYEYLGN+ RLVITPLTDRCYRTL GA+ L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGL   GAWACFDEFNRI+LEVLSV+AQQI TIQR I    ++ +FEGTEL+LD +C +FITMNPGYAGRSELPDNLK LFRTVAMMVPDYA+IAEI LYS GFV AR L+ KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     EE ++L+SIIDVNLPKFL  D+PLF+GI SDLFPGV+ P  DY DL   + +   TM L+   +F +KI+QIYEM++VRHG MIVG+ F GKT A++ L+ AL D+  K L  EN V   ++NPK++++G LYG+FD VSHEWSDG+LA +FR  A+S + +RKW+IFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+ + N+IFEP DLE ASPATVSRCGMIYMEP  LG  PL+  WI   LP+ +   Q+  ++ LF+ ++P S++FI R  K         LV +++ L    +DD  +                         NK    N+   +E  + L   F  SLIWS GA    D ++KFD   R+L E  ++D    K+    + +   ++  +V  P+KGTI+D+ F+ +  G W  W + L + P +    K  + + I++PT+DTVR    L  +L   +KP +FVG TGTGKS  I  F+L+ L NKD ++  L   FSAQT++ Q Q+   SKLD+RR+G++ PP  K ++VF+DD++MP +E YGAQPP+E+LRQ +DH  W+D KD + + + D+ I  AM  P   R  +T R +RHFNI+ I+EF D++M  IF  I+ WH  + ++       ++  IV+ T  +++  M + LPTPAKSHY+FNLRDFSRVIQG  L +    +N         + RLWVHE  RV++DRL+ + D       I+ +++   +E FH LF   DF+ D     + ++R LMF DF   K+               E   Y E+ + +AL   ++ +LDEYN MSK PM+LVLFRFAIEHI+RI R+L+QP  H+LLVG+GGSGRQS  +LA  + D+ +FQ+E+++ Y   +W +D++ ++R   +  ++  FLF D QIK   FLED+N LLN+G++PNLF  + +  +    +     + +  Q + + I ++N FI+R R  LH+VL  SPIGDAF  RLR FP+L+NCCTI+WFQ WPEDAL+ VA++ L+++E+ ++ +E  + MC+ FH S  +LS  F+  + R NYVTPTSYLELI TF  LL KK+ E++  K RY VGL+KL+ + +Q++ MQ EL+A  PQL   S+E ++++ IIE E++EV K  K+VK +E     +A  AK+IKD+C+++LAEA+P++ +A+ ALDTL   DI++VK+M++PP GVKLVMEAVCILKG+K +K  DP  SGK +ED+W  AK+LLGD++FL  L  YDKD IP AYM  IR  YI NP F P KI+N S+A EGLC WV A++ YD++ K+V+PKK KLA AE   +  M  L+ KQ  LYEV+ KLAKLQ+  +  +Q+K DLEN ++L   K+ERAE+LI GLGGEK RW     +L   + N+ GD+L+ +G+VAYLG FT  YRQ   + W   CK   IP      +SL   LG+ V +R W I GLP DSFS+DN +I+ +  RW L+IDPQGQANKWIK +E + N L++IKLSD  Y+R LENC+QFGTP LLENVGEELD +LE +LLKQTFKQ     IRLGD  +EY+ DFRFYITT+LRNPHYLPE SVKVTL+NFMITP G++DQ+LGIV A+E+P+LE+ +  LI++ A N+RQLKEIED+IL++LS S+GNILEDE AI+ILSSSK L+ +IS KQE A +TE +I+  R GY+ +A H SILFF+I+DLA+++PMYQYSL+WFINL+I SIENSE S  +  RL+ L  HFT ++Y NICRSLFEKDKLLFSF L + +    N +++  WRFLLTGGI LD+P  NP   WL +KSW+E+  L +L  FK   ++F+     WK + DS  PH E FP DWE + +  +R+++IRCL P+KVIP +  +I+  LG  ++EPP FDL  +F +S+   P+IFVLSPG DPM+ L +FA+ +    + L  +SLGQGQGPIA   + +++K   W++LQNCHLATSW+P L K+CEE  L     +P+FR+WLTSYPS  FPV+VLQN VKMTNE PKGLRAN++RSY   PISD +FF + K+P+ F+KLL+ LCFFHA+VQERR +G +GWNIPYEFN++DL+IS++QL MF++ YE++  +AL Y+TGECNYGGRVTD+ DRR + S+L   +  EL+ +  +    SG Y +P  + D  SY+++ K  P   APEVFG++ NA++ K+Q ET  LF++IL+T  +     +KSS  ++ ++A DILSKLP  F IE    +YP  Y + MNTVL+QE+ RFNKL+  IR+S ++++ A++GL++M   LEEV  S++  K+P++W   SYPSLKPLGSY++D + R+KF Q W + G P  FW+SGF+FTQ+FLTG  QNYAR+    ID L FD+ +M+  EY    ++G +IHGL+L+   W  +   L ESH KVLYD +PV+ + P  KS I+   SY  P+YKT+ RRG LSTTGHSTN+V  + LPS Q  +HWI RG+A LCQLN
Sbjct:  199 MTNSIMVLSDEIREDYLLSVKKSIVDFVLKDPREKDDDGKITELPPHRAEIEVLPK--PWRRSFLSACSYIRDHLNAMNPMMLAVLDLWHSTFKKLRLVDIEEFHKRQDALELSEFQNIVIKHMESAKETLLKTWFPEVQNIYYKGNKKKQLPTGKSSAK----LDSFFNCAATLMTLQLQDLILVSMQDFTDLIAQPPE-----------STRAFEHPGFIMRLVLDKDNIS-----FEPEFNDYIDILVNIYEIMIKAVSFVPRVETKLYSQWE-SKSKPTTLKPIILNEIIDGHKEKIREVILRESVAPTEHLKMYDKYQFLITGKAERDIDEFLFQSQNYERLIEEIRKYQKLEEEIQYTSRKAVRLGMFEMHCEELIKSLVKRADIICGKLIAKMFRNHQKESTM-----LCDEFEKIAEKALSTPLNTAELMEMKADIQKVETTDMLELRQRLVDSKNCLAFLIECVNFSPADIRLNNSVFQWYGRMGEIFDEHRKIIKDKTEQYQEALKFRCERFVEELESYAKQVEEFHTFGDLMDMQRYLQKAQVLNSKLDAAADKIDQFNAEEEAYG-WVPSVYPQRKKIQDALNPYLRLYETAVEFSAKHKWWTEGPYHKVNPDQVETDVGNYWRGLYKLEKVF----HDSPNALAMTKKVQSMVEEFKQYIPLIQVICNPGLHPRHWEAMSTIVGYPLKPSDDSTVLSFIDMNLEPFLDRFEGISEAASKEYSLEKAMDKMMTEWNSMEFVIHPYRESGTYILSSVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFKAVDKTWRDMMKTVVQDKQVLAVVTIERMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELVDTISTAKARGQVEKWLVELERTMIKSIHKVIRDAIAAYTKYSRISWVRDWPGQTVLCVSQTFWTVEVQTAIPKGHQALEDYLAKCNQQIDDIVTLVRGK-LSKQNRVTLGALVVLDVHARDVLASLADKKISDDSDFQWLSQLRYYW--------QENNLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGTDLLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIRDNCHTMNLQMTDFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLVSHEWSDGVLAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMVSWINT-LPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTKELSPTSDTNLVHSLMNLIDCFMDDFAD------------------------ENKQKERND---QESFSLLEGIFLFSLIWSVGATCTDDDRMKFDKILRELMEGPISDQTRNKFTLLSSTEQTSSKAFIVPFPEKGTIYDYQFILEDLGRWDKWIKKLADTPPIP---KDVQFNEIIVPTLDTVRYS-ALMHLLTTHQKPSIFVGPTGTGKSVYIINFLLNQL-NKD-IYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIVTINEFSDKSMFTIFSRILAWHLRTCYKFPDDFLDMTTQIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAEN------KEAIKRLWVHEVLRVYYDRLVDNADRGWLINYIQGILKNYMQEDFHDLFKNLDFNHDGTVEED-DLRSLMFCDFHDPKR---------------EDFGYREVENVDALRMIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAENDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQLDRQRDKTKQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEETQEGCIDMCKRFHTSTINLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAEALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAVCILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLRIAMEGLRKKQAALYEVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYINLTGDILISSGVVAYLGAFTSNYRQNQTKEWSQSCKERDIPC--SDDYSLMGTLGEAVTIRAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNME-KTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALIVQGADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKIDNTRMGYRIIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRLQILRDHFTYSLYVNICRSLFEKDKLLFSFCLTVNLLIHDNLINKTEWRFLLTGGIGLDNPYTNPC-TWLPQKSWDEICRLDDLPAFKTIRREFMRLKDGWKKVYDSMEPHHEMFPEDWENKANDFQRMLIIRCLRPDKVIPMLQEFIIKKLGRPFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEE--LNPESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFDSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFIP-PSGDHKSYIDYTKTLPLIPAPEVFGMNANADITKDQSETQLLFDNILLTQSQSSGSGTKSSDEVVNEVAGDILSKLPNNFDIEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPAMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKFTIPIDLLAFDYEVMDDKEYKNAPEDGVYIHGLFLDGASWDRKTKKLAESHPKVLYDTVPVMWLKPCKKSDISKRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVALLCQLN 4023          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Mouse
Match: Dnah7b (dynein, axonemal, heavy chain 7B [Source:MGI Symbol;Acc:MGI:2684953])

HSP 1 Score: 3406.31 bits (8831), Expect = 0.000e+0
Identity = 1846/3918 (47.12%), Postives = 2565/3918 (65.47%), Query Frame = 3
Query:  834 DTKQNFQTSVKKAILDYILLN---KLEQKRLGLMMPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENIC-ESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAA-SLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAAT--IKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAI-KSH-TLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDL-NKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPK-------NLKCARNLMV--PKKGTIFDHIFMKKQFGCWTTW-QSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSL--TFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEIT--LKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFG--DFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLF--ENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDP--SGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLN 12497
            + ++++  SVKK+I+D++L +   K +  ++  + P++  + VL +  PW    L +  Y++      +  ++ +L  +   + +LRL+ IE        L L++   I  ++ +   + L  +W  + + I        +    +S  +    ++ FFNC ATL +  L+ ++  S+ +F + I Q  +           S  A  +   I+R+ L+        + F P F+   D L  + + +I  VS   R+E  L+ + E + S P  L  +   E + ++KEK+R+ V   S AP ++ ++Y  +++L+    E    +F+   +       E+ K + L +E   +    + + +F + CE + + L+ R+  +    +  M    +  N  +C +++ I  +       T++L+E++ +V+KL T +++ L+ +L  +   + FL+        DI LNN+ F W  R+  I D     +  + E+    L+   ++FVE L     Q++EF+    L D     ++   +  KL+   ++ +Q N EE      V + Y Q ++I     P+ +L+++AV F   +  W  GP  +V+ ++VEA+  + W+  Y+L KVF    +  P   A T  +++ +E+FK  +P+IQ +CNPGL+ RHW+AMS  VGF + P  D+ +   + M L+  L+    +S  ASKE+SLEKA  +M  +W  + F   PY+E+G  IL +VDDIQ+LL+DHI+KT TMR SPFI P+E ++  W+  L  L++ L+ WLKVQA WLYLEPIF S DI  Q+P EG +F+ VD+ WR +M  V  D +V+ V+  + +LE L+ S  LLE I KGLN+YLEKKRL+FPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGI+K++FTE   IT M S+E E V+    I   +A G VEKW++++E  M  S+ +V+  A+  Y + SR  WV+DWPGQ VL  S   WT +   AI K H  LE +L K + QI  IV LVR + L    R+TL A +VLDVHARDV+A L+  ++S + DF W+SQ+RYYW          +NL  +M+   + YGYEYLGN+ RLVITPLTDRCYRTL GA+ L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGL   GAWACFDEFNRI+LEVLSV+AQQI TIQR I    E+ +FEGTEL+LD +C +FITMNPGYAGRSELPDNLK LFRTVAMMVPDYA+IAEI LYS GFV AR L+ KIVA YRLCSEQLSSQHHY+YGMRAVKSVLTAAG LK K     EE ++L+SIIDVNLPKFL  D+PLF+GI SDLFPGV+ P  DY +L   + E   TM L+   +F +KI+QIYEM++VRHG MIVG+ F GKT A++ L+ AL D+  K L  EN V   ++NPK++++G LYG+FD VSHEWSDGILA +FR  A+S + +RKW+IFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+ + N+IFEP DLE ASPATVSRCGMIYMEP  LG  PL+  WI   LP+ +   Q+  ++ LF+ ++P S++FI R  K         LV +++ L    +DD  +                         NK    N+    E  + L   F  SL WS GA    D +LKFD   R   E+ + P     R K           ++  +V  P+KGTI+++ F+ +  G W  W + L + P + + ++  E   I++PT+DT+R    L  +L   +KP +FVG TGTGKS  I  F+L+ L NKD ++  L   FSAQT++ Q Q+   SKLD+RR+G++ PP  K ++VF+DD++MP +E YGAQPP+E+LRQ +DH  W+D KD + + + D+ I  AM  P   R  +T R +RHFNI+ I+EF D++M  IF  I+ WH  + ++       L+  IV+ T  +++  M + LPTPAKSHY+FNLRDFSRVIQG  L +    +N         + RLWVHE  RV++DRL+ + D       I+++++   +E FH LF   DF+ D     + ++R LMF DF   K+               E   Y EI + +AL   ++ +LDEYN MSK PM+LVLFRFAIEHI+RI R+L+QP  H+LLVG+GGSGRQS  +LA  + D+ +FQ+E+++ Y   +W +D++ ++R   +  ++  FLF D QIK   FLED+N LLN+G++PNLF  + +  +    +     + +  Q + + I ++N FI+R R  LH+VL  SPIGDAF  RLR FP+L+NCCTI+WFQ WPEDAL+ VA++ L+++E+ ++++E  + MC+ FH S  +LS  F+  + R NYVTPTSYLELI TF  LL KK+ E++  K RY VGL+KL+ + +Q++ MQ EL+A  PQL   S+E ++++ IIE E++EV K  K+VK +E     +A  AK+IKD+C+++LAEA+P++ +A+ ALDTL   DI++VK+M++PP GVKLVMEA+CILKG+K +K  DP  SGK +ED+W  AK+LLGD++FL  L  YDKD IP AYM  IR  YI NP F P KI+N S+A EGLC WV A++ YD++ K+V+PKK KLA AE   +  M  L+ KQ  LYEV+ KLAKLQ+  +  +Q+K DLEN ++L   K+ERAE+LI GLGGEK RW     +L   + N+ GD+L+ +G+VAYLG FT  YRQ   + W   CK   IP      +SL   LG+ V +R W I GLP DSFS+DN +I+ +  RW L+IDPQGQANKWIK +E + N L++IKLSD  Y+R LENC+QFGTP LLENVGEELD +LE +LLKQTFKQ     IRLGD  +EY+ DFRFYITT+LRNPHYLPE SVKVTL+NFMITP G++DQ+LGIV A+E+P+LE+ +  LI++ A N+RQLKEIED+IL++LS S+GNILEDE AI+ILSSSK L+ +IS KQE A +TE +I+  R GY+ +A H SILFF+I+DLA+++PMYQYSL+WFINL+I SIENSE S  +  RL+ L  HFT ++Y NICRSLFEKDKLLFSF L + +   +N +++  WRFLLTGGI LD+P  NP   WL +KSW+E+  L +L  FK   ++F+     WK + DS  PH E FP DWE + +  +R+++IRCL P+KVIP +  +I+  LG  ++EPP FDL  +F +S+   P+IFVLSPG DPM+ L +FA+ +    + L  +SLGQGQGPIA   + +++K   W++LQNCHLATSW+P L K+CEEL  + +  +P+FR+WLTSYPS  FPV+VLQN VKMTNE PKGLRAN++RSY   PISD +FF + K+P+ F+KLL+ LCFFHA+VQERR +G +GWNIPYEFN++DL+IS++QL MF++ YE++  +AL Y+TGECNYGGRVTD+ DRR + S+L   +  EL+ +  +    SG Y VP  + D  SY+N+ K  P   APEVFG++ NA++ K+Q ET  LF++IL+T  +     +KSS  ++ ++A DILSKLP  F +E    +YP  Y + MNTVL+QE+ RFNKL+  IR+S ++++ A++GL++M   LEEV  S++  K+P +W   SYPSLKPLGSY++D + R+KF Q W + G P  FW+SGF+FTQ+FLTG  QN+AR+    ID L FD+ +M+  EY    ++G +IHGL+L+   W+ +   L ESH KVLYD +PV+ + P  KS I    SY  P+YKT+ RRG LSTTGHSTN+V  + LPS Q  +HWI RG+A LCQLN
Sbjct:  253 EIREDYLLSVKKSIVDFVLKDPRKKDDDGKITELPPHRAEMEVLPK--PWRRSFLSACSYIRDHLNAMNPMMLAVLDLWHSTFKKLRLVDIEEFHNRQDSLELSEFQNIVIKHMESAKEMLLKTWFPEVQNIYYKGNKKKQLPTGKSSAK----LDSFFNCAATLMTLQLQDLILVSMQDFTDLIAQPPE-----------STRAFEHPGFIMRLILD-----KKTIKFAPDFNDYIDILINVYEIMIKMVSFVPRVETKLYSQWE-SKSKPTTLKPIILNEIIDTHKEKIREVVLRESVAPTEHLKMYDKYQFLITGKAERDIDEFLFQSQNYERLIEEIRKYQKLEEEIQYTSRKAVRLGMFEMHCEELIKSLVKRADVICGKLIAKMFRDHQEVNTMLCDEFEKIAEKALSMPLNTAELMEMKAHVQKLETTDMLELRQRLVDSKNCLAFLIECVNFSPADIRLNNSVFQWYGRMGEIFDEHRKIIKDKTEQYQEALKFRCERFVEELESYAKQVEEFHTFGDLLDVQRYLKKAQVLNGKLDAAADKIEQFNAEEEAYG-WVPSVYPQRKKIQDGLNPYLRLYETAVEFSTKHRGWTEGPYHKVNPDQVEADVGNYWRGLYKLEKVF----HDSPNALAMTKKVQSMVEEFKQYIPLIQVICNPGLRPRHWEAMSTIVGFPLLPSDDSTVFSFIDMNLEPFLDRFEGISEAASKEYSLEKAMDKMMTEWDSMEFVILPYRESGTYILSSVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFKAVDKTWRDVMKTVVQDKRVLAVVTIERMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELVDTISTAKARGQVEKWLVELERTMIKSIHKVIGDAIAAYTKNSRISWVRDWPGQTVLCVSQTFWTVEVQTAIPKGHRALEGYLAKCNHQIDDIVTLVRGK-LSKQNRVTLGALVVLDVHARDVLASLVDKKISDDSDFQWLSQLRYYW--------QENNLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGTELLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYNYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNELLAAIRENCHTMNLQMTDFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLVSHEWSDGILAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMVSWINT-LPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTKELSPTSDTNLVQSLMNLIDCFMDDFAD------------------------ENKQKERND---RESFSLLEGIFMFSLAWSVGATCTDDDRLKFDKILR---ELMEGPISDLTRNKFKLLSGTEQTSSKVFIVPFPEKGTIYEYQFIPEGLGRWDKWIKKLADTPPIPKDVQFIE---IIVPTLDTIRYS-ALMHLLTTHQKPSIFVGPTGTGKSVYIINFLLNQL-NKD-IYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIVTINEFSDKSMFTIFSRILAWHLRTCYKFPDDFLDLTTQIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAEN------KEAIKRLWVHEVLRVYYDRLVDNADRSWLIHYIQEILKNYMQEDFHDLFKNLDFNQDGTVEED-DLRSLMFCDFHDPKR---------------EDFGYREIANVDALRMIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAENDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQLDRQRDKTRQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEEIQEGCIDMCKRFHTSTINLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAEALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLRIAMEGLRKKQAALYEVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYINLTGDILISSGVVAYLGAFTSNYRQNQTQEWSQSCKERDIPC--SDDYSLMGTLGEAVTIRAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNME-KTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQSLIVQGADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKIDNTRMGYRIIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRLQILRDHFTYSLYVNICRSLFEKDKLLFSFCLTVNLLIHENAINKTEWRFLLTGGIGLDNPYTNPC-TWLPQKSWDEICRLDDLPAFKTIRREFMRLKDGWKKVYDSMEPHHEMFPEDWENKANDFQRMLIIRCLRPDKVIPMLQEFIIKKLGRPFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELSAEST--HPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFVP-PSGDHKSYINYTKTLPLIPAPEVFGMNANADITKDQSETQLLFDNILLTQSQSSGSGTKSSDEVVNEVAGDILSKLPNNFDVEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPVMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNFARKFTIPIDLLGFDYEVMDDKEYKNAPEDGVYIHGLFLDGASWNRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPKRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVALLCQLN 4067          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Mouse
Match: Dnah7b (dynein, axonemal, heavy chain 7B [Source:MGI Symbol;Acc:MGI:2684953])

HSP 1 Score: 3406.31 bits (8831), Expect = 0.000e+0
Identity = 1846/3918 (47.12%), Postives = 2565/3918 (65.47%), Query Frame = 3
Query:  834 DTKQNFQTSVKKAILDYILLN---KLEQKRLGLMMPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENIC-ESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAA-SLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAAT--IKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAI-KSH-TLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDL-NKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPK-------NLKCARNLMV--PKKGTIFDHIFMKKQFGCWTTW-QSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSL--TFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEIT--LKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFG--DFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLF--ENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDP--SGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLN 12497
            + ++++  SVKK+I+D++L +   K +  ++  + P++  + VL +  PW    L +  Y++      +  ++ +L  +   + +LRL+ IE        L L++   I  ++ +   + L  +W  + + I        +    +S  +    ++ FFNC ATL +  L+ ++  S+ +F + I Q  +           S  A  +   I+R+ L+        + F P F+   D L  + + +I  VS   R+E  L+ + E + S P  L  +   E + ++KEK+R+ V   S AP ++ ++Y  +++L+    E    +F+   +       E+ K + L +E   +    + + +F + CE + + L+ R+  +    +  M    +  N  +C +++ I  +       T++L+E++ +V+KL T +++ L+ +L  +   + FL+        DI LNN+ F W  R+  I D     +  + E+    L+   ++FVE L     Q++EF+    L D     ++   +  KL+   ++ +Q N EE      V + Y Q ++I     P+ +L+++AV F   +  W  GP  +V+ ++VEA+  + W+  Y+L KVF    +  P   A T  +++ +E+FK  +P+IQ +CNPGL+ RHW+AMS  VGF + P  D+ +   + M L+  L+    +S  ASKE+SLEKA  +M  +W  + F   PY+E+G  IL +VDDIQ+LL+DHI+KT TMR SPFI P+E ++  W+  L  L++ L+ WLKVQA WLYLEPIF S DI  Q+P EG +F+ VD+ WR +M  V  D +V+ V+  + +LE L+ S  LLE I KGLN+YLEKKRL+FPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGI+K++FTE   IT M S+E E V+    I   +A G VEKW++++E  M  S+ +V+  A+  Y + SR  WV+DWPGQ VL  S   WT +   AI K H  LE +L K + QI  IV LVR + L    R+TL A +VLDVHARDV+A L+  ++S + DF W+SQ+RYYW          +NL  +M+   + YGYEYLGN+ RLVITPLTDRCYRTL GA+ L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGL   GAWACFDEFNRI+LEVLSV+AQQI TIQR I    E+ +FEGTEL+LD +C +FITMNPGYAGRSELPDNLK LFRTVAMMVPDYA+IAEI LYS GFV AR L+ KIVA YRLCSEQLSSQHHY+YGMRAVKSVLTAAG LK K     EE ++L+SIIDVNLPKFL  D+PLF+GI SDLFPGV+ P  DY +L   + E   TM L+   +F +KI+QIYEM++VRHG MIVG+ F GKT A++ L+ AL D+  K L  EN V   ++NPK++++G LYG+FD VSHEWSDGILA +FR  A+S + +RKW+IFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+ + N+IFEP DLE ASPATVSRCGMIYMEP  LG  PL+  WI   LP+ +   Q+  ++ LF+ ++P S++FI R  K         LV +++ L    +DD  +                         NK    N+    E  + L   F  SL WS GA    D +LKFD   R   E+ + P     R K           ++  +V  P+KGTI+++ F+ +  G W  W + L + P + + ++  E   I++PT+DT+R    L  +L   +KP +FVG TGTGKS  I  F+L+ L NKD ++  L   FSAQT++ Q Q+   SKLD+RR+G++ PP  K ++VF+DD++MP +E YGAQPP+E+LRQ +DH  W+D KD + + + D+ I  AM  P   R  +T R +RHFNI+ I+EF D++M  IF  I+ WH  + ++       L+  IV+ T  +++  M + LPTPAKSHY+FNLRDFSRVIQG  L +    +N         + RLWVHE  RV++DRL+ + D       I+++++   +E FH LF   DF+ D     + ++R LMF DF   K+               E   Y EI + +AL   ++ +LDEYN MSK PM+LVLFRFAIEHI+RI R+L+QP  H+LLVG+GGSGRQS  +LA  + D+ +FQ+E+++ Y   +W +D++ ++R   +  ++  FLF D QIK   FLED+N LLN+G++PNLF  + +  +    +     + +  Q + + I ++N FI+R R  LH+VL  SPIGDAF  RLR FP+L+NCCTI+WFQ WPEDAL+ VA++ L+++E+ ++++E  + MC+ FH S  +LS  F+  + R NYVTPTSYLELI TF  LL KK+ E++  K RY VGL+KL+ + +Q++ MQ EL+A  PQL   S+E ++++ IIE E++EV K  K+VK +E     +A  AK+IKD+C+++LAEA+P++ +A+ ALDTL   DI++VK+M++PP GVKLVMEA+CILKG+K +K  DP  SGK +ED+W  AK+LLGD++FL  L  YDKD IP AYM  IR  YI NP F P KI+N S+A EGLC WV A++ YD++ K+V+PKK KLA AE   +  M  L+ KQ  LYEV+ KLAKLQ+  +  +Q+K DLEN ++L   K+ERAE+LI GLGGEK RW     +L   + N+ GD+L+ +G+VAYLG FT  YRQ   + W   CK   IP      +SL   LG+ V +R W I GLP DSFS+DN +I+ +  RW L+IDPQGQANKWIK +E + N L++IKLSD  Y+R LENC+QFGTP LLENVGEELD +LE +LLKQTFKQ     IRLGD  +EY+ DFRFYITT+LRNPHYLPE SVKVTL+NFMITP G++DQ+LGIV A+E+P+LE+ +  LI++ A N+RQLKEIED+IL++LS S+GNILEDE AI+ILSSSK L+ +IS KQE A +TE +I+  R GY+ +A H SILFF+I+DLA+++PMYQYSL+WFINL+I SIENSE S  +  RL+ L  HFT ++Y NICRSLFEKDKLLFSF L + +   +N +++  WRFLLTGGI LD+P  NP   WL +KSW+E+  L +L  FK   ++F+     WK + DS  PH E FP DWE + +  +R+++IRCL P+KVIP +  +I+  LG  ++EPP FDL  +F +S+   P+IFVLSPG DPM+ L +FA+ +    + L  +SLGQGQGPIA   + +++K   W++LQNCHLATSW+P L K+CEEL  + +  +P+FR+WLTSYPS  FPV+VLQN VKMTNE PKGLRAN++RSY   PISD +FF + K+P+ F+KLL+ LCFFHA+VQERR +G +GWNIPYEFN++DL+IS++QL MF++ YE++  +AL Y+TGECNYGGRVTD+ DRR + S+L   +  EL+ +  +    SG Y VP  + D  SY+N+ K  P   APEVFG++ NA++ K+Q ET  LF++IL+T  +     +KSS  ++ ++A DILSKLP  F +E    +YP  Y + MNTVL+QE+ RFNKL+  IR+S ++++ A++GL++M   LEEV  S++  K+P +W   SYPSLKPLGSY++D + R+KF Q W + G P  FW+SGF+FTQ+FLTG  QN+AR+    ID L FD+ +M+  EY    ++G +IHGL+L+   W+ +   L ESH KVLYD +PV+ + P  KS I    SY  P+YKT+ RRG LSTTGHSTN+V  + LPS Q  +HWI RG+A LCQLN
Sbjct:  209 EIREDYLLSVKKSIVDFVLKDPRKKDDDGKITELPPHRAEMEVLPK--PWRRSFLSACSYIRDHLNAMNPMMLAVLDLWHSTFKKLRLVDIEEFHNRQDSLELSEFQNIVIKHMESAKEMLLKTWFPEVQNIYYKGNKKKQLPTGKSSAK----LDSFFNCAATLMTLQLQDLILVSMQDFTDLIAQPPE-----------STRAFEHPGFIMRLILD-----KKTIKFAPDFNDYIDILINVYEIMIKMVSFVPRVETKLYSQWE-SKSKPTTLKPIILNEIIDTHKEKIREVVLRESVAPTEHLKMYDKYQFLITGKAERDIDEFLFQSQNYERLIEEIRKYQKLEEEIQYTSRKAVRLGMFEMHCEELIKSLVKRADVICGKLIAKMFRDHQEVNTMLCDEFEKIAEKALSMPLNTAELMEMKAHVQKLETTDMLELRQRLVDSKNCLAFLIECVNFSPADIRLNNSVFQWYGRMGEIFDEHRKIIKDKTEQYQEALKFRCERFVEELESYAKQVEEFHTFGDLLDVQRYLKKAQVLNGKLDAAADKIEQFNAEEEAYG-WVPSVYPQRKKIQDGLNPYLRLYETAVEFSTKHRGWTEGPYHKVNPDQVEADVGNYWRGLYKLEKVF----HDSPNALAMTKKVQSMVEEFKQYIPLIQVICNPGLRPRHWEAMSTIVGFPLLPSDDSTVFSFIDMNLEPFLDRFEGISEAASKEYSLEKAMDKMMTEWDSMEFVILPYRESGTYILSSVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFKAVDKTWRDVMKTVVQDKRVLAVVTIERMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELVDTISTAKARGQVEKWLVELERTMIKSIHKVIGDAIAAYTKNSRISWVRDWPGQTVLCVSQTFWTVEVQTAIPKGHRALEGYLAKCNHQIDDIVTLVRGK-LSKQNRVTLGALVVLDVHARDVLASLVDKKISDDSDFQWLSQLRYYW--------QENNLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGTELLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYNYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNELLAAIRENCHTMNLQMTDFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLVSHEWSDGILAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMVSWINT-LPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTKELSPTSDTNLVQSLMNLIDCFMDDFAD------------------------ENKQKERND---RESFSLLEGIFMFSLAWSVGATCTDDDRLKFDKILR---ELMEGPISDLTRNKFKLLSGTEQTSSKVFIVPFPEKGTIYEYQFIPEGLGRWDKWIKKLADTPPIPKDVQFIE---IIVPTLDTIRYS-ALMHLLTTHQKPSIFVGPTGTGKSVYIINFLLNQL-NKD-IYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIVTINEFSDKSMFTIFSRILAWHLRTCYKFPDDFLDLTTQIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAEN------KEAIKRLWVHEVLRVYYDRLVDNADRSWLIHYIQEILKNYMQEDFHDLFKNLDFNQDGTVEED-DLRSLMFCDFHDPKR---------------EDFGYREIANVDALRMIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAENDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQLDRQRDKTRQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEEIQEGCIDMCKRFHTSTINLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAEALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLRIAMEGLRKKQAALYEVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYINLTGDILISSGVVAYLGAFTSNYRQNQTQEWSQSCKERDIPC--SDDYSLMGTLGEAVTIRAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNME-KTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQSLIVQGADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKIDNTRMGYRIIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRLQILRDHFTYSLYVNICRSLFEKDKLLFSFCLTVNLLIHENAINKTEWRFLLTGGIGLDNPYTNPC-TWLPQKSWDEICRLDDLPAFKTIRREFMRLKDGWKKVYDSMEPHHEMFPEDWENKANDFQRMLIIRCLRPDKVIPMLQEFIIKKLGRPFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELSAEST--HPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFVP-PSGDHKSYINYTKTLPLIPAPEVFGMNANADITKDQSETQLLFDNILLTQSQSSGSGTKSSDEVVNEVAGDILSKLPNNFDVEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPVMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNFARKFTIPIDLLGFDYEVMDDKEYKNAPEDGVYIHGLFLDGASWNRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPKRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVALLCQLN 4023          
BLAST of dynein heavy chain 3, axonemal vs. UniProt/SwissProt
Match: sp|Q8BW94|DYH3_MOUSE (Dynein heavy chain 3, axonemal OS=Mus musculus OX=10090 GN=Dnah3 PE=1 SV=2)

HSP 1 Score: 3713.31 bits (9628), Expect = 0.000e+0
Identity = 1971/3926 (50.20%), Postives = 2699/3926 (68.75%), Query Frame = 3
Query:  834 DTKQNFQTSVKKAILDYILLNKLEQKRLGLM-MPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICEST-PLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYY---DLFSGMAVSNVNSILRIHLNADLTSSHPLI-FVPSFDR----ICDQLCQIIDNIIG---------------SVSQFSRLENVLFIKVEGTPSLP---FILSMLNYEEFVISN-KEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLN--DAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIEN-SVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSF-GAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSG--KLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIM--ECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            + + ++  S+ K+I+DYIL++ +E+KRL +  +P      V+R  +PWH+    +K++ ++  +  +  + KL   +  ++  LR +   ++     PL  ++  E+ +++ ++    L   W+  C ++ V+  +      P++  +  R +E +F  VA+  S  LR +V  S+ + V F   ++D   ++  Y   D F       +  ++ I L        P+I F P+FD     I +   +II N  G                VS   R+ +VL ++    P L     IL  +N EE ++S+  ++  +  K N   P KY  +Y  +  LL+   E    +F+    ++ D+   +  +K   +E AS+   +P+ +F LD   +N  L +R++ L+   + +  + +R  N SIC QY +I  ++++    T++LV L EY++K     +  L+ +L  A+  + FL++Y  LP++ I               + +SS   L  +R++A   L K   +F   L G   +++ F +R  +   +   N ++L  +++ L+  + E + IN+EE LL     + +  LQ ++  K P+++LW +A  F    ++WMNGP+  ++AE++  E  ++W+T Y+LTK     +   P R A  +K K+EKFK ++PI+   CNPG+K RHW  +S+ VG++I P   T L++ML  G  K ++ L  + + ASKE+SLEK   +M+ DW  + FSF  Y++T  +ILC VDDIQ++L+DH++KT TM  S FI P E+E   W++ L R+++ L++WLK Q  WLYLEPIF S DI  Q+P EG +F  VD  W+++M +  ND++VM       + E LQ +  LLE IQ+GLNDYLEKKRL+FPRFFFLSN+ELLEILSETKDPLRVQPHLKKCFEGI+KL+FT+   I GM+S+E E V F   I+P++A+G+VEKW+ QVE  M  S+R+V++  +  Y Q+ R  WV +WPGQVV+  S++ WT + + A+   TL +FLKK++ QI+ IVELVR + L S  R+TL A  V+DVHARDVVAKL    ++S +DF WISQ+RYYW        +  N+ ++M+TTE  YGYEYLGN+ RLVITPLTDRCYRTLMGA+KLNLGGAPEGPAGTGKTET+KDLAKA+AKQCVVFNCSDGLDYK+MGKFFKGLAQ+GAWACFDEFNRIE+EVLSV+AQQI +IQ+AI  +L+ F+FEGTEL L+ +C +FITMNPGYAGR+ELPDNLK LFRTVAMMVPDYALI EISLYSMGF+++R+LA KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     E  ++L++++DVNL KFL  D+PLF GIISDLFPGV  P  DY+     L   +R MKL+PVPWF+ KIIQIYEM+LVRHG MIVG    GKT A+K L+ ALGDL+    +E  +V F IINPKAI++G LYG FD VSHEW+DG+LA  FRE ASS +D+RKWIIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM++K ++IFEP DLEQASPATVSRCGMIYME  QLG  PL   ++   LP  L  E    V+ +F WL+ P LDF    CK  V+   + L  +M++LYSSLLD++R++ ++  +                    ++++   L      +L   F  SL+W+  G I  +  K     F   +  M D    + PRPK++K  +N + P++G+I+D  F+K+  G W  W   I K + + +    ++ +++IPT++T RQ FFL   L +   PI+FVG TGTGKSA+   F+L  LP   +  + + FSA+TS++Q QD   SKLDRRR+GL+ PP  K  VVF+DD++MP KE YGAQPP+E+LRQ IDH +WFD+KD   L I DVL+ +AM  P   R  +T R  RH NII+I+ F+DE +  IF  I DWHF  GF++   R  K++V AT  I+++ + +FLPTP+KSHYVFNLRDFSRVIQG LL     L++L       K IRLW+HE YRVF+DRLI ++D   FF L+K+     FK+    +    S   K  T+  +R L FGD+LK + D                K+Y+EI D   L   M++YLDE+N +SKAPM LV+F+FAIEHI+RICR+L+Q  GH LLVGIGGSGRQSA KL+TF+  +E++QIE+T+ Y+ SDWR+D+++++  +G     T FLF D+QIK   F+EDINMLLN+GD+PN+F  +++ +++EKMQ   + +  ++E T ++MYN FIER     +  L  SPIGDAF +RLR FPSLINCCTI+WFQ WP DAL++VANK L++VE+  ++R ++V MC++F +SV  LS  +Y  + R NYVTPTSYLELI TF  LLN K+ E+ T + RY  GL+KLEF+ +Q+++MQVEL A QPQLI+TS++T  ++  IE ET E +  + +V+ +E      A  +++IK++CE +LAEAMP + AA+ ALDTL  +DI++VK+MQNPP  VKLVME++C++KGLKPE+K DPSG  K++EDYW  ++K+LGDLKFL+ LK+YDKD IP   M++IR ++I++P F P  IKN+SSACEGLC WVRA+EVYDR+ KVV+PK+E+L  AE   + QM +L  K+ EL  VE +L  L + F+   ++K  LE NIE+   K+ RAEKLI+GLGGEK RW +    L IR+DN+ GDVLL +G VAYLG FT+ YR +C   W   CK   IP      FSLS+ LGDP+++R WQI GLPVDSFSVDN +IV+++ RW L+IDPQGQANKW+K +E + NKL VIK SD  Y+R LEN LQFGTP LLENVGEELD+ +E +LLK TFKQ  VEY+RLG++++EYS++F+FYITTRLRNPHYLPE +VKV L+NFMITP GL+DQ+LGIV AKEKPELE+++ +LI+ESA N++QLKEIED+IL++LS  +GNILEDE AI+ILSSSKVLSE+IS KQE A+ TE +I+  R GYKPVA H + +FF ISDLA ++PMYQYSL+WFINLY+ S+ NS  S ++++R++ +  HFT ++Y N+CRSLFEKDKLLFS LL +G+ K +  +DE VW FLLTGG++LD+P  NP P+WLSEKSW E+   S+L+  KG ++D + NI+ WK I DS  PH E  P  W   L  LE++ ++RCL P+K++PA+ ++I   +G  ++E P FDL+ S+ +S    P+IF+LSPG DPM+ L +FA+  ++  T  + +SLGQGQGPIA + I +++    W++LQNCHLATSW+P L KICEE+++ ++  N  FRLWLTSYPS  FPV++LQN +KMTNEPPKGLRANLLRSY   PISD  FF++  +P +++KLLF LCFFHA+VQERRNYG++GWNIPYEFN+SDL+IS+RQ+QMF+NDYE+V  EALTYLTGECNYGGRVTD++DRRL++SLL   Y KE + ++ + +     Y++P   S   SY+ +++  P  A PEVFGLH NA++ K+ QETNQLF+ +L+TLP++  G  KS Q ++E+LA DILSKLP  F +EE+  KYPV+Y+E MNTVL QELIRFN+L +V+R+SL+DL  A++G +LM + LEEV+ SM++GKVP++W+  SYPSLKPLG Y++DL+AR+ FFQ WID G P  FW+SGFYFTQSFLTGV QNYAR+    ID + F+F +   E    + P D GA+I GL+LE  RW      + ES  K+LYD LP+I + P   +    ++ Y CPVYKT+ARRG+LSTTGHSTNYV +I LP+    +HWINRG+A+LCQL++
Sbjct:  254 EKESDYYYSLMKSIVDYILMDPMEKKRLFIKSIPRLFPHRVIRAPVPWHNIYQSTKKWNEEHLHTVNPMMYKLKELWFAEFQNLRFVRTADLLAGKLPLLPHEYKEVVQKHCREARHILLTKWIPTCAQLFVTQKEHWVHFAPKNDYDSSRNIEEYFASVASFMSLQLRDLVIKSLRDLVSFFMIHKDGNDFKEPYQEMDFF-------IPQLIMIKLEV----RDPIIVFNPTFDDCWQLIKNSFLEIIKNSDGIPKVYLCWKPLASYICVSPHLRMTSVLQVESILFPDLKGYNMILGTVNPEESLVSDFLDQTLEVFKKNQVGPYKYLNVYKKYDDLLDNMAEKGISEFLKEKHEIEDFVTSINSIKKRKNEIASMHITVPLAMFCLDAVFLNYDLCERAQNLKDNLILYQVDVNRETNTSICNQYSTIADKVSEIPANTAELVALIEYLKKSSDVTVFKLRRQLRDASERLEFLMDYADLPSESIE-------------DVFESSRNLLMSKRDQAEMDLIKRCSEFESRLEGYSKELEMFRKREVMTTEEMKNNVEKLHDLSKNLDLALTEFELINKEEELLEKEKSS-FPLLQTLMINKIPYEQLWVTAYEFSTKSEEWMNGPLYLMNAEQIAEEIGNMWRTTYKLTKTLI--DVPAPKRLAENVKLKIEKFKQHIPILNIACNPGMKDRHWQQISDIVGYEIKPTETTCLANMLEYGFGKFVDKLEPIGAAASKEYSLEKNLEKMKADWVNMCFSFVKYRDTDTSILCAVDDIQLILDDHVIKTQTMCGSVFIKPIEAECRKWEEKLVRVQENLDAWLKCQVTWLYLEPIFSSEDIIAQMPEEGKKFTTVDTYWKSLMAQAVNDTRVMVAADQPRMTEKLQEANVLLEDIQRGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTDNLEIKGMISSEKETVPFIQTIYPVKAKGMVEKWLQQVEQVMLASMRQVIENGIEAYVQVPRNAWVLEWPGQVVICVSSIFWTREVSEALVEDTLTDFLKKSNDQIAQIVELVRGK-LSSGARLTLGALTVIDVHARDVVAKLRHDHINSLNDFQWISQLRYYW--------TEKNVHVQMITTEALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRKLKRFIFEGTELSLNPTCAVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYEVFLEALNNNIRKMKLQPVPWFIGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLAAALGDLHAANQMEEFAVEFKIINPKAITMGQLYGCFDAVSHEWTDGVLANAFREQASSITDDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSSKMSLIFEPADLEQASPATVSRCGMIYMEAHQLGWKPLKDSYMDT-LPRCLTKEHTELVEDMFTWLVQPCLDFSRLHCKFVVQTSPIHLAFSMMRLYSSLLDEIRDIQEEEMEIY----------------EGLSSQQIFL------WLQGLFLFSLVWTLAGTINAESRKKFDVFFRNLIMGMDD----RNPRPKSVKLTKNNIFPERGSIYDFYFLKQGGGHWNAWTEYITKEE-ETIPANAKVSDLIIPTMETARQSFFLKTYLDH-EIPILFVGPTGTGKSAITNDFLL-HLPKNVYQPNFINFSARTSANQTQDIIMSKLDRRRKGLFGPPIGKKAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGYWFDKKDTNRLDIVDVLLVTAMGPPGGGRNDITGRFTRHLNIISINAFEDEILTKIFSSIADWHFGKGFDVMFLRYGKMLVQATQTIYRAAVENFLPTPSKSHYVFNLRDFSRVIQGVLLCPHTHLQDL------EKFIRLWIHEVYRVFYDRLIDNDDRQTFFNLVKETTSNCFKQTMEKVLIHLSPTGKI-TDDNIRSLFFGDYLKPESDQ---------------KIYDEIIDLRGLTVVMEYYLDEFNSVSKAPMSLVMFKFAIEHISRICRVLKQKKGHLLLVGIGGSGRQSATKLSTFMNSYELYQIEITKNYTNSDWREDLKKIMLQSGVATKSTVFLFSDNQIKHESFVEDINMLLNTGDVPNIFPADEKADLVEKMQTAARTEGEKVEATPLSMYNFFIERGTNRAYFSLAMSPIGDAFRTRLRMFPSLINCCTIDWFQSWPTDALELVANKFLEDVELDDNIRAEVVSMCKYFQESVKKLSVDYYNTLLRHNYVTPTSYLELILTFKTLLNSKRQEVDTIRNRYLAGLQKLEFASSQVAVMQVELTALQPQLIQTSEDTAMMMVKIELETKEADAKKLLVQADEKEANAAAAISQAIKNECEGDLAEAMPALEAALAALDTLNPSDITLVKSMQNPPGPVKLVMESICVMKGLKPERKPDPSGSGKMIEDYWGVSRKILGDLKFLESLKTYDKDNIPSVIMKRIRERFIDHPDFQPAVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLREAEGKLEIQMQKLNQKRAELKLVEDRLQDLNDEFELMNRKKNSLEKNIEICSQKLVRAEKLISGLGGEKDRWTEAARQLGIRYDNLTGDVLLASGTVAYLGAFTVDYRAQCQNEWLVSCKDKVIP--GSVDFSLSNTLGDPIKIRAWQIAGLPVDSFSVDNGIIVSNSRRWPLMIDPQGQANKWVKNME-KTNKLSVIKFSDTNYVRTLENALQFGTPVLLENVGEELDAFIEPILLKATFKQQGVEYMRLGENIIEYSREFKFYITTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNKLILESAQNKKQLKEIEDKILEVLSLCEGNILEDETAIKILSSSKVLSEEISEKQEIASVTETQIDETRMGYKPVAVHSAAIFFCISDLAHIEPMYQYSLTWFINLYVQSLANSNKSDELDLRIEYIIEHFTLSIYNNVCRSLFEKDKLLFSLLLTVGLLKERKAIDEEVWYFLLTGGVALDNPFPNPAPEWLSEKSWGEIVRASSLQKLKGLMEDVMQNIKVWKDIYDSAWPHEESLPSPW-FFLQTLEKIAILRCLRPDKIVPAIQNFICETMGKIFIEAPTFDLQGSYGDSSCCVPLIFILSPGADPMAGLLKFADDVSMGGTKTQTISLGQGQGPIAANMINKAIHEGTWVVLQNCHLATSWMPALEKICEEVIVPEN-TNSEFRLWLTSYPSEKFPVSILQNGIKMTNEPPKGLRANLLRSYLNDPISDPLFFQSCTKPVIWQKLLFGLCFFHAIVQERRNYGALGWNIPYEFNESDLRISMRQIQMFLNDYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLSLLSMFYCKE-IETDNYHIAPGDAYVIPPYGS-YQSYIEYLRTLPITAHPEVFGLHENADITKDNQETNQLFQGVLLTLPRQSGGSGKSPQEVVEELAQDILSKLPNDFNLEEVMKKYPVVYKESMNTVLRQELIRFNRLTKVVRRSLIDLGRAIKGQVLMSSELEEVFNSMLVGKVPAMWAAKSYPSLKPLGGYVADLLARLTFFQEWIDKGPPVVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFEFEVTPKETTMENIPED-GAYIKGLFLEGARWDRSTSQIGESLPKILYDPLPIIWLKPGESASFLHQDIYVCPVYKTSARRGILSTTGHSTNYVLSIELPTDMPQKHWINRGVASLCQLDN 4083          
BLAST of dynein heavy chain 3, axonemal vs. UniProt/SwissProt
Match: sp|Q8TD57|DYH3_HUMAN (Dynein heavy chain 3, axonemal OS=Homo sapiens OX=9606 GN=DNAH3 PE=2 SV=1)

HSP 1 Score: 3705.22 bits (9607), Expect = 0.000e+0
Identity = 1986/3952 (50.25%), Postives = 2691/3952 (68.09%), Query Frame = 3
Query:  771 KFMASQNLTEKYPDVTNQFLIDTKQN-FQTSVKKAILDYILLNKLEQKRLGL-MMPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLI-SIENICESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLI-FVPSFDR----ICDQLCQIIDNIIG-----------SVSQFSRLENVLFIKVEGTPSLP-------------FILSMLNYEEFVISN--KEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLN--DAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIEN-SVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSF-GAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSG--KLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRI--MECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            K +++  LT  + +     L+  K+N +  S+ K+I+DYIL++ +E+KRL +  +P      V+R  +PWHS    +K++ ++  +  +  +++L   +  ++ +LR + + E +    PL   +  ++ +++  +  Q L N W+  C ++  S  +      P+S  +  R +E +F  VA+  S  LR +V  S+ + V     ++D   ++  Y          +  ++ I L      S P+I F PSFD     I D   +II N  G           S +  +     +     G PS+               +L  +N EE ++S+   +  + + K N   P KY  +Y  +  LL+ T E +   F+  +  + D+  ++  +K   +E AS+   +P+ +F LD   +N  L +R++ L+   +    + +R  N SIC QY  I  ++++    T +LV L E+++K     +  L+ +L  A+  + FL++Y  LP               +I  I D+S   L  +R++A   L K   +F   L G   +++ F +R  +   +   N ++L+++++ LN    E + IN+EE LL     T Y  LQ +L  K P+++LW +A  F    ++WMNGP+  ++AE++  E  ++W+T Y+L K  S  +   P R A  +K K++KFK  +PI+   CNPG+K RHW  +S  VG++I P   T LS+ML  G  K +E L  + + ASKE+SLEK   RM+ DW  + FSF  Y++T  NILC +DDIQ+LL+DH++KT TM  SPFI P E+E   W++ L R++D L++WLK QA WLYLEPIF S DI  Q+P EG +F IVD  W+++M++   D++++       + E LQ +  LLE IQKGLNDYLEKKRL+FPRFFFLSN+ELLEILSETKDPLRVQPHLKKCFEGI+KL+FT+   I GM+S+E E V F   I+P  A+G+VEKW+ QVE  M  S+REV+   +  Y ++ R  WV  WPGQVV+  S++ WT++ + A+  +TL +FLKK++ QI+ IV+LVR + L S  R+TL A  V+DVHARDVVAKL    VS  +DF WISQ+RYYW  +        ++ ++++TTE  YGYEYLGN+ RLVITPLTDRCYRTLMGA+KLNLGGAPEGPAGTGKTET+KDLAKA+AKQCVVFNCSDGLDYK+MGKFFKGLAQ+GAWACFDEFNRIE+EVLSV+AQQI +IQ+AI  +L+ F+FEGTEL L+ +C +FITMNPGYAGR+ELPDNLK LFRTVAMMVPDYALI EISLYSMGF+++R+LA KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     E  ++L++++DVNL KFL  D+PLF GIISDLFPGV  P  DY+   ++L + ++ MKL+PVPWF+ KIIQIYEM+LVRHG MIVG    GKT A+K L+ ALGDL+    +E  +V + IINPKAI++G LYG FD VSHEW DG+LA  FRE ASS SD+RKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQM +K ++IFEP DLEQASPATVSRCGMIYMEP QLG  PL   ++   LP  L  E +  V  +F WL+ P L+F    CK  V+   + L  +M++LYSSLLD++R V ++  +  +    +                          +L   F  SL+W+  G I     K     F   +  M D+    +PRPK++K  +N + P++G+I+D  F+K+  G W TW   I K + +++    ++  ++IPT++T RQ FFL   L +   P++FVG TGTGKSA+   F+L  LP   +L + + FSA+TS++Q QD   SKLDRRR+GL+ PP  K  VVF+DD++MP KE YGAQPP+E+LRQ IDH +WFD+KD T L I D+L+ +AM  P   R  +T R  RH NII+I+ F+D+ +  IF  I+DWHF  GF++   R  K++V AT  I++  + +FLPTP+KSHYVFNLRDFSRVIQG LL     L+++       K IRLW+HE YRVF+DRLI  ED  +FF ++K+     FK+    +    S   K   +  +R L FGD+ K + D                K+Y+EITD + L   M+ YL+E+N +SKAPM LV+FRFAIEHI+RICR+L+Q  GH LLVGIGGSGRQSAAKL+TF+  +E++QIE+T+ Y+ +DWR+D+++++   G     T FLF D+QIK+  F+EDINMLLN+GD+PN+F  +++ +I+EKMQ   + Q  ++E+T ++MYN FIERV   +   L  SPIGDAF +RLR FPSLINCCTI+WFQ WP DAL++VANK L++VE+  ++R ++V MC++F +SV  LS  +Y  + R NYVTPTSYLELI TF  LLN K+ E+   + RY  GL+KL+F+ +Q+++MQ EL A QPQLI TS+ET K++  IE ET E +  + +V+ +E    V A  A+ IK++CE +LAEAMP + AA+ ALDTL   DIS+VK+MQNPP  VKLVME++CI+KG+KPE+K DPSG  K++EDYW  +KK+LGDLKFL+ LK+YDKD IP   M++IR ++IN+P F P  IKN+SSACEGLC WVRA+EVYDR+ KVV+PK+E+L  AE     QM +L  K+ EL  V  +L  L ++F+    +K DLE NIE+   K+ RAEKLI+GLGGEK RW +    L IR+ N+ GDVLL +G VAYLG FT+ YR +C   W  ECK   IP    S FSLS  LGDP+++R WQI GLPVDSFS+DN +IV+++ RW+L+IDP GQANKWIK +E + NKL VIK SD  Y+R+LEN LQ GTP L+EN+GEELD+ +E +LLK TFKQ  VEY+RLG++++EYS+DF+ YITTRLRNPHYLPE +VKV L+NFMITP GL+DQ+LGIV AKEKPELE+++ QLI+ESA N++ LKEIED+IL++LS SKGNILEDE AI++LSSSKVLSE+IS KQ+ A+ TE +I+  R GYKPVA H + +FF ISDLA+++PMYQYSL+WFINLY+HS+ +S  S ++ +R+K +  HFT ++Y N+CRSLFEKDKLLFS LL IGI K + ++ E VW FLLTGGI+LD+P  NP P WLSEK+W E+   S L    G ++    N+ +WK I DS  PH E+ PG W+     LE++V++RCL P+K++PAV  +I   +G  Y+E P FDL+ S+ +S    P+IFVLSP  DPM+ L +FA+   +  T  + +SLGQGQGPIA   I  ++K   W++LQNCHLA SW+P L KICEE+++ +S  N  FRLWLTSYPS  FPV++LQN +KMTNEPPKGLRANLLRSY   PISD  FF++  +  +++K+LF LCFFHAVVQERRN+G +GWNIPYEFN+SDL+IS+ Q+QMF+NDY++V  +ALTYLTGECNYGGRVTD++DRRL++SLL   Y KE +  + + L    TY +P   S   SY+++++  P  A PEVFGLH NA++ K+ QETNQLFE +L+TLP++  G  KS Q ++E+LA DILSKLP+ F +EE+   YPV+YEE MNTVL QELIRFN+L +V+R+SL++L  A++G +LM + LEEV+ SM++GKVP++W+  SYPSLKPLG Y++DL+AR+ FFQ WID G P  FW+SGFYFTQSFLTGV QNYAR+    ID + F+F +   E    + P D GA+I GL+LE  RW  +   + ES  K+LYD LP+I + P   +    ++ Y CPVYKT+ARRG LSTTGHSTNYV +I LP+    +HWINRG+A+LCQL++
Sbjct:  260 KLISNTLLTSPFLEPLMVVLVQEKENDYYCSLMKSIVDYILMDPMERKRLFIESIPRLFPQRVIRAPVPWHSVYRSAKKWNEEHLHTVNPMMLRLKELWFAEFRDLRFVRTAEILAGKLPLQPQEFWDVIQKHCLEAHQTLLNKWIPTCAQLFTSRKEHWIHFAPKSNYDSSRNIEEYFASVASFMSLQLRELVIKSLEDLVSLFMIHKDGNDFKEPYQEMKFF----IPQLIMIKLEV----SEPIIVFNPSFDGCWELIRDSFLEIIKNSNGIPKLKYIPLKFSFTAAAADRQCVKAAEPGEPSMHAAATAMAELKGYNLLLGTVNAEEKLVSDFLIQTFKVFQK-NQVGPCKYLNVYKKYVDLLDNTAEQNIAAFLKENHDIDDFVTKINAIKKRRNEIASMNITVPLAMFCLDATALNHDLCERAQNLKDHLIQFQVDVNRDTNTSICNQYSHIADKVSEVPANTKELVSLIEFLKKSSAVTVFKLRRQLRDASERLEFLMDYADLPY--------------QIEDIFDNSRNLLLHKRDQAEMDLIKRCSEFELRLEGYHRELESFRKREVMTTEEMKHNVEKLNELSKNLNRAFAEFELINKEEELLEKEKST-YPLLQAMLKNKVPYEQLWSTAYEFSIKSEEWMNGPLFLLNAEQIAEEIGNMWRTTYKLIKTLS--DVPAPRRLAENVKIKIDKFKQYIPILSISCNPGMKDRHWQQISEIVGYEIKPTETTCLSNMLEFGFGKFVEKLEPIGAAASKEYSLEKNLDRMKLDWVNVTFSFVKYRDTDTNILCAIDDIQMLLDDHVIKTQTMCGSPFIKPIEAECRKWEEKLIRIQDNLDAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKSLMSQAVKDNRILVAADQPRMAEKLQEANFLLEDIQKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTDNLEIVGMISSEKETVPFIQKIYPANAKGMVEKWLQQVEQMMLASMREVIGLGIEAYVKVPRNHWVLQWPGQVVICVSSIFWTQEVSQALAENTLLDFLKKSNDQIAQIVQLVRGK-LSSGARLTLGALTVIDVHARDVVAKLSEDRVSDLNDFQWISQLRYYWVAK--------DVQVQIITTEALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRKLKTFIFEGTELSLNPTCAVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYEVFLKVLNDNIKKMKLQPVPWFIGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLAAALGDLHAANQMEEFAVEYKIINPKAITMGQLYGCFDQVSHEWMDGVLANAFREQASSLSDDRKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMNSKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLKDSYMDT-LPSSLTKEHKELVNDMFMWLVQPCLEFGRLHCKFVVQTSPIHLAFSMMRLYSSLLDEIRAVEEEEMELGEGLSSQQIFL----------------------WLQGLFLFSLVWTVAGTINADSRKKFDVFFRNLIMGMDDN----HPRPKSVKLTKNNIFPERGSIYDFYFIKQASGHWETWTQYITKEE-EKVPAGAKVSELIIPTMETARQSFFLKTYLDH-EIPMLFVGPTGTGKSAITNNFLL-HLPKNTYLPNCINFSARTSANQTQDIIMSKLDRRRKGLFGPPIGKKAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGYWFDKKDTTRLDIVDMLLVTAMGPPGGGRNDITGRFTRHLNIISINAFEDDILTKIFSSIVDWHFGKGFDVMFLRYGKMLVQATKTIYRDAVENFLPTPSKSHYVFNLRDFSRVIQGVLLCPHTHLQDV------EKCIRLWIHEVYRVFYDRLIDKEDRQVFFNMVKETTSNCFKQTIEKVLIHLSPTGKI-VDDNIRSLFFGDYFKPESDQ---------------KIYDEITDLKQLTVVMEHYLEEFNNISKAPMSLVMFRFAIEHISRICRVLKQDKGHLLLVGIGGSGRQSAAKLSTFMNAYELYQIEITKNYAGNDWREDLKKIILQVGVATKSTVFLFADNQIKDESFVEDINMLLNTGDVPNIFPADEKADIVEKMQTAARTQGEKVEVTPLSMYNFFIERVINKISFSLAMSPIGDAFRNRLRMFPSLINCCTIDWFQSWPTDALELVANKFLEDVELDDNIRVEVVSMCKYFQESVKKLSLDYYNKLRRHNYVTPTSYLELILTFKTLLNSKRQEVAMMRNRYLTGLQKLDFAASQVAVMQRELTALQPQLILTSEETAKMMVKIEAETREADGKKLLVQADEKEANVAAAIAQGIKNECEGDLAEAMPALEAALAALDTLNPADISLVKSMQNPPGPVKLVMESICIMKGMKPERKPDPSGSGKMIEDYWGVSKKILGDLKFLESLKTYDKDNIPPLTMKRIRERFINHPEFQPAVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLREAEGKLAAQMQKLNQKRAELKLVVDRLQALNDDFEEMNTKKKDLEENIEICSQKLVRAEKLISGLGGEKDRWTEAARQLGIRYTNLTGDVLLSSGTVAYLGAFTVDYRVQCQNQWLAECKDKVIP--GFSDFSLSHTLGDPIKIRAWQIAGLPVDSFSIDNGIIVSNSRRWALMIDPHGQANKWIKNME-KANKLAVIKFSDSNYMRMLENALQLGTPVLIENIGEELDASIEPILLKATFKQQGVEYMRLGENIIEYSRDFKLYITTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAKNKKHLKEIEDKILEVLSMSKGNILEDETAIKVLSSSKVLSEEISEKQKVASMTETQIDETRMGYKPVAVHSATIFFCISDLANIEPMYQYSLTWFINLYMHSLTHSTKSEELNLRIKYIIDHFTLSIYNNVCRSLFEKDKLLFSLLLTIGIMKQKKEITEEVWYFLLTGGIALDNPYPNPAPQWLSEKAWAEIVRASALPKLHGLMEHLEQNLGEWKLIYDSAWPHEEQLPGSWKFSQG-LEKMVILRCLRPDKMVPAVREFIAEHMGKLYIEAPTFDLQGSYNDSSCCAPLIFVLSPSADPMAGLLKFADDLGMGGTRTQTISLGQGQGPIAAKMINNAIKDGTWVVLQNCHLAASWMPTLEKICEEVIVPES-TNARFRLWLTSYPSEKFPVSILQNGIKMTNEPPKGLRANLLRSYLNDPISDPVFFQSCAKAVMWQKMLFGLCFFHAVVQERRNFGPLGWNIPYEFNESDLRISMWQIQMFLNDYKEVPFDALTYLTGECNYGGRVTDDKDRRLLLSLLSMFYCKE-IEEDYYSLAPGDTYYIPPHGS-YQSYIDYLRNLPITAHPEVFGLHENADITKDNQETNQLFEGVLLTLPRQSGGSGKSPQEVVEELAQDILSKLPRDFDLEEVMKLYPVVYEESMNTVLRQELIRFNRLTKVVRRSLINLGRAIKGQVLMSSELEEVFNSMLVGKVPAMWAAKSYPSLKPLGGYVADLLARLTFFQEWIDKGPPVVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFEFEVTPQETVMENNPED-GAYIKGLFLEGARWDRKTMQIGESLPKILYDPLPIIWLKPGESAMFLHQDIYVCPVYKTSARRGTLSTTGHSTNYVLSIELPTDMPQKHWINRGVASLCQLDN 4116          
BLAST of dynein heavy chain 3, axonemal vs. UniProt/SwissProt
Match: sp|Q8WXX0|DYH7_HUMAN (Dynein heavy chain 7, axonemal OS=Homo sapiens OX=9606 GN=DNAH7 PE=1 SV=2)

HSP 1 Score: 3403.61 bits (8824), Expect = 0.000e+0
Identity = 1835/3915 (46.87%), Postives = 2548/3915 (65.08%), Query Frame = 3
Query:  834 DTKQNFQTSVKKAILDYILLNKLEQ---KRLGLMMPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENI--CESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEA--ASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKS--HTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDL-NKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPR---------PKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTW-QSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEIT--LKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTE-MRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLF--ENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDP--SGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLN 12497
            + ++++  SV+K+I+D++L +  E+   K+   +  ++  + +L +  PW    L +  Y++      + T++ +L  +   + +LRL+ I+    C+   L L+    I  ++     + L   W  + + I      + +  +P    +   ++E FFNC A L +  L+ +   S+ +F + I Q  D V            A  +   I+R+ L+ D        F P      D    + D +I +VS   R+E  L+ K E + S P  L  +   E V ++KEK+++ +   S AP ++ ++Y  + +L+ +  E     F+  +        E+ K + L +E    S+ T + + +F + CE + + L+ R+  +    L  M    +  N  +C +++ I  +       T++L+E++ Y++K+   ++I L+ +L  +   + FL+ Y      D+ LNN+ F W  R+  I +     + ++ E+    L+   ++FVE L     Q +EF     L D     ++   +  KL+   ++ +Q N EE      + + Y Q ++I     P+ +L+++AV F   Y  W  GP  +V+ ++VEA+  + W+  Y+L K F    Y   M     +++K+E FK ++P+IQ +CNPGL+ RHW+AMS  VG+ + P  D+ +S  L M L+ +++    +S  ASKE+SLEKA  +M  +W  + F    Y+ETG  IL +VD+IQ+LL+DHI+KT TMR SPFI P+E ++  W+  L  L++ L+ WLKVQA WLYLEPIF S DI  Q+P EG +F  VD+ WR IM  V  D  V+ V+  D +LE L+ S  LLE I KGLN+YLEKKRL+FPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGI+K++FTE   IT M S+E E V+    I   +A G VEKW++++E  M +S+ +V   A   Y +  R  WV+DWPGQ VL  S + WT++   AI      LE++LK  ++QI  IV LVR + L    R+TL A +VLDVHARDV++ L+   +S + DF W+SQ+RYYW          ++L  +M+   + YGYEYLGN+ RLVITPLTDRCYRTL GA+ L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGL   GAWACFDEFNRI+LEVLSV+AQQI TIQR I    ++ +FEGTEL+LD +C +FITMNPGYAGRSELPDNLK LFRTVAMMVPDYA+IAEI LYS GFV AR L+ KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     EE ++L+SIIDVNLPKFL  D+PLF+GI SDLFPGV+ P  DY DL   + +   +M L+   +F +KI+Q+YEM++VRHG MIVG+ F GKT A++ L+ AL D+  K L  EN V   ++NPK++++G LYG+FD+VSHEWSDG+LA +FR  ASS + +RKW+IFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+ + N+IFEP DLE ASPATVSRCGMIYMEP  LG  PL+  W+   LP  +   Q+  +  LF+ ++P S++FI +  K         LV +++ L    +DD  +                          K+   N+    E  + L   F  SLIWS GA    D +LKF+   R   E+ +SP     R          +    A  +  P+KGTI+D+ F+ +  G W  W + L E P +    K    + I++PT+DT+R    L  +L   +KP +FVG TGTGKS  I  F+L+ L  + +    + FSAQT++ Q Q+   SKLD+RR+G++ PP  K +VVF+DD++MP +E YGAQPP+E+LRQ +DH  W+D KD + + + D+ I  AM  P   R  VT R +RHFNII I+EF D++M  IF  I+ WH    ++       L+  IV+ T  +++  M + LPTPAKSHY+FNLRDFSRVIQG      V L      ++   + RLWVHE  RV++DRL+ + D       I++++     E FH LF     DN      + +R LMF DF   K++                  Y EI D + L   ++ +L+EYN +SK PM+LVLFRFAIEHI+RI R+L+QP  H+LLVG+GGSGRQS  +LA  + D+ +FQ+E+++ Y  ++W +D++ ++R   +  ++  FLF D QIKE  FLED++ LLN+G+IPNLF  + +  +    +     + +  Q + + I ++N FI+  R  LH+VL  SPIGDAF +RLR FP+L+NCCTI+WFQ WPEDAL+ VA++ L+E+E+ +++R+  + MC+ FH S  DLSK F+  + R NYVTPTSYLELI TF  LL KK+ E++  K+RY VGLEKL+ + +Q++ MQ+EL+A  PQL   SKE ++++ +IE E+VEV K  K+VK +E     +A  +K+IKD+C+++LA A+P++ +A+ ALDTL   DI++VK+M++PP GVKLVMEA+CILKG+K +K  DP  SGK +ED+W  AK+LLGD++FL  L  YDKD IP AYM  IR  YI NP F P KI+N S+A EGLC WV A++ YD++ K+V+PKK KLA AE   +  M  L+ KQ  L EV+ KLA+LQ+  +  +Q+K DLEN ++L   K+ERAE+LI GLGGEK RW     +L   + N+ GD+L+ +G+VAYLG FT  YRQ   + W   CK   IP S + +      LG+ V +R W I GLP DSFS+DN +I+ +  RW L+IDPQ QANKWIK +E + N L VIKLS+  Y+R LENC+QFGTP LLENVGEELD +LE +LLKQTFKQ     IRLGD  +EY+ DFRFYITT+LRNPHYLPE SVKVTL+NFMITP G++DQ+LGIV A+E+P+LE+ +  LI++ A N+RQLKEIED+IL++LS+S+GNILEDE AI+ILSSSK L+ +IS KQE A +TE +I+  R GY+P+A H SILFF+++DLA+++PMYQYSL+WFINL+I SIENSE S  +  RL+ L  HFT ++Y N+CRSLFEKDKLLFSF L I +   +  +++  WRFLLTGGI LD+P  N +  WL +KSW+E+  L +L  FK   ++F+     WK + DS  PH E FP +WE++ +  +R+++IRCL P+KVIP +  +I+  LG  ++EPP FDL  +F +S+   P+IFVLSPG DPM+ L +FA+ +    + L  +SLGQGQGPIA   + +++K   W++LQNCHLATSW+P L K+CEE  L     +P+FR+WLTSYPS  FPV+VLQN VKMTNE PKGLRAN++RSY   PISD +FF + K+P+ F+KLL+ LCFFHA+VQERR +G +GWNIPYEFN++DL+IS++QL MF+N YE++  EAL Y+TGECNYGGRVTD+ DRR + S+L   ++ EL+ +  +    SG Y VP  + D  SY+ + K  P   APE+FG++ NA++ K+Q ET  LF++IL+T  +     +KSS  ++ ++ASDIL KLP  F IE    +YP  Y + MNTVL+QE+ RFNKL++ IR S V+++ A++GL +M   LEEV  S++  K+P +W   SYPSLKPLGSY++D +AR+KF Q W + G P  FW+SGF+FTQ+FLTG  QNYAR+    ID L FD+ +ME  EY  P ++G FIHGL+L+   W+ +   L ESH K+LYD +PV+ + P  ++ I    SY  P+YKT+ RRGVLSTTGHSTN+V  + LPS Q  +HWI RG+A LCQLN
Sbjct:  209 EMREDYLLSVRKSIVDFVLKDPREKGDDKKTDELPAHRAEMEILPK--PWRKSFLAASSYIRDHLNAMNPTMLAVLDLWHTNFKKLRLVDIKEFHNCQDA-LELSSFQNIIMRHMDSAKETLLKMWFPEVQNIYYQG--NKKKQLPTG--DSSAKLESFFNCAAALMTLQLQDLTLVSMQDFTDLIAQPPDSV-----------RAFEHPGFIMRLILDNDTIK-----FEPELSDYIDIFLNVYDVMIKAVSFVPRVETKLYSKWE-SKSKPTTLKPIILNEIVDAHKEKIKEVIMKESVAPTEHLRLYDKYDFLITRKAERDVDNFLAENHSYEKIIDEICKYQKLIEEIQYTSIKT-IRLGMFEMHCEELIRALVKRADIICGKLLAKMFRDHQEVNTRLCDEFERIAEKALSTPPNTAELMEMKAYIQKVEVTDMIELEQRLVDSKNCLAFLIEYVNFSPADMRLNNSVFQWYGRMGEIFEEHRKIIKEKIEQYQEGLKLRCERFVEELESYAKQSEEFYSFGDLQDVQRYLKKAQILNGKLDLAADKIEQFNAEEEAFG-WLPSVYPQRKKIQDGLNPYLRLYETAVEFSSNYRAWTEGPYHKVNPDQVEADIGNYWRGLYKLEKTFHDSPYALAM--TKKVRSKVEDFKQHIPLIQVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVSSFLDMNLEPYIDRFEGISEAASKEYSLEKAMEKMITEWDAVEFVIHSYRETGTFILASVDEIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFTAVDKTWRDIMRSVMQDKHVLTVVTIDRMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELIEIISTAKARGQVEKWLVELERVMINSIHKVTGDATFAYTKYERINWVRDWPGQTVLCVSQIFWTKEVQTAIPMGIKALEQYLKTCNRQIDDIVTLVRGK-LSMQNRVTLGALVVLDVHARDVLSSLVKKNISDDSDFEWLSQLRYYW--------QENHLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGADILMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIKDNCASMNLQMTAFFSEKILQVYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDSVSHEWSDGVLAVSFRAFASSVTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMLSWVN-LLPASVSVIQKEFIMGLFDRMVPVSVEFIRKHTKELSPTSDTNLVRSLMNLIDCFMDDFAD------------------------EVKLKERND---RETYSLLEGIFLFSLIWSVGASCTDDDRLKFNKILR---ELMESPISDRTRNTFKLQSGTEQTSSKALTVPFPEKGTIYDYQFVTEGIGKWEPWIKKLKEAPPIP---KDVMFNEIIVPTLDTIRYSA-LMELLTTHQKPSIFVGPTGTGKSVYITNFLLNQLNKEIYKPLLINFSAQTTAAQTQNIVMSKLDKRRKGVFGPPLGKRMVVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPPGGGRNPVTPRYMRHFNIITINEFSDKSMYTIFSRILTWHLEICYKFPDEFLDLTTQIVNGTMTLYKEAMKNLLPTPAKSHYLFNLRDFSRVIQG------VCLSRPETTETTEVIKRLWVHEVLRVYYDRLLDNTDRSWLINYIQEILRNYMYEDFHELFQRLDFDNDGMVEADDLRSLMFCDFHDPKREDTN---------------YREIADVDNLRMIVEIHLEEYNNISKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSVFQVEISKGYDTTEWHEDLKVILRKCAEGEMQGVFLFTDTQIKEESFLEDVSNLLNAGEIPNLFALDEKQEICDKMRQLDRQRDKTKQTDGSPIALFNMFIDHCRSQLHVVLAMSPIGDAFRNRLRKFPALVNCCTIDWFQSWPEDALQAVASRFLEEIEMSEEIRDGCIDMCKSFHTSTIDLSKSFFVELQRYNYVTPTSYLELISTFKLLLEKKRSEVMKMKKRYEVGLEKLDSASSQVATMQMELEALHPQLKVASKEVDEMMIMIEKESVEVAKTEKIVKADETIANEQAMASKAIKDECDADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDMRFLQSLHEYDKDNIPPAYMNIIRKNYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGELKIAMDGLRKKQAALKEVQDKLARLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSHTALELGQLYINLTGDILISSGVVAYLGAFTSTYRQNQTKEWTTLCKGRDIPCSDDCSLMG--TLGEAVTIRTWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQSQANKWIKNME-KANSLYVIKLSEPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVAQERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALANEISQKQEVAEETEKKIDTTRMGYRPIAIHSSILFFSLADLANIEPMYQYSLTWFINLFILSIENSEKSEILAKRLQILKDHFTYSLYVNVCRSLFEKDKLLFSFCLTINLLLHERAINKAEWRFLLTGGIGLDNPYAN-LCTWLPQKSWDEICRLDDLPAFKTIRREFMRLKDGWKKVYDSLEPHHEVFPEEWEDKANEFQRMLIIRCLRPDKVIPMLQEFIINRLGRAFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMAALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKEGTWVVLQNCHLATSWMPTLEKVCEE--LSPESTHPDFRMWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLNQYEELPYEALRYMTGECNYGGRVTDDWDRRTLRSILNKFFNPELVENSDYKFDSSGIYFVP-PSGDHKSYIEYTKTLPLTPAPEIFGMNANADITKDQSETQLLFDNILLTQSRSAGAGAKSSDEVVNEVASDILGKLPNNFDIEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLKTIRDSCVNIQKAIKGLAVMSTDLEEVVSSILNVKIPEMWMGKSYPSLKPLGSYVNDFLARLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKYTIPIDLLGFDYEVMEDKEYKHPPEDGVFIHGLFLDGASWNRKIKKLAESHPKILYDTVPVMWLKPCKRADIPKRPSYVAPLYKTSERRGVLSTTGHSTNFVIAMTLPSDQPKEHWIGRGVALLCQLN 4023          
BLAST of dynein heavy chain 3, axonemal vs. UniProt/SwissProt
Match: sp|Q63170|DYH7_RAT (Dynein heavy chain 7, axonemal OS=Rattus norvegicus OX=10116 GN=Dnah7 PE=2 SV=2)

HSP 1 Score: 3397.06 bits (8807), Expect = 0.000e+0
Identity = 1825/3919 (46.57%), Postives = 2552/3919 (65.12%), Query Frame = 3
Query:  834 DTKQNFQTSVKKAILDYILLNKLEQK---RLGLMMPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENIC-ESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAA-SLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAAT--IKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAI--KSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDL-NKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNF--LIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPK-------NLKCARNLMV--PKKGTIFDHIFMKKQFGCWTTW-QSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSL--TFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEIT--LKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPT-NTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLF--ENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDP--SGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLN 12497
            + ++++  SVKK+I+D++L +  E++   ++  + P++  + VL +  PW    L +  Y++      + T++ +L  +   + +LRL+ IE        L L+    I  ++ +   + L  +W  + + I      + +  +P    +   ++E FFNC ATL +  L+ ++  S+ +F + I Q  + +            A  +   I+R+ L+          F P F    D L  + + +I +VS   R+E  L+ K E + S P  L  +  +E + ++KEK+R+ V   S AP ++ ++Y  +++L+ +  E    +F+   +       E+ K + L +E   +    + + +F + CE + + L+ R+  +    +  M    +  N  +C +++ I  +       T++L+E++ +++K+ T +++ L  +L  +   + FL+        DI LNN+ F W  R+  I D     +  + E+    L+   ++FVE L     Q +EF     L D     ++   +  KL+   ++ +Q N EE      + + Y Q ++I     P+ +L+++AV F   +  W  GP  +V+ ++VEA+  + W+  Y+L K F    +  P   A T  ++A++E FK  +P++Q +CNPGL+ RHW+AMS  VG+ + P  D+ +   + M L+  L+    +S  ASKE+SLEK+  +M  +W+ + F   PY+E+G  IL  VDDIQ+LL+DHI+KT TMR SPFI P+E ++  W+  L  L++ L+ WLKVQA WLYLEPIF S DI  Q+P EG +F  VD+ WR +M  V  +  V+ V+  + +LE ++ S  LLE I KGLN+YLEKKRL+FPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGI++++FTE   IT M S+E E V+    I   +A G VEKW++++E  M  S+ +V+  A+T Y + +R  WV+DWPGQ VL  S   WT +   AI      LE++L K + QI  IV LVR + L    R+TL A +VLDVHARDV+A L+   +S + DF W+SQ+RYYW          +NL  +M+   + YGYEYLGN+ R+V+ P  D C+ TL GA+ L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGL   GAWACFDEFNRI+LEVLSV+AQQI TIQ  I    E+ +FEGTEL+LD +C +FITMNPGYAGRSELPDNLK LFRTVAMMVPDYA+IAEI LYS GFV AR L+ KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     EE ++L+SIIDVNLPKFL  D+PLF+GI SDLFPGV+ P  DY DL   + E   +M L+   +F +KI+QIYEM++VRHG MIVG+ F GKT A++ L+ ALGD+  K L  EN V   ++NPK++++G LYG+FD VSHEWSDGILA +FR  A+S + +RKW+IFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+ + N+IFEP DLE ASPATVSRCGMIYMEP  LG  PL+  WI   LP+ +   Q+  ++ LF+ ++P S++FI R  K         LV +++ L    +DD  +  K+ +                             + +R NF  L   F  SLIWS GA    D ++K++   R   E+ + P     R K           ++ L V  P+KGTI+D+ F+ +  G W  W + L + P +    K  + + I++PT+DTVR    ++ +L   +KP +FVG TGTGKS  I  F+L+ L NKD ++  L   FSAQT++ Q Q+   SKLD+RR+G++ PP  K ++VF+DD++MP +E YGAQPP+E+LRQ +DH  W+D KD + + + D+ I  AM  P   R  +T R +RHFNII I+EF D++M  IF  I+ WH  + ++       L+  IV+ T  +++  M + LPTPAKSHY+FNLRDFSRVIQG  L +    +N         + RLWVHE  RV++DRL+ + D       I++++    +E FH LF +   DN       ++R LMF DF   K+               E   Y EI + +AL   ++ +LDEYN MSK PM+LVLFRFAIEHI+RI R+L+QP  H+LLVG+GGSGRQS  +LA  + D+ +FQ+E+++ Y   +W +D++ ++R   +  ++  FLF D QIK   FLED+N LLN+G++PNLF  + +  +    +     + +  Q + + I ++N FI+R R  LH+VL  SPIGDAF  RLR FP+L+NCCTI+WFQ WPEDAL+ VA++ L+++E+ +++RE  + MC+ FH S  +LS  F+  + R NYVTPTSYLELI TF  LL KK+ E++  K RY VGL+KL+ + +Q++ MQ EL+A  PQL   S++ + ++ +IE E++EV K  K+VK +E     +A  AK+IKD+C+++LAEA+P++ +A+ ALDTL   DI++VK+M++PP GVKLVMEA+CILKG+K +K  DP  SGK +ED+W  AK+LLGD++FL  L  YDKD IP AYM  IR  YI NP F P KI+N S+A EGLC WV A++ YD++ K+V+PKK KLA AE   +  M  L+ KQ  L EV+ KLAKLQ+  +  +Q+K DLEN ++L   K+ERAE+LI GLGGEK RW     +L   + N+ GD+L+ +G+VAYLG FT  YRQ   + W + CK   IP      +SL   LG+ V +R W I GLP D FS+DN +I+ +  RW L+IDPQGQANKWIK +E + N L++IKLSD  Y+R LENC+QFGTP LLENVGEELD +LE +LLKQTFKQ     IRLGD  +EY+ DFRFYITT+LRNPHYLPE SVKVTL+NFMITP G++DQ+LGIV A+E+P+LE+ +  LI++ A N+RQLKEIED+IL++LS+S+GNILEDE AI+ILSSSK L+ +IS KQE A +TE +I+  R GY+P+A H SILFF+I+DLA+++PMYQYSL+WFINL+I SIENSE S  +  RL  L  HFT ++Y NICRSLFEKDK+LFSF L + +   +N +++  WRFLLTGGI LD+P  NP   WL +KSW+E+  L  L  FK   ++F+   + WK + DS  PH E FP +WE + +  +R+++IRCL P+KVIP +  +I+  LG  ++EPP FDL  +F +S+   P+IFVLSPG DPM+ L +FA+ +    + L  +SLGQGQGPIA   + +++K   W++LQNCHLATSW+P L K+CEE  L     +P+FR+WLTSYPS  FPV+VLQN VKMTNE PKGLRAN++RSY   PISD +FF + ++P+ F+KLL+ LCFFHA+VQERR +G +GWNIPYEFN++DL+IS++QL MF+N YE++  +AL Y+TGECNYGGRVTD+ DRR + S+L   +  EL+ +  +    SG Y VP  + D  SY+ + K  P    PE+FG++ NA++ K+Q ET  LF++IL+T  +     +KSS  ++ ++A DIL KLP  F IE    +YP  Y + MNTVL+QE+ RFNKL+  IR+S ++++ A++GL++M   LEEV  S++  K+P +W   SYPSLKPLGSY++D +AR+KF Q W + G P  FW+SGF+FTQ+FLTG  QNYAR+    ID L FD+ +M+  EY    ++G +IHGL+L+   W+ +   L ESH KVLYD +PV+ + P  KS I    SY  P+YKT+ RRG LSTTGHSTN+V  + LPS Q  +HWI RG+A LCQLN
Sbjct:  242 EMREDYLLSVKKSIVDFVLKDPREKEDDTKITELPPHRAEMEVLPK--PWRRSFLSACSYIRDHLNAMNPTMLAVLDLWHSTFKKLRLVDIEEFHNRQDALELSGFQNIVIKHMESAKETLLKTWFPEVQNIYYQG--NKKKQLPTG--DSSAKLESFFNCAATLMTLQLQDLILVSMQDFTDLIAQPPESI-----------RAFEHPGFIMRLVLDKKAVK-----FEPEFTDYIDILVNVYEIMIKAVSFVPRVETKLYSKWE-SKSKPTTLKPIILDEIIDAHKEKIREVVLRESVAPTEHLKMYDKYQFLITRQAEQDIEEFLTQSQNYERLIEEIRKYQKLGEEIQYTSRKTVRLGMFEMHCEELIRSLVKRADIICGKLIAKMFRDHQEVNTMLCEEFEKIAEKALSTPPNTAELMEMKAHIQKVETTDMLDLGQRLVDSKNCLAFLIECVNFSPADIRLNNSVFQWYGRMGEIFDEHRKIIKDKTEQYQEGLKLRCERFVEELESYAKQAEEFYTFGDLQDVQRYLKKAQVLNSKLDAAADKIEQFNAEEEAFG-WIPSVYPQRKKIQDGLNPYLRLYETAVEFSTKHRAWTEGPYHKVNPDQVEADVGNYWRGLYKLEKAF----HDSPNALAMTKKVRARVEDFKQYIPLVQVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVFSFIDMNLEPFLDRFEGISEAASKEYSLEKSMDKMMTEWEAMEFVIHPYRESGTFILSAVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFTAVDKTWRDVMKMVVQNKHVLAVVTIERMLERMKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIARVEFTETLDITHMKSSEGEVVELVDTISTTKARGQVEKWLVELERIMIKSIHKVIGDAITAYTKNARINWVRDWPGQTVLCVSQTFWTVEVQVAIPMGHKALEDYLGKCNHQIDDIVTLVRGK-LSKQNRVTLGALVVLDVHARDVLANLVKKRISDDTDFEWLSQLRYYW--------HENNLETKMINAGLRYGYEYLGNSPRMVLAPFCDYCFLTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQIGINSGTELLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIRENCHSMNLQMTNFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALGDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLVSHEWSDGILAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPQMLGWRPLMVSWINT-LPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTKELSPTSDTNLVRSLMNLIDCFMDDFADENKQKE-----------------------------RNDRENFSLLEGIFLFSLIWSVGASCTADDRIKYNKILR---ELMEGPISDLTRNKFKLLSGTEQTSSKALTVPFPEKGTIYDYQFIPEGLGRWDQWIKKLADTPPIP---KDVQFNEIIVPTLDTVRYSALMS-LLTTHQKPSIFVGPTGTGKSVYIINFLLNQL-NKD-IYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIITINEFSDKSMFTIFSRILTWHLRTCYKFPDDFLDLTTQIVNGTMTLYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAEN------KEAIKRLWVHEVLRVYYDRLLDNADRSWLVNYIQEILRNYMQEDFHDLFKNLDFDNDGIVEEDDLRSLMFCDFHDPKR---------------EDFGYREIPNVDALRVIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAEGDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQLDRQRDKTKQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEEIREGCIDMCKSFHTSTINLSTTFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQGELEALHPQLKVASRQVDDMMIMIEKESIEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAEALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGELRIAMEGLRKKQAALREVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYVNLTGDILISSGVVAYLGAFTSNYRQHQTKEWSHSCKERDIPC--SDDYSLMGTLGEAVTIRAWNIAGLPSDLFSIDNGIIIMNARRWPLMIDPQGQANKWIKNME-KTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALANEISQKQEVAEETEKKIDNTRMGYRPIAVHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSQRLHILRDHFTYSLYVNICRSLFEKDKMLFSFCLTVNLLIHENAINKAEWRFLLTGGIGLDNPYTNPC-TWLPQKSWDEICRLDELHAFKTIRREFMRLKEGWKKVYDSMEPHHEIFPEEWENKANDFQRMLIIRCLRPDKVIPMLQEFIIKKLGRSFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEE--LSPESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCRKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLNQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFVP-PSGDHKSYIEYTKTLPLIPDPEIFGMNANADITKDQSETQLLFDNILLTQSRSSGSGAKSSDEVVNEVAGDILGKLPNNFDIESAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPGMWMGKSYPSLKPLGSYVNDFLARLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKFTIPIDLLGFDYEVMDDKEYKNAPEDGVYIHGLFLDGASWNRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPKRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVALLCQLN 4056          
BLAST of dynein heavy chain 3, axonemal vs. UniProt/SwissProt
Match: sp|E9Q8T7|DYH1_MOUSE (Dynein heavy chain 1, axonemal OS=Mus musculus OX=10090 GN=Dnah1 PE=1 SV=1)

HSP 1 Score: 2748.38 bits (7123), Expect = 0.000e+0
Identity = 1594/3942 (40.44%), Postives = 2351/3942 (59.64%), Query Frame = 3
Query:  882 YILLNKLEQKRLGLMMPNK--ISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSI--------ESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVC--YEGYYDLFSGMAVSNV------NSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLF--IKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTN-FRYLLNKTTEDHSHQFINADKQLLDYEAELE------KLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTI-LPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLE-EFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENSVI----FDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDV--RNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIF----------------MKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLI-IEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMD-WHFNSGFEITLKR----------LSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEV---EIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEK-KTDPSGKLMEDYWPTAKKLLGDL-KFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIM--ECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLN 12497
            Y+ L + E++++    PN+  +SVP    E P+  Q    KE        T   ++  LS    +  ++  +S+ +   S    L +  +I  Q   +   +L++SW+   +  +  S+  +        E+      M ++R   +    +  +  + LRF+V++S+  F +FI    D  C   E   D+  G  + N       N +  + L  D +  H    +  F+ I   L  + D  I +     +LE ++   I + G P    +L  +   E ++   E+LR  +       +   Q Y   +R  L     D S        Q    E   E      K K + D   SLP+ + +  F ++ + + Q L  + K L    L+ +         SIC ++ SI R++ ++  +  +L EL+++++ +   +L+ L+ ++ K       +  +   L TDD         W  +I+  +D       ++ E+        Q  F E L GL+  +  F+   ++  A E   E+ ++ ++L +C +     N  E +    + T Y +L  ++   +P+  LW +A  + +  + WMN P+  +DAE++E      +KT ++  K F   +       A  I+ ++E+FK  +P+IQ L NPG++ RHW+ +SN++  ++ P+ +   +  L M L  H+E + +V+  A KE+++E+A  +M+ +W  I+F+  PYKET   IL + D+   LL+DHIV T +M  SP+  PFE  IN W+  L   ++ L  WL  Q AWLYLEPIF S DI RQ+P+E  +++ ++  WR IM     + +V+NV     LL+ L+    LL+ +QKGL++YLE KR  FPRF+FLS++ELLEILS+TKDP  VQPHL+KCFE I++L F E+  IT M SAE EEVK ++ I+P      VE W+L+VE +MK S+ ++++ A+  Y  + R +WV +WPGQV +A    +WT +   A+++  +  +   +  +Q+S +V LVR + L  + R+ L A IV++VHA+DVV+KL+   V S  DF WISQ+RYYW        + D+L IR V  E  YGYEYLGN+ RLVITPLTDRCY TL GA+ L  GGAP GPAGTGKTET+KDL KA+A Q VVFNCSD LD+ +MGKFFKGLA +GAWACFDEFNRI++EVLSV+AQQI TIQ+A + ++E F+FEG E+ L  SC +FITMNPGYAGR+ELPDNLK LFR VAMMVPDYA+IAEISLYS GF EA  LA KI   ++L SEQLSSQ HYD+GMRAVK+V++AAG LKR+   + EE + L++I DVN+PKFL  D+ LF GI+SDLFP +++   DY  L + +        L+ V  FL K IQ+YE  +VRHGLM+VG +  GK+  ++ L+ A+  L  + +I   V     + ++NPK+I++G LYG FD ++HEW+DGI +   R  A +    +KW +FDGPVDA+WIENMNTVLDDNKKLCL SGEII++T    M+FE +DL  ASPATVSRCGM+Y+EP  LG  P ++ W+++ LP  +   +    + LF   +  S++F+    K  +   +  L  ++L+L          R   KK                      K+++  E+++          F  SL+WS GA  D  S++ F                ++ R K       L  P+ G ++D+                    KQ   W  W   ++      ++  T   NI++PT+DTV+  + L  +L N  KP++ +G TGTGK+  +   +L  LP  +++ H LTFSA+TS++Q QD   SKLD+RR+G++ PP  +  + FIDD++MP  E YGAQPP+E+LRQ +DH  W+DRK       + D+    AM  P   R A+T RL RHFN ++  E D+ + K IF  I++ W      E + +           L++ +V AT +++  + +  LPTPAKSHY FNLRD S+V QG L+ +   +++  Q      L+RLW HE  RVF DRL++ ED   F EL++  +E     +F V F               + +++GDF+    D               +K Y  IT E  + Q ++ Y+++YN ++ A + LVLF  A+ HI RI R LRQ  G++LL+G+GGSGR S  +LA+ + ++E FQIE+++ Y +S+WR+D+++++   G + +  TFLF D QIK   FLEDIN +LNSGDIPN++  +++             Q   ++ T  N+   +  RVR N+H+VL  SPIG+ F +RLR FPSL+NCCTI+WF  WP +ALK VA   L E+   E  ++V + ++ +C   HQSV+    ++   + R NYVTP SYLEL+  F  L+ +K+ME+ T+K R   GL+KL  +   ++ MQ EL+  +P L E +K+T   ++ I+ +T   E+ RK V+ EE     KA  A++I DD + +L EA+P ++AA+ +L  L +ND++ V+AMQ PP GVKLV+EAVCI+KG+KP+K   +  G  ++DYW   K LL D  +FL+ L  +DKD I EA ++ I+  YI+N  F P  I  +S AC  +C WVRA+  Y  + K V PK++ L  A+   +     L+  +  L+EVE  +A +Q  ++    +K +LE   E  + ++ RA+KLI GL  EK RW + + +L    DN+ GDVL+ AG VAYLGPFT  YR    E W N+     +P    S  +L + LG+PV++R WQI GLP D+ SV+N VI   + RW+  IDPQGQANKWIK +E E + L+V KLSD+ +LR +EN ++FG PCLLENVGEELD  LE VLLKQT+KQ     ++LGD V+ Y +DFR YITT+L NPHY PE S K+TL+NF ++P+GLEDQ+LG V A+E+P+LE+ + QLI+ +A  R++LK+IEDQIL  LS+S+GN ++D + I++L +SK+ + +I  K   A +TE +I+  R  Y PVA    ILFF +SDLA++DPMYQYSL WF+N+++  I NSE + +++ R+ N+N + T ++Y N+CRSLFEK KL+F+FLLC+ I   + K+++  WR+LL+GG S+ +  +NP P WLS+++W ++  LSNL  F  +  DFVM + ++++I DS  PH E  PG W   L   ++L+++RCL  +KV  A+  ++   L   ++EP   +L   FKES+S TP+IFVLSPG DP +DLY+FAE    S      +SLGQGQGP AE+ +  S++   W+  QNCHLA SW+P L ++ E   +   +++ +FRLWLTS PS+ FPV++LQN  KMT EPP+G++ANLL+SY +  +SD DF  + ++   F+ LL SLC FH    ERR +G +G+NIPYEF D DL+I I QL+MF+++YED+  + L Y  GE NYGGRVTD+ DRR +M++L   Y+  +L SE    + SG Y     T DLN YL++IK  P N  PE+FGLH NA +   Q ET  LF +IL   PK  S   +S + ++ED+A +IL ++P   +++E+  K+PVLYEE MNTVL+QE+IR+NKL+EVI ++L D+  A++GL++M   LE +  S+    VP LW   +YPSLKPL S+I DL+ R+ F  +WI++G P  FW+SGF+F Q+FLTG LQN+AR+   +ID + FDF+++     E  +    G +IHGL+LE  RW   +  L ES  K LY  + VI +LP     +  ++ Y CP+YKT  R G LSTTGHSTNYV  + +PS+Q  +HWI RG+A +C L+
Sbjct:  452 YVTLPEKEEEKV----PNQGLVSVP----EYPFREQ----KEDFTFVSLLTRPEVITALSKVRAECNKVTSMSLFHSSLSKYSRLEEFEQIQSQTFSQVQMFLKDSWISTLKVAMRGSLRDMSKGWYNLYETNWEVYLMSKLR---KLMELIKYMLQDTLRFLVQDSLGSFTQFIG---DACCSVLECVDDMDWGEDLVNSPYKPRKNPLFIVDLVLDNSGVHYSTPLEHFEMI---LLNLFDKGILATHAVPQLEKLVMEDIFISGDP----LLESVGLHEPLV---EELRANITNAMHKAMMPLQAYAKEYRKYLELNNNDISTFLKTYQTQCPSAEEVREVVITHLKEKEILDN--SLPSSIIIGPFYINVDNVKQSLSKKRKALATSMLDILAKNLHKEVDSICEEFRSISRKIYEKPNSIEELAELRDWMKGI-PEKLVFLEERIVKVMSDYEVMDEFFYNLTTDDFNDKWAANNWPSKILGQIDMVRQQHVEDEEKFRKIQLMDQNNFQEKLEGLQLVVAGFSIHVEIARAHEIANEVRRVKKQLKDCQQLAMLYNNRERIFGLPI-TNYDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEKNVIESFKTMHKCVKQFK--DIPACQEVALDIRTRIEEFKPYIPLIQGLRNPGMRNRHWEVLSNEININVRPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSSILFNVLPYKETDTYILKSPDEASQLLDDHIVMTQSMSFSPYKKPFEQRINSWETKLKLTQEVLEEWLNCQRAWLYLEPIFSSEDITRQLPVESKRYQTMERIWRKIMKNAYENREVINVCSDQRLLDSLRDCNKLLDLVQKGLSEYLETKRTAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARLLFQEDLEITHMYSAEGEEVKLSFSIYP---SSNVEDWLLEVERSMKASVHDIIEMAIKAYPTMLRTEWVLNWPGQVTIAGCQTYWTMEVAEALEAGNISSKLFPQLSKQLSDLVALVRGK-LSRMQRMVLSALIVIEVHAKDVVSKLIDENVVSVHDFEWISQLRYYW--------TKDDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVERFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMIAEISLYSFGFNEANVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPTMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTIKEEETDYGILDQAIRRSCEKNNLKDVEGFLIKCIQLYETTVVRHGLMLVGPTGSGKSNCYRVLAAAMTLLKGKPSISGGVYEAVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFSSLIRAGAIASDTNKKWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFVECWLKR-LPAIIKPYEEQ-FKSLFTKYLENSINFVRNTVKEVIASTNSNLTMSLLKLLDCFFRPFLPREGLKK------------------IPSEKLSHIPELIE--------PWFIFSLVWSVGATGDHTSRISF---------------SQWLRLKMRLEQVKLGFPEDGLVYDYRLDDAGISSTEDDDEEEDENKQVS-WVKW---MDYSAPFTMMPDTNYCNIIVPTMDTVQMSYLLGMLLTN-HKPVLCIGPTGTGKTLTVSNKLLKYLP-LEYISHFLTFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKVIGAFKNLVDINFVCAMGPPGGGRNAITPRLTRHFNYLSFIEMDEVSKKRIFSIILECWMDGLLGEKSYREPVPGAPNIDDLTEPLVDATINVYGIITSQLLPTPAKSHYTFNLRDLSKVFQGMLMAEPSKVEDKVQ------LLRLWYHENCRVFRDRLVNEEDRSWFDELLEAQME-----EFGVAFNKVCP---------FQPILYGDFMSPGSD---------------VKSYELITSESKMMQVIEEYMEDYNQINTAKLRLVLFVDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWREDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNIYSADEQ--DQIINTMRPYIQEQGLQPTKANLMAAYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATTFLSEIPELECSEEVIQGLIQVCVFIHQSVASKCVEYLAELARHNYVTPKSYLELLNIFSILIGQKKMELKTAKNRMKSGLDKLLRTSEDVAKMQEELEIMRPLLEEAAKDTMLTMEQIKVDTAIAEETRKSVQAEEIKANEKANKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPGEKPGSKVDDYWEPGKGLLQDPGRFLESLFKFDKDNIGEAVIKAIQ-PYIDNEEFQPAAIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALREAQDDLEVTQRILEEAKHHLHEVEDGIATMQAKYRECVAKKEELEMKCEQCEQRLGRADKLINGLADEKVRWQETVENLENMLDNIFGDVLVAAGFVAYLGPFTGQYRTTLYEYWVNQLTVHHVP--HTSKPTLITTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQGQANKWIKNMERE-SGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNIVLKLGDTVIPYHEDFRMYITTKLPNPHYSPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIVSNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAVRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRIVNINRYLTFSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQAEWRYLLSGG-SIQTMFENPAPQWLSDRAWRDILALSNLPTFATFSNDFVMYLSEFQAIFDSAEPHRELLPGIWNAYLDEFQKLLILRCLRGDKVTNAMQDFVATHLEPRFIEPQTANLSAVFKESNSTTPLIFVLSPGTDPAADLYKFAEEMKFS-KKFSAISLGQGQGPRAEAMMRNSIERGKWVFFQNCHLAPSWMPALERLIEH--INPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVKANLLKSYNS--LSD-DFLHSCQKVVEFKSLLLSLCLFHGNALERRKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYEDIPYKVLKYTAGEINYGGRVTDDWDRRCVMNILEDFYNPAVLSSE-HSYSNSGIYHQIPPTYDLNGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALFNAILQLQPKSSSMGGQSREELVEDVAENILLQVPGPIELQEVTKKFPVLYEESMNTVLVQEVIRYNKLLEVITQTLSDMLKAIKGLVVMSLELELMSISLYNNTVPELWKSKAYPSLKPLASWIMDLLLRLDFMHSWINDGIPPVFWISGFFFPQAFLTGTLQNFARKFVISIDTITFDFKVLPEASSEIKERPQTGCYIHGLFLEGARWDSMNFQLAESRPKELYTEMAVIWLLPEANRKVQNQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPSNQPQRHWIKRGVALICALD 4249          
BLAST of dynein heavy chain 3, axonemal vs. TrEMBL
Match: A0A2R2MQX7 (dynein heavy chain 3, axonemal OS=Lingula unguis OX=7574 GN=LOC106174593 PE=4 SV=1)

HSP 1 Score: 4489.87 bits (11644), Expect = 0.000e+0
Identity = 2290/4005 (57.18%), Postives = 2984/4005 (74.51%), Query Frame = 3
Query:  585 HDDNTKLALSVPFTPWYRSTKGLXXXXXXXXXXXNRYQILMENSFNDXXXXXXXXXXXQNKIKFMAS--QNLTEKYPDVTNQFLIDTKQNFQTSVKKAILDYILLNKLEQKRLGLMMPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSN----VNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKS-HTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDL-NKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPE-FLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNE---------------NEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIK--------TTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIM-ECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            HD  +K  L V F P+Y  T GL R +SP  + ++RY  L+E +     +       +    K +    ++LTE       QF  + +++++T+V+K +LDYILL+  EQ+RLG+  P K S    R   PW     ++++++ +  Y TH  + ++L +F K Y + RLI +  + +  P+++  L    E   +  S  L+N W+ +C  I+    D +E+ MP S   R+ +M+ FFN  A+L SN+LR +V+ S+ + V+ ++QY D   YEG Y++ +G  +      +   L  H+  + T   PL+      ++     +II+ ++ SV    R+E+ LF  VE   +  ++ ++   EE V   K ++R  V  N   P  Y  +Y  ++YLL+K  +    +FI+ ++ L +Y  E+EKLK ++ E  S P ++PMHLF+LDC  INQWL+ R++ L  I + ++ N SR FNRSI TQY++I+RR+T Q+ETT +LV L +YVE+LR G+L+ L  KLE AA ++LFL++Y+ LP  D++LN+ TF+W  RI+P++ +S   L KE E A   L +W+K+F   L  +  ++K+F+Q++++++A     +L+ M + L E  +EK  IN+EE LL  G Q+PY+++Q+I +  EP++KLWK+AV F+   DKWMNGP+LEV+AE VE E Q+LW+TAYRLTK+FSHP   GP R A +IK KLEKFKIN+P+I ALCNPG+KQRHW+ M++KVGF ITP  +TPL +ML +GL+K L++L EVSS+ASKEF+LEKA  +M++DW+ + F F PYK+  ++IL  +DD++V L+DHIVKT+TM+ SPFIGPFE+E+N WD  L R+K  L+SWLKVQAAWLYLEPIFGSADIR QIP EG  FE VDE W TIM+    D+K + V   D +LE LQ SE++LE I KGLNDYLEKKRL+FPRFFFLSN+ELLEILSETKDPLRVQPHLKKCFEGI++L FT E VI GM SAE E V F   I P E  GLVEKW++QVE  MK SL++   KA+  Y++  R +WV  WPGQ+VLAA  VHWT +   +I +   + E+L K+++QI  +V LVR + L  + RITL A IV+DVHARDVVAKL   +VSS  DFNWISQ+RYYW          D ++++M+TT V Y YEYLGNT RLVITPLTDRCYRTLMGA+KLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYK+M KFFKGLAQSGAWACFDEFNRIELEVLSVIAQQ+Q+IQRAI + L+ F FEGTEL LD +CT+FITMNPGYAGR+ELPDNLKVLFRTVAMMVPDYA+I EISLYSMGF+ AR+LA KIVA Y LCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     E+ ++LKSIIDVNLPKFL  DIPLF+GIISDLFP V++P  DY DL   L+E ++ MK++P PWFL+KIIQIY+MILVRHGLMIVG    GKT AFKA+SM+L D+  K+L  E++V F IINPKAI++G LYGRFD +SHEWSDG+LA TFREHASS +++RKWIIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+NKQNMIFEP+DLEQASPATVSRCGMIY+EP+QLG DPL+K W++  +P+  L+ EQ+ +++LLF WL+PP L F+ + CK +V+   + L ++ML+LYS +++DVR +G + ++ D  + EE    +D       + E               ++ L EER+N L  HF  S++WS GA LD  S+LKFD+FFR+LCEM +  N KYPRPK LK +RNL+ PK+ T++D++++K     W +W ++I+   + E  K         T ++ ++I TVDT RQR+FL + +    KP++FVG TGTGKSA+   F+L  LP   ++ ++L FSAQTS++Q QD  FSKLDRR +G Y P   K L VF+DD++MP KEKYGAQPP+EILRQ IDH +WFDRKD + L + D+++C+AM  P   R  +T R +RHFN+I+I+ F+DETM  IF PI+DWHF  GFE +L+R S+++V AT DI++  +++FLPTP+KSHY+FNLRDF+RV+QG LLL+        Q     KL RLWVHE YRV +DRL+ +ED D+FF+++K  VE  FKEKF+ LF       K+  + ++R LMFGD++  K+D                +LY EI D E++ +T++  LDEYNLMSKAPMDLV+FRFAIEHI+RI R+L+QPNGH LLVGIGGSGR SA KL++F+ D+E+FQIE+++ Y+V++WR+D+R+L+   G +GI   FLFGDHQIK+  FLED+NM+LN+ DIPNL+ENE+RLEIIEKMQQ+  Q+N   EIT +NMYNKF+ER+R+NLH+V+TFSPIG+AF SRLR FPSLINCCTI+WF  WPEDAL++VAN+ L++VE+ Q VRE+ V+MC+HFHQSV  LS+K+YE M R NYVTPTSYLELIKTF  LLNKK+ME++T K+RY +GLEKLEFSE+QI++M+ ELQ  QP LI+TS ET+ LIK+IETETVEVE ++ VV  +EA     A ++++IKD+CE+ LAEAMP MNAAI ALDTLKQNDI+IVK+M NPP GV+LVMEAVCI+KG KP+K  DPSGK +EDYWP AKKLLGDLKFL+ LK YDKD IPEA M+KIR  Y+NNP FDP  IK +SSACEGLC WVRA++ YD++ KVV+PK++ L  A ++Y  QM+QL+ KQ EL EV  KL KL EN   K +EK +LENNIEL KVKI RAEKLI+GLGGEK RW   +++L+  +DN++GDVLL A +VAYLGPF + YRQ C++ W + CK+  IP++   + S    LG+PV++R+W I GLPVDSFSVDNA+IV + NRW L+IDPQGQANKW+K +E + NK+ ++KLS+  Y+R +ENCLQFG PCL+EN+GEELD VLESVLLKQTFKQ+ V+YIRLGDHVVEYS+DF+FY+TTR+RNPHYLPE SVKVTL+NFMITP GLEDQ+LGIV AKEKPELE+++ QLI+ESA N+RQLKEIED+IL+ILSTS+GNILEDE AIE+LSSSKVLSE+ISIKQEAA KTE EI+ VRNGYKPVA HGSILFFTISDLA +DPMYQYSL+WFINLY+ SI NS  S ++E R+ NL  HFT ++YQN+CRSLFEKDKLLFSFLLCIGIAKG+  +D+  WRFLLTGG++L++P  NP   WL++K+W E+   S++    G++  F  N+ +WK   DS TP  E  P    ++L+ L+ L+V+RCL P+K++PAV ++IV  +GH+Y+EPP FDL  S+ +S+S +P+IF+LSPG DPM+ LY+FAE K +  + L+ +SLGQGQGPIAE  I +++++  W++LQNCHLA SWL E+ +ICE ++   S+  P+FRLWLTSYPS  FPV+VLQN VKMTNEPPKGLRANLLRSY   PISD  FF +  +P+VF+KLLF LCFFH +VQERR +G +GWNIPYEFN+SDL+IS+RQL MFIN+YE+  LEAL YLTGECNYGGRVTD++DRRLI SLL   Y K+++  + +  +ES  Y  P    +  SYL +I+  P    PEVFGLH NA+++K+QQET QLF+ IL+TLP++ SG  K+SQ IIE+LASDILSK+P  F++EE+  KYPV YEE +NTVL+QELIRFN+L  V+R+SL+D++ A++GL++M   LE+V+ SM++GK P++W+  SYPSLKPLGSY++DLI R++FF++WI +G P  FW+SGFYFTQSFLTGV QNYAR+ +  ID L F F ++ E H        GA++ GL+LE  RW  +  ++ ES  K+LYD +PVI + P  KS      SY CPVYKT+ARRG LSTTGHSTNYV +I LP      HWINRG+A LCQL+D
Sbjct:  283 HDKLSKACLEVVFPPYYYPTIGLPRPASPIEKEKSRYYHLIERAVEPHQVAPHQKVWLDGIYKLVPKPLRDLTE----ARKQFQQEMEEDYRTAVQKCVLDYILLDIKEQERLGVFPPPKPSHSAGRWGFPWKRAVRKARKFMTRDLYVTHPVMSQILYHFEKNYADFRLIDLPGLKKRMPITMEKLKSNVESTCKAGSSLLKNQWINECCAIVDDLRDDVEAWMPDSAELRMDKMDHFFNSAASLMSNLLRSVVKKSMFDLVDLLEQYADGNAYEGEYNIMAGFGLPQKFHPITIFLEEHMAQNTTKFRPLV-----SQVKTTFDEIINTMVASVVAIPRIEHRLFQPVEDLET-HYLSTVKQDEEIVEEAKVRIRKVVDANFHGPQSYKVVYEPYKYLLSKEADRQVEKFISKERALREYVREIEKLKKMAWEVGSFPVYVPMHLFLLDCSGINQWLIQRARNLADIMITNVMNISRKFNRSIVTQYETIMRRITTQAETTEELVSLIDYVERLRVGQLLELNDKLEVAAENLLFLMDYSYLPKQDLVLNDNTFSWKTRILPVVKNSETKLQKEHEIATQNLTRWKKKFKTKLDAMAKKVKDFSQKDRMSEAEHYVLQLEDMQKNLEEFNKEKVLINKEEALLGIGQQSPYVEIQDIQSAMEPYEKLWKAAVKFYAQNDKWMNGPLLEVNAEVVEEEVQNLWRTAYRLTKIFSHPSMAGPFRAATSIKGKLEKFKINMPLITALCNPGIKQRHWNMMNHKVGFQITPTEETPLQEMLGLGLEKFLDELTEVSSQASKEFALEKALSKMKSDWEIVNFVFVPYKDADISILSAIDDVEVQLDDHIVKTTTMKGSPFIGPFEAEVNEWDAKLRRMKAILDSWLKVQAAWLYLEPIFGSADIRNQIPREGKMFEEVDEHWHTIMSNAVKDTKALVVTSQDQMLEKLQYSESMLEDINKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAQLTFTPEKVIVGMESAEKEAVDFPRHIVPAETRGLVEKWLIQVEDTMKLSLKDSCAKAVAAYDENPRSEWVLHWPGQIVLAAGTVHWTSEVEQSIVTPGGMAEYLAKSNRQIDEVVTLVRGK-LTKMARITLGALIVIDVHARDVVAKLKEVQVSSLTDFNWISQLRYYW--------EGDIVIVKMITTAVDYAYEYLGNTGRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKAMSKFFKGLAQSGAWACFDEFNRIELEVLSVIAQQVQSIQRAIAEHLKTFNFEGTELSLDPTCTLFITMNPGYAGRAELPDNLKVLFRTVAMMVPDYAMIGEISLYSMGFINARSLATKIVATYTLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPESPEDELLLKSIIDVNLPKFLSHDIPLFEGIISDLFPEVKQPKPDYTDLEVALVENIQKMKMQPTPWFLEKIIQIYDMILVRHGLMIVGDPIGGKTSAFKAISMSLADMEKKKLMEEHAVTFRIINPKAITMGQLYGRFDPISHEWSDGVLANTFREHASSTTEDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKQNMIFEPQDLEQASPATVSRCGMIYLEPMQLGPDPLVKSWMEYEMPQDILNKEQKESIKLLFEWLLPPCLSFVSKHCKHFVQLSPMHLTSSMLRLYSCMMEDVRKLGDEEEEEDFIEEEEEETTEDGAPAAPSSEEPAEAAFPPRKDKSLSDQKLIEERSNMLFCHFLFSIVWSVGANLDGPSRLKFDEFFRELCEM-EGGNAKYPRPKELKVSRNLLFPKRDTVYDYVYLKTHICSWNSWATMIQNVAIAEKAKYIKDDWKLRTMVNELIINTVDTERQRYFLQKFIHQN-KPLLFVGPTGTGKSAITNNFLL-QLPKDKYIINNLVFSAQTSANQTQDVIFSKLDRRGKGKYGPAVGKLLCVFVDDLNMPAKEKYGAQPPIEILRQWIDHGYWFDRKDTSILELVDIMMCAAMGPPGGGRNTITPRFMRHFNLISIESFNDETMMNIFAPILDWHFTRGFETSLRRFSRIMVQATLDIYKQSISNFLPTPSKSHYLFNLRDFARVVQGILLLQPQKCPEGAQ--GAQKLTRLWVHEAYRVIYDRLVDTEDRDVFFKMVKNTVESQFKEKFNNLFSHLCVPGKQVCDDDLRSLMFGDYMAEKEDE---------------RLYTEIEDLESVRETIEKCLDEYNLMSKAPMDLVMFRFAIEHISRISRVLKQPNGHCLLVGIGGSGRASATKLSSFMADYELFQIEISKNYTVNEWREDVRKLMTKAGVEGIGIVFLFGDHQIKDISFLEDVNMILNTADIPNLYENEERLEIIEKMQQLALQENAMSEITPLNMYNKFVERIRRNLHVVITFSPIGEAFRSRLRMFPSLINCCTIDWFTAWPEDALELVANQFLEDVEMSQAVREEAVVMCKHFHQSVRALSEKYYETMQRRNYVTPTSYLELIKTFKTLLNKKRMELLTLKQRYVIGLEKLEFSESQINVMKQELQELQPMLIKTSAETDDLIKVIETETVEVEAIKSVVAADEAVANKAASESQAIKDECEAKLAEAMPAMNAAIAALDTLKQNDITIVKSMTNPPAGVRLVMEAVCIMKGQKPDKTRDPSGKTVEDYWPVAKKLLGDLKFLESLKVYDKDNIPEATMKKIRKDYMNNPEFDPEIIKKVSSACEGLCKWVRALDTYDQVAKVVAPKRKSLEAALAVYDDQMSQLRQKQAELKEVTDKLDKLNENLDTKMEEKQNLENNIELCKVKIIRAEKLISGLGGEKDRWTHNVANLSDTYDNIVGDVLLSASVVAYLGPFVLSYRQSCLKEWYSMCKAKGIPLNDNFSLSS--TLGEPVKIRDWNIAGLPVDSFSVDNAIIVMNANRWPLMIDPQGQANKWVKNME-KANKIAIVKLSNPNYIRTIENCLQFGNPCLMENIGEELDPVLESVLLKQTFKQNGVDYIRLGDHVVEYSKDFKFYMTTRMRNPHYLPEVSVKVTLLNFMITPMGLEDQLLGIVAAKEKPELEEKKNQLILESAHNKRQLKEIEDKILEILSTSEGNILEDETAIEVLSSSKVLSEEISIKQEAATKTEKEIDDVRNGYKPVAKHGSILFFTISDLAYIDPMYQYSLTWFINLYLQSIHNSTPSENLEERITNLCDHFTYSIYQNVCRSLFEKDKLLFSFLLCIGIAKGEGAIDDREWRFLLTGGVALENPFPNPASAWLTDKAWAEVVRASDIPGLNGFMDHFKKNVTEWKKFYDSATPQSETLPEPL-DKLTKLQTLIVLRCLRPDKMVPAVSNFIVDRMGHQYIEPPTFDLSKSYVDSNSSSPLIFILSPGADPMAVLYKFAEEKGMGGSKLQTISLGQGQGPIAEKMILQAVEAGTWVVLQNCHLAASWLGEMQRICETVITDSSKTKPSFRLWLTSYPSQDFPVSVLQNGVKMTNEPPKGLRANLLRSYLNDPISDPQFFNSCNKPKVFQKLLFGLCFFHGIVQERRKFGPLGWNIPYEFNESDLRISVRQLVMFINEYEEPPLEALIYLTGECNYGGRVTDDRDRRLIKSLLQIFYCKDMIFDDNYKFSESSLYYAP-KQGNYESYLEYIRSLPLLPHPEVFGLHENADISKDQQETQQLFDGILLTLPRQSSGGGKTSQEIIEELASDILSKIPPDFKLEEVQAKYPVKYEESINTVLLQELIRFNRLTSVVRQSLIDIQKAIKGLVVMSAELEDVFDSMMVGKQPAMWAAKSYPSLKPLGSYVADLITRLQFFKDWIYSGPPAVFWLSGFYFTQSFLTGVTQNYARKYQIPIDHLGFQFEVLDEEHTMKSKPSNGAYVRGLFLEGARWERKTKTIAESFPKILYDTMPVIWLKPGEKSKFQESLSYTCPVYKTSARRGTLSTTGHSTNYVLSIQLPIDSTENHWINRGVALLCQLDD 4243          

HSP 2 Score: 70.8626 bits (172), Expect = 1.101e-7
Identity = 28/71 (39.44%), Postives = 48/71 (67.61%), Query Frame = 3
Query:  102 DNIKIGVLNEFEQKHRPLELFDHLPPLSSNTEVYSDRPKLIGKGPWTFAQPFRDKKNFKTLSSSIAENYSP 314
            + + +  +N+FE +HRP ++  HLPPLS+    Y+++PK++ +G WT A P +++K  + +S SI  NYSP
Sbjct:   23 NGVPVAPMNDFEVQHRP-DIISHLPPLSAPWPAYAEKPKILQRGSWTLAAPIKEEKYVRHVSDSIGNNYSP 92          
BLAST of dynein heavy chain 3, axonemal vs. TrEMBL
Match: V3ZCU1 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_125424 PE=4 SV=1)

HSP 1 Score: 4445.57 bits (11529), Expect = 0.000e+0
Identity = 2289/3944 (58.04%), Postives = 2968/3944 (75.25%), Query Frame = 3
Query:  690 RYQILMENSFNDXXXXXXXXXXXQNKIKFMASQNLTEKYPDVTNQFLIDTKQNFQTSVKKAILDYILLNKLEQKRLGLMMPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERI--REMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLN-KELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRK--DNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIM--ECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            RY  L++ + +   I    +E I+   KF+  ++L  ++P  +  FL + + +++ ++++AIL+YILL+ +EQ+RLG+ +P K S    R E PWH      KE++    Y TH  + ++L  F  KY + RLI+I  + +  P+++ + V+  E+ ++  ++YL+ +W++DC +I+ +  D IES+MP+     +   +M+ FF  VA+L S +LR  V+NSI + V+ I++Y +   YE  YD+FSG+A+  +   + I +  +  ++  ++F PSF  ICD    +ID ++ SV +  RLEN+LF  VEG   + +I ++ + EE VI  K ++   V  NS  PIKY  +Y  ++YLL+  ++   H+FI+ ++ L  Y  E+EKL+ +  E  SLP  +PMHLF LDC  IN+WL++R++ L    ++++   S  FNR+IC QY  IV+   K +ETT +LVELQ YVE L+ GEL  L+ KLE A  ++LFL++Y  L ++D+ +NNTTF W DRIIPI+              LN  EK    F+E +  +   +KEF Q++++ +A    Q+L ++  KL    EEK +IN EELLL    QT Y  + +++ +KEPFDKLW +AVTFH  Y+KWMNGP+LEV AEEVE E Q+ W+TAY+LTK+F HP+ KGP++ A TIKAKLEKFKIN+P+I ALCNPGLK+RHW+ MS KVGFD+TP+ DTPL+D+L +GL+K+L+ LM +SS+ASKEFSLEKA  +M+ DW+ + F+F  YK+TG+NIL   DDIQVLL+DHIVKT+TM+ SPFIGPFE E + WD  LHR++D L SWLKVQ+AWLYLEPIFGS DIR QIP+EG  FE VDE W+TIM K   D+  + V+  D +LE LQ SE++L+ IQKGLNDYLEKKRL+FPRFFFLSN+ELLEILSETKDPLRVQPHLKKCFEGI++L F EE VIT M S E E V F   I P E+ GLVEKW+LQVE AMK SLR VM KA+  Y    R  W+  WPGQ+VLAAS  HWT + T AI +  L  +  K+ +Q+  +VE+VR + L  + RITLEA IV+DVHARDVV  L       + DF+WISQ+RYY+         +D + +RM+TT V Y YEYLGN+ RLVITPLTDRCYRTLMGA+ LNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYK+MGKFFKGLAQSGAWACFDEFNRIELEVLSVIAQQ+QTIQR I +Q + F+FEGTE+ LD +CTIFITMNPGYAGR+ELPDNLKVLFRTVAMMVPDY +I EISLYSMGFV+A++LA KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     E+ +VL+SI DVNLPKFL  DIPLF+GI+SDLFPGV  P  DY  L + L+ +++   L+ VPWF+DKIIQIY+MI+VRHGLMIVG    GKT AFK L+ ALGDL+ K+L  E  V   IINPKA+++  LYG FD VSHEW+DGILA TFREHASS SD+RKWIIFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+NKQNMIFEP+DLEQASPATVSRCGMIY++P QLG +PL+  W++  LP+ +  EQ  T++LLF+W++PP L+F+ + C+  + C  +    +ML+LY  L++DV                              +  ++ L EER+N +IA+FF S +WS GA LD  S+LKFD+FF+ LCEM +    KYP+PK+LK ARNL++PKKGT++DH++++KQ+G W TW SL+E  D++   K   +++++I TV+T +QR+FL   +  G KP++FVG TGTGKSA+   F+L+ LP   ++ +++ FSAQTS++Q QD  FSKLDRRR+G+Y P   K L VF+DD++MP KEKYGAQPP+E+LRQ ID  +WFDR+  + + L I D+++ +AM  P   R  VT R LRHFNII I+ FD+ETMK IF PI DWHF S FE +L+R S++IV AT ++F++ ++ FLPTP+KSHY+FNLRDFSRVIQG LLLK  V+    + +   K+ RLWVHE YRVF+DRL+  +D   FF++IK   ++ FKEKF+ LFG  +   K  ++  +R L+FGDF+               +K+ E K+Y+EI D + L +TM+ YL++YN+M+KAPMDLV+FRFAIEHI+RI R+L+QPNGH LLVGIGGSGRQSA +LA F+ DFE+FQIE+T+ Y+  +WRDD+R++++  G +GI T FLFGDHQIK+  FLED+NM+LN+GDIPNL+ENE+RLEIIE+M  + QQ+N+QIE+TA+NMYNKFIERVR+NLH+VL FSPIGDAF +RLR FPSLINCCTI+WF+ WPEDAL++VAN  LD+VE+ Q+VRE+ V+MC+HFHQSV  LS+++++ M R NYVTPTSYLELIKTF NLLNKK++EI+T K RY VGLEKLEFSE QIS+MQ EL   QP+LIETSKETE+LI IIE ETVEVE  +K+V+E+EA     A +AKSIK +CE  LA AMP +NAAI AL+TLKQNDI+IVK M NPP GVKLVME+VCI+KG++PE+KTDPSGK  EDYWP +K++L D+KFLD L+ YDKD IP   M+KIR +YI+NP FDP  IKNISSACEGLC WVRA+++YD ++KVV+PK+  L  AES+   QMA+L   Q EL EV  KL  L ++ + KQ EK +LE+NIE+TK+KIERA KLI+GLGGEK RW + +  L+  + N++GDVLL A +VAYLGPF + YRQE ++ W + CK   IPVS   + S   +LGDPVR+R+WQI GLPVD++S DNA+IV S NRW L+IDPQGQANKWIK +E + NKL +IKL+D  Y RVLENCLQFG PCLLENVGEELD +LE +LLKQTFKQ+N++YIRLG+H++EYSQ F FYITTRLRNPHYLPE SVKVTL+NFMITP GLEDQ+LGIV AKEKPELE+++ QLI+ESA+N+RQLKEIED+IL++LS+S+GNILEDE AI ILSSSK+LSE+IS KQE A++TE+EI+ VRNGYKP+AHHGSILFFTISDLA++DPMYQYSL+WFINLY  SI NS+ S ++  R+ NL  H T ++Y+N+CRSLFEKDKLLFSFLLCIG+ KG+  +++  WRFLLTGG++L++P  NP   WL++KSW E+   S+++ F G++  F  ++  WK I DS TPHLE  P  W + L+ LE L+V+RCL P+K++PA+  YI   +G  Y+EPP FDL L +++S+  +P+IFVLSPG DPM+ L+RFAE K +    L+ +SLGQGQGPIAE  I E+L+   W++LQNCHLA SWLPEL +ICE ++  +++   +FRLWLTSYPSSVFPV+VLQN VKMTNEPPKGLRANLLRSY   PISD  FF +S +P+ FEKLLF LCFFHA+VQERR +G +GWNIPYEFN+SDL+IS+RQL+MFINDY++  LEALTYLTGECNYGGRVTD+ DRRLIMS+L   Y +E++ ++ +  ++SG Y  P V      YL ++++ P    PEVFGLH NA+++K+Q ET Q+F+ IL+TLP++ISG  KSSQ IIE+LASDILSK+P  F +EE+  KYPV YEE MNTVL+QELIRFN+LI+V+R+SL D++ A++GL++M + LE+V+ SM++GKVP++W+  SYPSLKPLGSYI+DL+AR+ FF++WI +G P  FW+SGFYFTQSFLTGVLQNYARR +  ID L F+F +   E    +KP + GA+I GL++E  RW  +   + E+  K+LYD++PVI + P  KS     ++Y CPVYKT+ARRG LSTTGHSTNYV TI LP+ Q   HW+NRG+A LCQL+D
Sbjct:    8 RYYKLVDKAIDPSMITPVASETIEGLYKFVP-KSLRIEHPKASKIFLQEMEDDYRFALRQAILNYILLDPVEQERLGVPLPEKPSNSAGRFEYPWHDTVQDMKEFMSTDLYLTHPIMRQILFLFHSKYGDFRLINISELRKIMPITMEEFVQHVEKSSKDGARYLRKTWIEDCCDIVDNYRDDIESMMPKDNQVYLLMDKMDHFFGSVASLMSVLLRQCVKNSIYDLVDIIEKYYEGNRYEESYDIFSGLALPTLIHPVTIFMLENKENTG-VLFKPSFTDICDFFNLLIDTMVLSVVELPRLENILFQTVEGL-DVKYISTVQSNEELVIEAKNRIHKVVMENSHGPIKYETVYEPYKYLLSTDSDQTVHKFISKERPLRMYVQEIEKLRRMISEVGSLPVLVPMHLFHLDCTNINEWLIERARSLIDKMVSNIMTTSVEFNRAICDQYKQIVKNNAKHAETTEELVELQNYVENLKIGELYELKDKLEIAGGNMLFLMDYGYLSSEDLSVNNTTFKWPDRIIPII--------------LNTKEK----FLEEIKRVTESVKEFKQKDKIPEAETYHQQLQELGVKLEGFKEEKVKINTEELLLGMETQTVYNDIIDLIGMKEPFDKLWSTAVTFHDQYEKWMNGPLLEVIAEEVEEEVQNQWRTAYKLTKIFGHPDLKGPLKAAVTIKAKLEKFKINMPLINALCNPGLKERHWNKMSMKVGFDVTPKEDTPLNDVLGIGLEKNLDVLMGISSQASKEFSLEKALKKMKEDWENMNFNFVAYKDTGINILSAFDDIQVLLDDHIVKTTTMKGSPFIGPFEKEASEWDVQLHRMRDILESWLKVQSAWLYLEPIFGSQDIRNQIPVEGKMFEEVDEHWKTIMTKAVEDTSALVVVGQDEMLEKLQHSESMLDDIQKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAQLTFNEEKVITAMESKEKERVDFPKTITPAESRGLVEKWLLQVEEAMKFSLRTVMTKAVLAYPTTLRKDWILQWPGQIVLAASQTHWTTEVTQAINNGELNSYFNKSKKQVEEVVEMVRGK-LSKMARITLEALIVIDVHARDVVKNLHDINTRKDTDFSWISQLRYYF--------QDDVVNVRMITTTVAYAYEYLGNSGRLVITPLTDRCYRTLMGALLLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQSGAWACFDEFNRIELEVLSVIAQQVQTIQRGIAEQCKTFVFEGTEILLDPTCTIFITMNPGYAGRAELPDNLKVLFRTVAMMVPDYGMIGEISLYSMGFVDAKSLAIKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGTLKLKYPEQREDVLVLRSINDVNLPKFLSHDIPLFEGIVSDLFPGVNLPKPDYLHLQQALVYQIKQRNLQVVPWFIDKIIQIYDMIMVRHGLMIVGDPIGGKTSAFKCLAAALGDLHQKQLMEEFRVQTCIINPKAVTMSQLYGCFDPVSHEWTDGILANTFREHASSTSDDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKQNMIFEPQDLEQASPATVSRCGMIYLDPHQLGWEPLVTSWLETNLPDIVTKEQTQTIKLLFSWIVPPCLNFVTKYCRHLLPCHLMHFTMSMLKLYGCLMEDVNQPA--------------------------SVMDQKLNEERSNMIIAYFFFSTVWSVGATLDTTSRLKFDEFFKTLCEM-EGTTAKYPKPKDLKLARNLLIPKKGTVYDHVYIRKQYGAWCTWSSLVEPFDIESKAK---VNDLIINTVETEKQRYFLQHFVSRG-KPVLFVGPTGTGKSAITNNFLLN-LPKDKYIINNINFSAQTSANQTQDIIFSKLDRRRKGIYGPAPGKKLCVFVDDLNMPAKEKYGAQPPIEVLRQWIDQGYWFDRQVINTSVLQIVDIIMVAAMGPPGGGRNKVTPRFLRHFNIIGIESFDEETMKNIFSPISDWHFKS-FETSLRRYSRIIVGATIEMFENAISTFLPTPSKSHYLFNLRDFSRVIQGVLLLKPYVVPEGVEGN--QKIARLWVHEVYRVFYDRLVDDQDRKNFFKMIKVTFQVHFKEKFNTLFGHLAEAGKVVSDDNLRSLLFGDFM---------------AKKEESKVYDEIMDIDELRETMESYLEDYNVMTKAPMDLVMFRFAIEHISRISRVLKQPNGHCLLVGIGGSGRQSATRLAAFMADFEVFQIEITKNYTAVEWRDDLRKMMKRAGYEGISTVFLFGDHQIKDESFLEDVNMILNTGDIPNLYENEERLEIIERMMVVCQQENLQIELTALNMYNKFIERVRRNLHVVLAFSPIGDAFRNRLRMFPSLINCCTIDWFKAWPEDALELVANNFLDDVEMTQEVREETVVMCKHFHQSVRALSEQYFDTMRRRNYVTPTSYLELIKTFKNLLNKKRLEILTLKNRYMVGLEKLEFSEQQISVMQSELLDLQPKLIETSKETEELIAIIEEETVEVEAKKKIVEEDEAVANKSAMEAKSIKVECEEKLAVAMPALNAAIAALNTLKQNDITIVKTMTNPPQGVKLVMESVCIMKGIRPERKTDPSGKSFEDYWPASKRMLNDMKFLDSLREYDKDNIPSTIMKKIRDKYISNPDFDPAIIKNISSACEGLCKWVRAMDIYDSVIKVVAPKQRSLKAAESVLAEQMAKLHQTQAELKEVTDKLQTLNDHLEQKQIEKKNLEDNIEMTKIKIERATKLISGLGGEKVRWTENVDTLSETYMNIVGDVLLSASVVAYLGPFILDYRQEALKEWYSMCKEKGIPVSEVFSLSK--ILGDPVRIRDWQIAGLPVDNYSTDNAIIVMSANRWPLMIDPQGQANKWIKNME-KANKLGIIKLNDPNYTRVLENCLQFGNPCLLENVGEELDPILEPILLKQTFKQNNLDYIRLGEHIIEYSQGFTFYITTRLRNPHYLPEVSVKVTLLNFMITPLGLEDQLLGIVAAKEKPELEEKKNQLIVESAANKRQLKEIEDKILEVLSSSQGNILEDETAINILSSSKILSEEISQKQEIASETESEIDTVRNGYKPIAHHGSILFFTISDLANIDPMYQYSLAWFINLYHQSILNSDKSDELWERINNLREHLTYSIYKNVCRSLFEKDKLLFSFLLCIGLEKGRGDINDQSWRFLLTGGVALENPFPNPASSWLADKSWAEIVRASSMKAFTGFMDHFQKHVHDWKKIYDSATPHLETLPLPWCDCLTNLEELIVLRCLRPDKMVPAIQKYIAERMGQIYIEPPTFDLSLCYQDSNCYSPLIFVLSPGADPMAGLFRFAEEKGMGNKGLQTISLGQGQGPIAEKMILEALEKGTWVVLQNCHLAASWLPELERICESVITDQTKTKNSFRLWLTSYPSSVFPVSVLQNGVKMTNEPPKGLRANLLRSYLNDPISDPMFFHSSNKPKEFEKLLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQLEMFINDYDEPPLEALTYLTGECNYGGRVTDDYDRRLIMSILKIFYCQEIIDNDNYKFSDSGLYYAP-VKGSYQHYLKYVRQLPLIPHPEVFGLHENADISKDQHETQQMFDGILLTLPRQISGGGKSSQQIIEELASDILSKIPPDFNLEEVKNKYPVRYEESMNTVLVQELIRFNRLIQVVRQSLQDIRKAIKGLVVMSSELEDVFYSMMVGKVPAMWASKSYPSLKPLGSYITDLLARLLFFKDWIFSGSPTVFWISGFYFTQSFLTGVLQNYARRFKIPIDHLGFEFEVTNHESTVSAKPTN-GAYIKGLFMEGARWCRQTKCIEEALPKILYDIMPVIWLKPGEKSSFEEGHNYACPVYKTSARRGTLSTTGHSTNYVLTILLPTKQPDSHWVNRGVALLCQLDD 3866          
BLAST of dynein heavy chain 3, axonemal vs. TrEMBL
Match: W4ZLH0 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 4347.35 bits (11274), Expect = 0.000e+0
Identity = 2243/4006 (55.99%), Postives = 2932/4006 (73.19%), Query Frame = 3
Query:  582 EHDDNTKLALSVPFTPWYRSTKGLXXXXXXXXXXXNRYQILMENSFNDXXXXXXXXXXXQNKIKFMASQNLTEKYPDVTNQFLIDTKQNFQTSVKKAILDYILLNKLEQKRLGLMMPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAI-KSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNK-ELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEM--------------RKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHH--GS------------ILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQK-WKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIM--ECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            E+D   +  +SV F  +  ST GLSR  +P+ +   RY  L+E S  D ++    T+ I+    F+ ++  TE       +   + +  +  S+KK I+DYIL + +EQ+RLG+ MP K S    RE  PW      ++++++ + Y TH  +  +L  +  +Y  LR++    + E  PL+    ++  +   ++  + L N W+++C +++    D IE  MP +   R+ +M+ FF  ++TL S  LR  V  SI + V++ Q Y D   Y+  YD  S +++  +   L+I +  ++ S     F P  + + D L   I  ++  V    R+E  LF +V+   ++  I ++ + EE V   KE++++ +  N   P+++  +Y  + YLL  +++    +F+N D+ L DY  E+EKLK ++ E    P  +PMHLF LDC  IN+WL+ RS+ L  I ++ + N SRVFNR IC QYD IVR++T QSETT QLV+LQEYV++L TGEL+ L+ KLE A  +++FL++Y  L  +D++LN+ TFTW DRI+PI+ +S   L KE + A++KL  WQK+F   +  +  Q+K F  ++++++A +   +L  +  KL++   EK  +NQE+ LL  G  +PY +L +I   KEP+DKLW +AV FH +YDKWMNGP+L+V+AE VE E Q++W+T+Y+LTKVF+HP+  GPMR + TIKAKLEKFKIN+P+I ALCNPG+KQRHWD MS KVGF++TP+ DTPL +ML MGL+K+LEDL E+SS+ASKE+++EKA  +M++DW+ + FSFT YK+T ++IL   DD+QVL+EDH+VKT+TMR SPFI PFE+E+  W+  LHR+KD L+SWLKVQAAWLYLEPIFGS DIRRQIP+EG  F  VD  WR IM+    ++  + V    ++LE+LQ SE LL+ IQKGLNDYLEKKRL+FPRFFFLSN+ELLEILSETKDPLRVQPHLKKCFEGI++L FT E  I  M SAE+E V+    I P +A GLVE W++QVE  MK SLR+V  KA+  Y +  R  WV +WPGQ+V++AS+++WT + T AI +   L+++L   ++QI  IVELVR + L  + RITL A  V+DVHARDVV+ L + ++    +F WISQ+RYY+           N+++RM+TT VPYGYEYLGNT RLVITPLTDRCYRTLMGA+ LNLGGAPEGPAGTGKTET KDLAKAVAKQCVVFNCSDGLDYK+MGKFFKGLAQSGAWACFDEFNRIELEVLSV+AQQIQ+IQRA+ +Q   F+FEGTE+ LD SCT+FITMNPGYAGR+ELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFV+AR+L+ KIVA Y+LCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     E+ +VL+SI DVNLPKFL  DIPLF+GIISDLFPGVE P  DY  L   L   +   KL+ VPWF++KIIQIYEMILVRHGLMIVG +  GKT AFK LS ALGDL K +L  E+ V + IINPKAI++G LYGRFD VSHEWSDG+LA TFREHASS SD RKW IFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+NKQNMIFEP+DLEQASPATVSRCGMIYMEP QLG  PL+  W++  +P+F++ +Q+ T+Q+LF WL+PP L    R C+  V    + +  +ML+LY  LL DV   G++++   ++  EE   +          ++ +IL +ER+N ++ +FF SL+WS G  +D   +  F +FF+ LC+M  +   K+PRPK LK ARNL++PK+G++FD+++ +K FG W  W + +      E+   T+++ ++I TVDT RQ FFL ++L  G K ++FVG TGTGKSA+  AF+LD L   D++ ++L FSAQTS++Q QD   SKLDRR++G+Y P   K LVVF+DD++MP KEKYGAQPP+E+LR  +DH +WFDRKD + L +ED+++ SAM  P   R  VT R LRHFNI+AID F++ETMK IF P++DWHFN GFE  L+R S+++V++T +I+   ++ FLPTP+KSHYVFNLRDF+RV+QG LL+K   +   +  D   KLIRLWVHE YRVF+DRL+  ED   FF ++K VV+  FKEK + +F   +T  +  T+T M              R L FGD+++ K                E K Y+EITD E L + ++ YL+EYN+M+KAPMDLV+FRFAIEHI+RI R+L+QPNGH+LLVGIGGSGR SAA+LA+F+  +E+F IE+T+ Y+ +DWRDDIR+L+R  GD+G  T FLFGDHQIKE  FLEDINM+LN+GDIPNLFENE+RLEIIEKMQQ+   +NIQIE+T +NMYNKFIER+R+NLH+VL FSPIGDAF +RLR FPSLINCCTI+WF+ WPEDAL+MVA+K LD+VE+  ++R + V+MC+HFH+SV  +S +F+ ++ R NYVTPTSYLELIKTF  LLN+K+MEI T K RY VGLEKL+F+ +              QLIE SKET+KLI I++ ET EV+  R++V  +EA     A +A++IK+DCE+NLA AMP ++AA+ AL+TLKQ DI+IVK M NPP GV+LVMEA+CI+KG+K EKKT+  GK  +DYWP AK++LGD+KFL+ L+ YDKD IP A  +KIR QYINNP F P  +K +SSACEGLC WVRAVEVYDR+ KVV+PKK +L  AES  + Q   L  K+  L E+  KL  L +    K+ EK DLE+NIELTK+K+ RAEKLIAGLGGEK RW ++  +L+  + N++GDVLL AG+VAYLGPFT+ +RQEC++ W + C    IPV   S FSLS+ LGDPV+VR+WQ+ GLPVD+FS DNA+IVT+ NRW L+IDPQGQANKW+K +E   NKL+VIKLSD  Y R LENC+QFG PCLLENVGEELD VLE +LLKQTFKQ+ ++YIRLGD+VVE+S+DF+FYITTRLRNPHYLPE SVKVTL+NFMITP GLEDQ+LG+V AKEKP+LE+++ QLIIESA N++QLKEIED+IL++LS+S+GNILEDE AIEILSSSKVLS++IS KQE A+KTE EI+  R+GYKPV  +  GS            I FFTISDLA+++PMYQYSL+WFINLY+ SI  SE S+D+E R+K+LN HFT ++YQN+CRSLFE DKLLFSF+LCIGIAKG  ++D+  WRFLLTGG++L++P  NP P+WLS+KSW E+  +S L+ F     DF++N +  WK + DS +PH +K P  W+  L+ +E+L+V+R + P+K++PAV ++I+  +G  Y+EPP FDL  S+ +S   TP+IFVLSPG DPM+ L +FA  K +    +  VSLGQGQGPIA   I E+++   W++LQNCHLA SWLP L KICEEL+    +  P+FRLWLTSYP+  FPV++LQN +KMTNEPPKGLRANLLRSY   PISD +FF    +P +++KLLFSLCFFHA+VQERR +G +GWN PYEFN+SDL+IS+RQ QMF+NDY+ + LEALTYLTGECNYGGRVTD  DRRL++SLL   Y+ +++  E +  +ESG Y  P  +    SY ++IK  P    PEVFGLH NA++ K+Q+ET QLF+ IL+TLP++ SG  KSSQ IIEDLASDILSK+P  + +EE+  KYPVLYEE MNTVL+QELIRFN+LIEV+R SL D++ A++GL++M   LE+V+ SM++GKVP +W+  SYPSLKPLGSYI+DL+AR++FF++WI +G P  FW+SGFYFT SFLTG +QN+ARR +  ID+L  DF +M  E +  SKP D G ++ GL++E  RW      L ES  K+LYD LP++               Y   VYKT+ RRG LSTTGHSTN+VF I LPSS    HWINRG+A LCQL++
Sbjct:  291 EYDLEMEAVMSVQFPGYTYSTHGLSRPPTPDQKDVVRYYGLIEGSIEDSSVAPLNTQWIKEMYNFLPARLKTEPLKKCMKEVTEEARSVYTESIKKGIMDYILQDPVEQERLGVPMPTKHSNSAGREWYPWSDAVDDARDFMENYLYITHPIMTTILYKWETQYAHLRMLDRPGMEEIMPLTPEVFLDHIKNTTKQTREILMNDWLEECADMIDDERDEIERWMPENQDGRMAQMDHFFKSLSTLMSLCLRSCVEKSIHDLVDWFQLYDDGNYYDCDYD-GSELSLPTIPQPLKISMGPEM-SKVSCSFTPDINGVIDILHGCIQTMVDGVKGIHRVEKRLFHRVDAV-AIAHIPAVRDDEEVVERAKEQVKEVILHNYHGPVRFKMVYAPYAYLLKSSSDSQVEKFVNKDQHLRDYVREIEKLKKMAAEVGLFPLNVPMHLFELDCTDINRWLILRSRDLADIMISKIVNTSRVFNRGICGQYDQIVRKITSQSETTHQLVKLQEYVDRLTTGELLQLKKKLEVAGGNLIFLMDYAYLNKEDLMLNDQTFTWPDRIMPIIRNSEMKLQKEHDYAVSKLNDWQKKFAVRIKEVMDQVKAFRTKDRMSEAQDYLDKLIDIQLKLDDFYSEKGAVNQEQKLLDVGHISPYPELDQIKEKKEPYDKLWNAAVKFHHMYDKWMNGPLLDVNAEVVEEEVQNMWRTSYKLTKVFAHPDMMGPMRASTTIKAKLEKFKINMPLINALCNPGIKQRHWDMMSEKVGFNMTPQDDTPLVEMLQMGLEKYLEDLSEISSQASKEYAMEKALSKMKSDWETVHFSFTGYKDTNLSILGAPDDVQVLIEDHVVKTATMRGSPFIAPFEAELKEWEIRLHRIKDILDSWLKVQAAWLYLEPIFGSEDIRRQIPVEGEMFTTVDGHWREIMHTSVKNTLALVVTSQKDMLENLQHSEGLLDTIQKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAQLTFTPEKEIIAMESAENESVELCSRIIPADAHGLVEMWLIQVEDLMKKSLRDVNAKAVVAYPKTPRKSWVLNWPGQIVISASSIYWTAEVTKAILEKDGLKKYLATCNRQIEEIVELVRGK-LTKMARITLGALTVVDVHARDVVSNLYNEKIEDVLNFQWISQLRYYF--------EEGNVMVRMITTTVPYGYEYLGNTGRLVITPLTDRCYRTLMGALLLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQSGAWACFDEFNRIELEVLSVVAQQIQSIQRAVAEQQTTFVFEGTEISLDPSCTMFITMNPGYAGRAELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVDARSLSTKIVATYKLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKFPDTAEDILVLRSIKDVNLPKFLSHDIPLFEGIISDLFPGVELPRPDYGVLEEALKTNIAKRKLQAVPWFIEKIIQIYEMILVRHGLMIVGDTIGGKTSAFKVLSDALGDLEKAKLMDEHRVEYRIINPKAITMGQLYGRFDPVSHEWSDGVLANTFREHASSTSDSRKWCIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKQNMIFEPKDLEQASPATVSRCGMIYMEPSQLGWQPLVASWMEHEVPDFINKQQKETMQMLFEWLLPPCLLHASRTCRQLVPMSPMHMTMSMLRLYKCLLTDV---GEETESDIEDLDEEDDPDASL-------SDQKIL-DERSNMMMCYFFFSLVWSVGVSVDGAFRENFSEFFKQLCDMDTT--GKHPRPKELKFARNLLIPKRGSVFDYVYTRKTFGAWNQWATFVTA---TEIADNTQVNELIIKTVDTERQNFFLKKLLLQGEK-VLFVGPTGTGKSAITNAFLLD-LAKGDYIPNNLNFSAQTSANQTQDIILSKLDRRKKGVYGPTPGKKLVVFVDDLNMPAKEKYGAQPPIELLRHWVDHGYWFDRKDTSVLYLEDIMLVSAMGPPGGGRNTVTPRFLRHFNILAIDTFNEETMKNIFTPLLDWHFNRGFETNLRRYSRIMVYSTTEIYMQAISSFLPTPSKSHYVFNLRDFARVVQGILLIKPACIP--SGADGAKKLIRLWVHEVYRVFYDRLVDDEDRQTFFTMVKSVVQSQFKEKMNTVFTHLTT-GREVTDTNMRSSSAHPEIRDEHLRSLFFGDYMRTKD---------------EEKNYDEITDLEGLRENVEKYLEEYNMMTKAPMDLVMFRFAIEHISRISRVLKQPNGHALLVGIGGSGRASAARLASFMAMYELFSIEITKNYTQADWRDDIRQLMRKAGDEGCSTVFLFGDHQIKEESFLEDINMILNTGDIPNLFENEERLEIIEKMQQVCVAENIQIEMTPLNMYNKFIERIRRNLHVVLAFSPIGDAFRNRLRMFPSLINCCTIDWFKAWPEDALEMVAHKFLDDVEMSDEIRAETVVMCKHFHESVRAMSDRFFTILRRANYVTPTSYLELIKTFKTLLNRKRMEIFTLKNRYMVGLEKLDFAAS--------------QLIENSKETDKLIVIVQEETQEVDAKRQIVAADEAVANAAANEAQAIKEDCEANLAVAMPALDAAVRALNTLKQQDITIVKTMLNPPAGVRLVMEAICIMKGIKGEKKTNDQGKPFDDYWPGAKRMLGDMKFLESLREYDKDNIPPAITKKIRDQYINNPDFRPEVVKKVSSACEGLCSWVRAVEVYDRVAKVVAPKKARLQEAESKLEEQEGHLNEKRGVLKEIMGKLQALNDQLSRKEGEKKDLEDNIELTKLKLIRAEKLIAGLGGEKDRWLQLTEELSETYINIVGDVLLSAGVVAYLGPFTLSFRQECLKDWYDMCVEKDIPV--SSVFSLSATLGDPVKVRDWQLAGLPVDNFSTDNALIVTNANRWPLMIDPQGQANKWVKNMEKP-NKLQVIKLSDPTYTRTLENCMQFGQPCLLENVGEELDPVLEPLLLKQTFKQNGLDYIRLGDNVVEFSRDFKFYITTRLRNPHYLPEVSVKVTLLNFMITPLGLEDQLLGLVAAKEKPDLEEKKNQLIIESAKNKKQLKEIEDKILEVLSSSQGNILEDETAIEILSSSKVLSKEISEKQEIASKTETEIDETRDGYKPVRTYVNGSYNNNDDDSYTVHITFFTISDLANIEPMYQYSLAWFINLYLQSISLSEPSNDLERRIKSLNDHFTYSIYQNVCRSLFETDKLLFSFILCIGIAKG--RIDDREWRFLLTGGVALENPFPNPAPNWLSDKSWAEVVRVSQLDAF----DDFMLNFRSNWKKLYDSPSPHTDKIPEPWDLSLNEMEKLIVLRIIRPDKMVPAVQNFIIKAMGQAYIEPPTFDLAKSYVDSSYFTPLIFVLSPGADPMNVLMKFAVEKGMGGNGMATVSLGQGQGPIAAKMINEAVEHGTWVVLQNCHLALSWLPTLEKICEELITDSEKTRPSFRLWLTSYPTPTFPVSILQNGIKMTNEPPKGLRANLLRSYLNDPISDPEFFNGCTKPDLWKKLLFSLCFFHALVQERRQFGPLGWNTPYEFNESDLRISVRQQQMFLNDYDVIPLEALTYLTGECNYGGRVTDYHDRRLLISLLAIFYNDQIVAEEGYSFSESGNYRCP-PSGPHESYTDYIKSLPLMPHPEVFGLHENADITKDQKETQQLFDGILLTLPRQASGGEKSSQQIIEDLASDILSKIPPNYNLEEVQKKYPVLYEESMNTVLVQELIRFNRLIEVVRSSLQDIRKAMKGLVVMSAELEDVFDSMMVGKVPGMWAAKSYPSLKPLGSYITDLLARLQFFKDWIRDGMPTVFWLSGFYFTHSFLTGTMQNFARRYKIPIDQLLLDFEVMKNESNMDSKPGD-GVYVTGLFIEGARWDRPTHVLAESQPKILYDTLPIV---------------YSIIVYKTSVRRGTLSTTGHSTNFVFEIQLPSSHPPNHWINRGVAMLCQLDN 4208          
BLAST of dynein heavy chain 3, axonemal vs. TrEMBL
Match: A0A1I8J3K8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 4240.26 bits (10996), Expect = 0.000e+0
Identity = 2187/3883 (56.32%), Postives = 2840/3883 (73.14%), Query Frame = 3
Query:  957 REEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWE-LRLISIENICESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPME-RIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFI-KVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWT-EQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNI----ENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEA-LFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLS-------------------PTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMEC--HEYS-KPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSH-----INWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLN 12497
            RE  PWH      KE+L++  +  H     + S F   Y +  RLI   ++  S PL+ +D    C  +++ QS  L+  WM +C  +   S   IE  +  +  E R   M  FFNC+A + S  +R  V  S ++ V  ++ Y     YEG Y +   +A+  + S+ R+ L  DL     +   P+ + I + L   +D ++G+ + F R+E+ LF+   E    L  + S+   E+F+   + +L   +  N+  P KY Q Y  F+Y++++TTE    +FI+ ++ L DY  E+EKLK+L D+ A +P  +PMHLF+LDC  +N+ LL R   L  + +N++   +R F   IC  YD IV+R+T+QSETT +LV+LQ+YV+ L   EL+ LQ       R++LFL++Y  L  DDI L   TF W  +I+P++++S + L KE + A ++L++    FV+ L  LK  ++ F  +  ++DA    +ELD + + L+EC EEK +IN+EELLL+TG QT Y+QLQEI  +KEP+++LW+  + F +  + W++GP+L+VDAE VE E + LWKTAYRLTKVFSHP++KGPMRCAAT+KA+LEKFKINLP+++ALCNPGLK RHW AMS +VG +I P+ DTPLS  L++ L+KHLE L  +S KA+KEF+LEKA   MQ  W+++ F+F PYK+TG+++L   D++QVLL+DHIVKT+TM NSPFIGPF+ E+  W   LHR+KD L+ WLKVQ++WLYLEPIF SADIRRQIP EG  FE V+  W  IM+    +S  ++V   + +LE LQ     LE I KGLNDYLE+KRL+F RFFFLSN+ELLEILSETKDPLRVQPHLKKCFEGI++L F+ E  IT M+SAE+E V F   I P +A+GLVE W+L+VE  M  SLR V  KA+  Y    R  WV  WPGQVVL+AS VHWT E AT   +   L ++L ++  +I  IV LVR + L S+ RITLEA IV+DVHARDVV KL     +S  DF+W SQ+RYYW         + +L++RMVTTEVPYG+EYLGNT RLVITPLTDRCY TLMGA+KLNLGGAPEGPAGTGKTET KDLAKAVAKQCVVFNCSDGLDY++MGKFFKGLAQSGAWACFDEFNRIELEVLSVIAQQ+Q+IQRAI D+ E F FEGT+LRL+ SCTIFITMNPGYAGR+ELPDNLKVLFRTV+MM+PDYALIAEISLYSMGFV A++L+AKIVA Y+LCSEQLSSQ+HYDYGMRAVKSVLTAAGQ+KRK     EE++VLK+I+D+NLPKFL PDIPLF+GI+SDLFP V     DY  L + L +    +KLE VPWF  K++Q+Y+MILVRHGLM+VG++  GKT A + L++AL  ++++  +    E  V F IINPKA+S+  LYGRFD VSHEW+DG+LA  FREHA+S  +ERKWI+FDGPVDA+WIENMNTVLDDN+KLCLMSGEIIQM+++QNMIFEP DL+QASPATVSRCGM+YME  +L   PL+  W++  LP  +  EQ   V+LLFNW++PP L F+GR C   +      +  +++ LY++LL D++ +G+K    DD+D +     ++ D++ K T   + +++ERTN +++ FF +++W  G++LD+  +  FD FFR+LC+M +  + +YPRPK L+CARNL++PK+GT+FDH+++ K FG W  W S I+  D++E +KT  I  I++P V T  + +FL R+L N   P + +G TGT K+AV K+F L SL  K ++ H++ FSAQTS+D VQD+FF+KLDR R+GLY P  ++ LVVF+DD++MP KEKYGAQPP+E+LRQL+DH FW+DRKD T + +++V +  AM + S  R  +T R LRH  +I +  FD+ETMK IFQPI+D H N GF+ +LKR S++IV+ TA ++ SV+  +LPTP++SHY+FNLRDF+RV+ G +LLK   +     E +   ++RLW HE YRVF+DRL+S  DC  FF L+K  +E+ FKEK  V+F    T +   T+++MRKLMFGDFLK +    + L  GT       KLY E+TD    L + M  YL++YN +S +PMDLVLF FAIEH+ARICR+L+QP+GH LLVGIGGSGRQS  +LATFICDFE+FQIE+T+ YSVSDWR+DI++L+   G  G   TFLFGDHQIK   F+EDIN+LLN+ DIPN+F NE+RL+I+EK Q  VQQ N+QIEIT +NMYNKFIER++ +LH+ L FSPIGD F  RLR FPSLI+CCTI+WF+ WPEDAL++VAN+ LD+VE+  +VR+  V +C++FH+SV  LS++F   M R  YVTPTSYLELIKT+  LL+K++++I+T KERY+VGLEKL+FSE QI+LMQ +LQ  QP+LIE S ET +LI++IE E++EVE+V+KVV+EEEA     A +AK+IKD+CE+ LAEAMP MNAAI ALDTLK NDI+IVK M NPP GVKLVMEAVCILKGLKPEKKTD +GK +EDYWPTAKK+LGDLKFLD+LKS+DKD IPEA + +IR  Y+ NP FDP  IKN SSACEGLCLWV A+E YD++ KVV+PKK+ L  A++I+  Q  +LKVKQ EL++V +KL +L     +KQQEK +LE+NIE+ KVKI RAE+LI GLGGEK RW + +  L  R+ N++GDVLL AG+VAYLGPFT  YRQECV  W        IPV    +FSLS+ LGDPVR+R+WQI+GLPVDSFSVDNA+I T++NRW LLIDPQ QANKWIK LE   NKLEVIKLS   YLR LENCLQFG PCL+ENVGE LD +LE V LKQT+KQS+++YIRLGD  VEYS+DF+ Y+TTRLRNPHYLPEWSVKVTLVNFMITP GL+DQ+LGI+TAKEKP LE+++ QLI+ESA N+RQLKEIED+IL++LSTS+GNILEDE AIEILSSS+ LSE+IS K++ A  T  EI+ VRNGYKPVA HGS+LFFTISDLA L+ MYQYSLSWF+NLYIH+IE S  S +++ R+K+LN  FT  VY N+CRSLFEKDKLLFSFLL IGI KG  K+DE  WRFLLTGG+S+ SP  NP+ DW+ +KSW ++   S +   KG       +   WK+  DS  PH +  P  +E RLS LERL+++RCL P+K+IPA+ + I   +G  +V+PPAF+LE+SF +S    P++ +LSPG+DP+  L++FA  K+LS                      +  VSLGQGQG  A   I E++K+ +W++LQNCHLA SWLPEL KIC+ L+     ++  FRLWLTSYP+  FPV++LQ +VKMTNE P  LR+NLLRSY + PI+D  F+    +P+VF KLLF LCFFHA++QERR YG +GWNIPYEFNDSDL+IS RQL MF+ DY +  L+AL+YL GECNYGGRV+D+ DRRLIMSLL   Y+ +LL    +  T+SG Y +P V+++ ++ + HIKR P N  PE+FGLH NA++ KEQ ET+ LF  IL TLP+E++G S S Q +IE+++S+IL+KLP  F +++  +K+PVLYEE MNTVLIQELIRFN LI VI +SL  L  A++GLI++   LEEV+ SM +GK+P +W + SYPSLKPLGSYI+DL+ RI F QNWID+G P  FW+SGFYFTQSFL+GVLQN+AR  +  ID L  +F + +   HE S +P   GA++ GL+LE  RW  E  SL ESH K+L+  LPVI  +P  K+          ++Y CPVYKT  RRGVLSTTGHSTN+V  I LP+ +   HWINRG+ ALCQLN
Sbjct:    7 REGFPWHKTAQHVKEFLKRNLHCLHPLPNSVYSQFITGYSQSFRLIDFADLESSYPLTFSDFGARCLAFSKSQSARLKTQWMSECVAVTNDSQAHIEDWIAANDEETRADRMSNFFNCIAQVMSKCIRMTVELSCSDLVRLLETYSAGNDYEGDYTMTCDLALPQLPSVFRVFLEIDL-QEELIELQPTEETIANILHATVDAMVGTSANFPRIESHLFVLTAEQRDELESLQSVSPEEDFIEDCRRRLTSVITANTPGPAKYKQRYQQFQYIISRTTEGKILKFISRERNLRDYVKEIEKLKALRDQLAVMPDHVPMHLFLLDCSHLNESLLARVDYLISLLVNNVVTGTRAFCDDICNHYDDIVKRITQQSETTKELVDLQKYVDNLTVDELLDLQ-------RTLLFLMDYAHLSRDDIRLYKRTFMWPVKIMPLIENSEFKLNKEHDVATSRLKRAMTLFVDRLMNLKQDVRNFASKIIISDAAVYVEELDNIQKALDECTEEKNRINREELLLNTGNQTQYVQLQEIHNLKEPYERLWRGILRFQQCSESWISGPMLQVDAEIVEEEVEVLWKTAYRLTKVFSHPDFKGPMRCAATMKARLEKFKINLPLVRALCNPGLKSRHWQAMSREVGQNIEPQADTPLSSYLSLNLEKHLEQLSNISQKATKEFALEKALKMMQTGWRDMNFTFVPYKDTGLSVLAAFDEVQVLLDDHIVKTTTMLNSPFIGPFKKEVTRWSAFLHRMKDILDCWLKVQSSWLYLEPIFSSADIRRQIPNEGQLFEEVNTHWTKIMSYAAKNSNAISVTSQEEMLEKLQECHQKLEVIHKGLNDYLEQKRLFFSRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIARLNFSSEQEITAMVSAENERVDFVSRIVPADAQGLVEVWLLEVETVMMKSLRCVTGKAIEAYQPHDRKDWVTRWPGQVVLSASIVHWTSEVATAMTQQDGLSQYLLRSINRIDEIVSLVRGQ-LSSMTRITLEALIVIDVHARDVVRKLHQLATTSPQDFSWTSQLRYYWI--------DGDLLVRMVTTEVPYGFEYLGNTPRLVITPLTDRCYCTLMGALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYEAMGKFFKGLAQSGAWACFDEFNRIELEVLSVIAQQVQSIQRAITDRTEEFYFEGTKLRLNMSCTIFITMNPGYAGRAELPDNLKVLFRTVSMMIPDYALIAEISLYSMGFVAAQSLSAKIVATYKLCSEQLSSQNHYDYGMRAVKSVLTAAGQMKRKFMDDAEEKLVLKAIVDINLPKFLSPDIPLFEGILSDLFPSVSHLTPDYSLLRQKLRDAADELKLECVPWFEQKLLQLYDMILVRHGLMVVGETLAGKTSAIRTLALALRKIHEQEEVGGMRELPVDFRIINPKAVSMAQLYGRFDPVSHEWTDGVLANIFREHAASYQEERKWIVFDGPVDAVWIENMNTVLDDNRKLCLMSGEIIQMSSRQNMIFEPRDLDQASPATVSRCGMVYMEVRELTHQPLVDAWLRYHLPPEVGPEQARQVRLLFNWILPPCLAFVGRSCLLPIPVNPNHMTMSVINLYAALLQDLKLIGEKE---DDDDDDFEFDSENLDLVKKPTRSAQKIEDERTNVMLSCFFFAVVWGTGSLLDQHGREVFDQFFRELCDMPEGSSAQYPRPKGLRCARNLLIPKRGTVFDHVYVTKPFGSWVQWSSQIKPIDIEEEMKTKPIQEIIVPVVQTQIESYFLNRLLANN-VPCLLIGPTGTSKTAVAKSF-LHSLDPKVYVTHTVNFSAQTSADSVQDNFFAKLDRVRKGLYMPQLNRRLVVFVDDLNMPAKEKYGAQPPIEVLRQLVDHGFWYDRKDTTVVKVQNVNMVCAMDV-SGGRQLITRRFLRHCVLIGVSAFDEETMKSIFQPILDHHLNQGFDNSLKRYSRMIVNCTAQLYMSVVKDYLPTPSRSHYLFNLRDFARVVHGYMLLKPQAMPKHATEFA-KSVVRLWTHEVYRVFYDRLVSEADCQHFFSLVKTTIEIGFKEKAAVIFDGLQTPDNPLTDSDMRKLMFGDFLKGR----DTLPGGT-------KLYCELTDHATQLREDMVRYLEDYNEISTSPMDLVLFGFAIEHVARICRVLKQPSGHLLLVGIGGSGRQSTTRLATFICDFELFQIEITKNYSVSDWREDIKKLILKAGLDGQNITFLFGDHQIKSISFMEDINLLLNTADIPNIFTNEERLDIVEKTQLFVQQANLQIEITPLNMYNKFIERIKSHLHIALCFSPIGDQFRVRLRMFPSLISCCTIDWFKPWPEDALELVANRYLDDVEMTAEVRDATVSICKNFHESVRHLSEQFQASMNRRTYVTPTSYLELIKTYKVLLSKQRLDILTQKERYAVGLEKLDFSEGQIALMQQKLQDLQPRLIENSTETAELIRVIEKESIEVEQVKKVVEEEEAVANRSAMEAKAIKDECEAKLAEAMPAMNAAIAALDTLKANDITIVKTMLNPPAGVKLVMEAVCILKGLKPEKKTDANGKTVEDYWPTAKKMLGDLKFLDNLKSFDKDNIPEANISRIRKHYVTNPDFDPANIKNTSSACEGLCLWVLAIEDYDKVAKVVAPKKQSLNAAQAIFMEQAEKLKVKQAELHKVLAKLDQLNATLADKQQEKLNLEHNIEMCKVKIVRAERLINGLGGEKVRWHERVGYLTDRYHNIVGDVLLSAGVVAYLGPFTAAYRQECVSNWHALALDKRIPV--SRSFSLSATLGDPVRIRDWQIFGLPVDSFSVDNAIIATNSNRWPLLIDPQTQANKWIKNLE-RANKLEVIKLSTANYLRALENCLQFGNPCLIENVGETLDPILEPVFLKQTYKQSSIDYIRLGDRSVEYSEDFKLYVTTRLRNPHYLPEWSVKVTLVNFMITPDGLQDQLLGILTAKEKPALEEKKNQLILESAKNKRQLKEIEDRILEVLSTSQGNILEDETAIEILSSSRALSEEISQKEKIAESTSEEIDIVRNGYKPVAFHGSLLFFTISDLAHLESMYQYSLSWFVNLYIHTIETSPKSEELQERIKHLNESFTVCVYLNVCRSLFEKDKLLFSFLLFIGIVKGSGKLDETQWRFLLTGGVSISSPDGNPLSDWMPDKSWADISHASTMGRLKGIKAHIRKHEADWKAFYDSAAPHTQPLPAPYEGRLSFLERLIILRCLRPDKIIPAIFNLIDAEMGRTFVDPPAFELEVSFADSVPEVPLLMILSPGLDPLHSLFKFA--KDLSTMRRNSQVQQTEDGSDATKAIQVNTVSLGQGQGSKAAVMIEEAIKTGSWVVLQNCHLAVSWLPELEKICDSLITNADRLHKEFRLWLTSYPTPDFPVSILQRAVKMTNETPMNLRSNLLRSYQSHPINDPSFYDTCNKPEVFRKLLFGLCFFHALIQERRKYGPLGWNIPYEFNDSDLQISCRQLHMFVCDYAEPPLDALSYLAGECNYGGRVSDSMDRRLIMSLLGKFYNHQLLSDVEYKFTDSGLYGLP-VSTEFDACIEHIKRLPMNPRPEIFGLHDNADITKEQNETSLLFNQILKTLPREVAGASDSQQ-LIEEISSEILAKLPGAFDVDDAQLKHPVLYEESMNTVLIQELIRFNVLINVITESLKALLKAMKGLIILSAELEEVFDSMTLGKIPQMWLEKSYPSLKPLGSYITDLLHRITFLQNWIDSGTPSVFWISGFYFTQSFLSGVLQNFARTKQIPIDHLTLNFLVTKFGPHEDSIEPPPAGAYVKGLFLEGARWCSESHSLAESHPKILFAELPVILFMPVKKAESSSASSASASTYSCPVYKTLIRRGVLSTTGHSTNFVLCIDLPTDREATHWINRGVCALCQLN 3847          
BLAST of dynein heavy chain 3, axonemal vs. TrEMBL
Match: A0A0L8FUX5 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22007301mg PE=4 SV=1)

HSP 1 Score: 4227.94 bits (10964), Expect = 0.000e+0
Identity = 2167/3913 (55.38%), Postives = 2877/3913 (73.52%), Query Frame = 3
Query:  774 FMASQNLTEKYPDVTNQFLIDTKQNFQTSVKKAILDYILLNKLEQKRLGLMMPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPME-RIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKE-LNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKD-FLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIM-ECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            F ++  L   +P +TNQ L +  +++  ++KKAILDYILL+  EQ RLG+ +  ++   +  E  PWH+   +++ +L+   + TH     +L  F  KY   RL+SI+ + +  P+++  LV   ++  ++ ++ LQ +W+ +C  I+ S  + +E    +   + R+  M++FF+ VA+L SN+LR  V++S++E +  I+ Y D   Y G Y++ +G+ +     +L+I LN D+ +    IF PSFD I   L  I+D I+ S S F  +E+ LF  VE  P+  +I S+   E+ V++ K+K+++ V  NS  P +Y   YT F YL++  T D ++QFIN D  L +Y   L+ +  L  +   LPT +PM++F+L+ + INQ L++++  L     N + + S++F RSIC QYD IV  +T+   TTS+LV LQ+Y++ L  GEL+ L+ K E AA +V+F++ Y ++  +D LL N TF+W++RI PI+      L K+ + A+ KL  W+K+ ++N++GL  ++KEF  ++++++A +   E+  +  +L    +EK++IN+EE++L     + + Q+Q + T  EP+++LW +AV     Y+ WMNGP+L V++EEV+ E Q+LW+ AY+LT+VF+HP+ KGP + A  +K +LEKFKIN+P+++ALCNPG+K RHW  MS KVGFDITP+ DTPLS++L + L+++L++L  +SS+A+KEF+LEKA  +M++DW+ + F+FTPYK+T + IL   DDIQ LL+DHIVKT+TM+ S F+GPFE EI  W  +L+R+K  L SWLKVQ+AWLYLEPIFGSADIR QIP++G  FE VD+ W+ IM+      K + V   D +LE LQ S  LLE IQ GLNDYLEKKRL+FPRFFFLSN+ELLEILSETKDPLRVQPHLKKCFE I++L FT E VI  M S+E E V F  +I P EA GLVEKW+ QVE+AMK SL++ M KA+  Y Q  R +WV  WPGQ+VLAAS VHWT + T AI+  +++++++K    I  IVE+VR  N+  + RITL A IV+DVHARD+ ++L+SS+VS+  DFNWIS +RYY+         + ++++RMVTT V Y YEYLGN+SRLVITPLTDRCYRTLM AI+LNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSD LDYK+MGKFFKGLAQSGAWACFDEFNRIELEVLSVIAQQ+QTIQRAI +Q  MF+FEGT + LD +CTIFITMNPGYAGR+ELPDNLKVLFRTVAMMVPDYA+I+EI LYSMGF +AR L+ KIVA YRLCSEQLS+Q HYDYGMRAV+SVLTA G LK      +E  +VLKSI DVNLPKFL  DI LF+GIISDLFPG+E P  +Y  L   + + L    L+PVPW+++KIIQIY MILVRHGLMIVG+   GKTCA+K L+ ALGDL+++ L  EN V + IINPKAI++G LYGR D +++EW+DG+LA +FREHASS S  RKW++FDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQM++KQNMIFE   LEQASPATVSRCGMIYM+ LQLG + L+K W+Q+ L +F   E + T++ LFNWL+P SLD++ + C   V C  + LV NML+LY  LL+++R +G   D+  + D                    E L EE++N +I HF  +L+WS  A L  DS LKF +FF  LCE T+S N    RPK +K +R+L++PKKG+I+D+I+MKKQ+G W TW+SL++   + E    T+++ IL+ T +T RQ FFL      G KP++FVG TGTGKS+VI +F+L    NKD ++  ++ FSAQTS++Q QD   SKL+RR +G+Y P  +K L VF+DD++MP  E  GAQPP+E+LRQ +DH FW+DRKD T   + +V I SAMA  S  R  +T+R LRHFNII ID F ++ +K IF P+ +WHF   F ++L+R S++I+HAT DI++ V+  FLPTP+KSHYVFNLRDF+RVIQG LL     +      +  +K+IRLW HETYR+F DRL+   D + FF+++K  +E  FKEKF+ +FG  +   K+ T  +MR L+FGDF++ K              EG ++LY+EI+D++ L Q ++ YL +YNLMSK PMDLV+F  A+EHI RI R+L+QPNGH LL+GIGG+GRQSA ++A FI +FE+ QIEM + YS ++WR+D+ +++R +G+      F  GD+QIK   FLEDINMLLN+GDIPNL++NE RLEIIEKMQQ+  Q+NI IE T++NM+NKFIERVR+NLH+VL FSPIG+AF +RLR +PSLINCCTI+WF+ WP+DAL++VANK LD+VE+ +D+R++ V MC+HFH SV  L+ K+YE +   NYVTPTSYLELI+TF  LL++K+MEI+T K RY VGLEKLEFS+ QI++MQ EL A QPQL+ETSKET +LIK IE E  EVE V+++V+++EA     A +A+SIK++CE  L  AMP  N A+ AL TLKQNDI+IVKAM NPP GVKLVM AVC +KG+KP+KKTD +GK++EDYW  +KK+L D+KFLD L+ YDKD IP A + KIR +YI+N  FDP  IKN+SSACEGLC WV+A++ YD ++K V+PKKE LAVAE+  + QM +L  KQ EL +V++KL  L++N   KQQEK +LE NIELTKVK+ERAEKLI GLGGE  RW + +  L   +DN+IGDVLL A +VAYLGPF   YRQEC++ W   CK   IP+S++ + S    LG+P+++REWQI GLPVDS+SV+N +IV +  RW L+IDPQGQANKWIK +E   NKL+V K +D  Y R++ENCLQFG PCLLENVGEELD +LE +LLKQTFKQ  V+Y+R  D VVEYS+DFR Y+TT LRNPHYLPE S+KVTL+NF+ITP GLEDQ+LGIV A+EKP+LE+++ QLIIESA N+RQLKEIED+IL +LS S+GNILEDE AI++LSSSK LSE I  KQ AA+ TE +I+ VRNGYKPVA HGSILFFTISDLA++DPMYQYSL+WFI+LY  +I NSE S  +  R+  LN +FTR+V+ N+CRSLFEKDKLLF+FLLCIG+ K Q  +D+L WRFLLTGG++L++P  NP  DWL EK+W+E+   S L   + + + F   +Q+WK++ DS  PH  K+P  + E L+ L+ L+V+RCL P+K+IPA+ ++I   +G  Y+EP  FDL +S++ES   TP+IF+LSPGVDPM+ L+RFAE K  S   L+ +SLGQGQGPIAE  I E+ +   W++LQNCHLA SW   L  ICE +L   +    +FRLWLT+YPSS FPV+VLQNS+K+ NEPPKGLRA LL+SY+++P++++ FF++  +P+VF+KLLF LCFFHA+VQERR +G++GWNIPY+FN+SDL +SI+QLQM INDYED  LEAL YLTGECNYGGRVTDN DRRLIMSLL   Y  ++++++ +  +ESG Y  P   S L+ YL +I+  P    PEVFGLH NA+++K+QQET QLFE +L+TLPK+  G  KSSQ IIEDLASDILSK+P  F++EEI  KY V Y E MNTVL+QEL+RFN+L++VI  SL +++ A+ GL++M   LE +  SM++GKVP++W++ SYPSLKPLGSY+SDL+ARI+FF +WI  GQP  FW+SGFYFTQSFL GV+QNYAR ++  ID L   FRIM + HE       GA+I+GL+LE   W  +   L E+  KVLYDL+P+I I P  K     E +Y CPVYKT+ARRG LSTTGHSTNYV TI LPS++   +WIN+G+A LCQL++
Sbjct:   24 FSSNDTLLTAFPKLTNQLLKEIDEDYIEAIKKAILDYILLDPSEQVRLGVYIQPQVMSCMKHERFPWHNSVTEARNFLKYNLFITHPVNTAILYTFQHKYSTYRLLSIDTLKQFLPMTIEQLVIYVKETVRRNAKNLQETWLSECASIIDSRREDVEGRFLKDRTDSRLDYMDKFFSSVASLMSNLLRTCVQDSLSELLTLIECYMDGNDYSGEYNIMTGLGLPTKMHVLKISLNTDVPNVST-IFEPSFDVIQHHLSDIVDVIVTSTSHFPCIEHCLFHSVENLPT-NYIRSVGQNEQLVLNTKQKIQNVVNKNSCGPTRYLSTYTPFYYLIDTKTSDWTNQFINEDHSLQEYSDILDNILRLRKQVFLLPTIMPMNMFLLEADQINQLLINQADYLVTTLCNKVISNSQLFYRSICKQYDQIVETITRHVTTTSELVALQKYIDGLSCGELLALKEKQEVAAANVMFMMTYVVMKREDFLLINNTFSWSNRITPIISKIESQLQKQHDLAVEKLNGWRKRILDNVSGLSKKLKEFATKDRMSEAQQILSEIRIIENQLEVLKKEKQKINEEEMMLGLEEISEFEQVQFLATAVEPYERLWSNAVKLQTQYECWMNGPLLNVNSEEVDQEIQTLWRIAYKLTQVFNHPDKKGPFKAARAMKNRLEKFKINIPLVKALCNPGIKNRHWKMMSEKVGFDITPQEDTPLSEILKLDLERYLDELSAISSQANKEFALEKALSKMKDDWENMAFNFTPYKDTELFILSAFDDIQALLDDHIVKTTTMKGSAFVGPFEKEIKEWGYSLNRMKGILESWLKVQSAWLYLEPIFGSADIREQIPVQGKMFEEVDQNWKQIMSTAKQSHKALTVASQDQMLEKLQYSVTLLEDIQCGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFESIAQLVFTPEKVIVAMESSEKERVNFCTNIVPSEAHGLVEKWLQQVEHAMKLSLKQEMAKAVESYIQNHRNKWVLMWPGQIVLAASQVHWTAEITKAIEKGSIQQYVEKRQHHIEEIVEIVRG-NISKMARITLGALIVIDVHARDIESQLISSQVSNVQDFNWISHLRYYF--------EDQSVIVRMVTTSVAYAYEYLGNSSRLVITPLTDRCYRTLMSAIRLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDSLDYKAMGKFFKGLAQSGAWACFDEFNRIELEVLSVIAQQLQTIQRAIIEQRNMFVFEGTYISLDPTCTIFITMNPGYAGRAELPDNLKVLFRTVAMMVPDYAMISEILLYSMGFADARNLSTKIVATYRLCSEQLSTQQHYDYGMRAVRSVLTAVGNLKLMYPDQSEALLVLKSIKDVNLPKFLSQDITLFEGIISDLFPGLELPQSEYSHLEMAIKKTLDIRNLQPVPWYIEKIIQIYNMILVRHGLMIVGEPIAGKTCAYKVLADALGDLSQQNLMDENQVDYRIINPKAITMGQLYGRCDPITNEWTDGVLANSFREHASSTSKNRKWMVFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMSSKQNMIFEVCHLEQASPATVSRCGMIYMDALQLGWNTLVKSWMQKTLEDFTKGE-KNTIEYLFNWLLPSSLDYVTKHCTQIVPCQYMHLVLNMLKLYECLLEEIRRIGGPQDEMVNVDDIAGFSVI-----------QEKLAEEKSNMIITHFLFALVWSLSATLTSDSSLKFQEFFHKLCE-TESIN---ARPKEMKFSRSLLIPKKGSIYDYIYMKKQYGSWRTWESLVDPTIITE---KTKMNKILVNTKETERQNFFLRLFFHQG-KPLLFVGPTGTGKSSVINSFLLKL--NKDSYITCNINFSAQTSANQTQDIIVSKLERRCKGVYGPSGEKILCVFVDDLNMPALEN-GAQPPIELLRQWLDHGFWYDRKDTTMFELVNVKILSAMAPTSGGRNPITTRFLRHFNIIHIDAFSEDILKEIFSPMTEWHFRQ-FPVSLRRFSRIIIHATLDIYKKVVTKFLPTPSKSHYVFNLRDFARVIQGILLFSPQSVSE--DPECIHKIIRLWTHETYRLFSDRLVDQADQEAFFKILKLSIEAQFKEKFNSVFGHLAPKGKQVTPKDMRCLIFGDFMEPK--------------EGSVRLYDEISDQDELRQVIEKYLADYNLMSKTPMDLVMFHLAVEHITRINRVLKQPNGHCLLIGIGGTGRQSATRMAAFIAEFELIQIEMGKDYSTAEWREDLMKIIRKSGEDSTPLVFFLGDYQIKNPSFLEDINMLLNTGDIPNLYDNEQRLEIIEKMQQLTLQENITIEFTSLNMFNKFIERVRQNLHIVLAFSPIGEAFRNRLRMYPSLINCCTIDWFEQWPDDALQLVANKLLDDVEMHEDLRQQSVEMCKHFHISVRALTTKYYEALNHQNYVTPTSYLELIRTFKTLLSQKRMEILTLKNRYLVGLEKLEFSKFQINIMQKELFALQPQLLETSKETVELIKTIEKERHEVEAVKQLVEQDEAVSNKAAMEAQSIKNECEEKLKLAMPAFNTAVAALHTLKQNDITIVKAMTNPPQGVKLVMAAVCTMKGIKPDKKTDQNGKIVEDYWTASKKMLSDMKFLDSLRDYDKDNIPPAIINKIREKYISNKEFDPSIIKNVSSACEGLCKWVKAIDAYDSVIKFVAPKKESLAVAETFLKEQMGELGKKQKELKDVKAKLDSLKQNLHIKQQEKKNLEFNIELTKVKLERAEKLINGLGGEHDRWIQAVDSLTNTYDNIIGDVLLSASVVAYLGPFISSYRQECLQEWYKCCKKKGIPLSAQFSLSK--TLGNPLKIREWQIAGLPVDSYSVENGIIVDNCGRWPLIIDPQGQANKWIKNMEC-HNKLQVTKHTDANYGRIIENCLQFGCPCLLENVGEELDPLLEPILLKQTFKQRGVDYVRFRDRVVEYSKDFRLYLTTCLRNPHYLPEVSLKVTLINFVITPNGLEDQLLGIVAAREKPDLEEKKNQLIIESAQNKRQLKEIEDKILDVLSNSQGNILEDETAIQVLSSSKTLSEDIEEKQLAASLTELDIDEVRNGYKPVARHGSILFFTISDLANIDPMYQYSLTWFIHLYHQAITNSEPSQILSERINYLNDYFTRSVHNNVCRSLFEKDKLLFTFLLCIGLTKAQGLIDDLEWRFLLTGGLALENPYSNPASDWLPEKNWSEIVRCSQLSSLQTFREHFTNRLQEWKAVYDSPQPHQMKYPSPYGEELTQLQELLVLRCLRPDKMIPAIQNFIQQRMGQAYIEPTTFDLSVSYEESSPQTPLIFILSPGVDPMAALFRFAEDKGRS-KGLQAISLGQGQGPIAEQRILEATEQGTWVVLQNCHLAVSWFGHLENICETVLQNPAHTKESFRLWLTTYPSSQFPVSVLQNSIKIINEPPKGLRAKLLQSYSSSPVAEQQFFESCNKPRVFKKLLFGLCFFHALVQERRKFGALGWNIPYQFNESDLNVSIQQLQMLINDYEDPPLEALVYLTGECNYGGRVTDNSDRRLIMSLLKKFYCHDIIVNDDYKFSESGLYYAPPCGS-LDCYLEYIRGLPYIPHPEVFGLHENADISKDQQETQQLFEGVLMTLPKQTLGAGKSSQDIIEDLASDILSKMPAAFEVEEIQKKYAVSYHESMNTVLVQELLRFNRLLKVIIWSLEEIQKAIYGLVVMSAKLERIVNSMIVGKVPAVWAEKSYPSLKPLGSYVSDLLARIQFFNHWISEGQPTVFWISGFYFTQSFLMGVMQNYARSHKIPIDHLTLSFRIMKQEHEMPSKPITGAYINGLFLEGACWCRQAGILSEALPKVLYDLMPIIWIKPVKKEEFQAEENYQCPVYKTSARRGNLSTTGHSTNYVLTIQLPSNRDEDYWINQGVALLCQLDN 3880          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Cavefish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 3358.93 bits (8708), Expect = 0.000e+0
Identity = 1819/3934 (46.24%), Postives = 2552/3934 (64.87%), Query Frame = 3
Query:  843 QNFQTSVKKAILDYILLNKLEQKRLGLMMPNKIS-VPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTN-FRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFS--------------------------HPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHT--LEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLN-KELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQL-LFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNL---KCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILK-NGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHF-NSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLF---ENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSG--KLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKA-SKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVT-LPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYK----TAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            +N    V+++    IL +  +   +  + P   S V  L    PWH   ++S++ ++K  +  H  +  +L      + +L L+ +     S P+S   L        ++    L N+W      +L S  D+++ I          +++ F+NC +TL SN L+ +V  S+  FV                +LF  ++   +  + R++L  +      + F PSF  + + + +I  +I  ++ +   +++ L            +  +  + E  + N       V  N EAP ++ Q Y+N + +L+N+T +D   +FI  +     Y   +EK ++LS E +SLP+     +  LDCE + Q L  +++    I L  + N  R     IC ++++I ++  K+ ETT  ++E+  Y+   RT  L  L  K+ +  +   +LL+      +D+ LN+    W   I PI D +   L + +++   +L+  +++ +  L  L  +++EF + ++L+   +   E+  + + L E  +    IN+EE L     QT Y ++  +    EP+ K++   + + +   +WM+G  L+++ E +EAE    ++  Y++ K F                           H E    + C   I+ ++++FK ++P++  LCNPG++ RHW+ MS  V  D+TP   T L  +L   L  ++E    +S+ ASKEFSLEKA   M   W  I FS   ++E+GV+IL  VD+IQ +L+D IVKT TMR SPFI PFE EI  W++ L R++D ++ WLKVQA WLYLEPIF S DI +Q+P EG  F+ VD+ WR +M     D KV+       LLE LQ S  LLEQI KGLN YLEKKRL+FPRFFFLSN+E+LEILSETKDPLRVQPHLKKCFEGI+KL F     I  M S+E E V+    I   EA G VEKW++QVE  M  S+R+V+ ++   Y +  R QWV++WPGQVVL  S ++WT++   AI+S    L+ +  +   Q+  IVELVR + L    R TL A + +DVHARDVV +++   VS E DF W++Q+RYYW        +NDN+ + ++  +V Y YEYLGN+ RLVITPLTDRCYRTL+GA  LNLGGAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY +MGKFFKGLA SGAWACFDEFNRIELEVLSV+AQQI  IQRAI  +LE F FEGTELRL+ +C + ITMNPGYAGRSELPDNLKVLFRTVAMMVP+YALIAEISLYS GF+ A+ L+ KIV  YRLCSEQLSSQ HYDYGMRAVK+VL AAG LK K     E+ ++L+SI DVN PKFL  DIPLF+GI SDLFPG+  P  DYQ       E  +   ++PV  FLDK+IQ YEM++VRHG M+VG+ F GKT     L+  L  +N +  N E  V +  +NPK+I++G L+G+FD VSHEW+DGI+A TFRE+AS+E+ +RKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQM+N+ ++IFE  DL QASPATVSRCGMIYMEP QLG  PL+  W+   LP+ L  ++ +T+ L LFNWLIPP+L  + + C+  V   +   V ++ +L+  LL +                                 E    K  RT +++A F  SL+WS G   D+DS+ +FD F R   E+     +++P P  +   +C  N     KG ++D+ +  K  GCW  W   I+   L +  K T++ +I++PT+DT+    F T I+  +  +P++FVG TGTGKS  +K  ++++L  + +L   + FSA+TS++Q Q+   ++LD+RR+G++ PP  K  ++F+DD++MP  E +GAQPP+E+LRQ  DH  W+D KD + + + DV + SAM  P   R AVT R LRHFNI +++ F D+TM  IF  ++ ++  N+ F      +   IV AT ++++  M + LPTPAKSHY FNLRDFSRV+QGCLLLK   L+N         +IRL+VHE +RVF+DRL+  +D D  ++L+K +V+  FKE F  +F     ++ +    +MR L+FGD++             T   E   +LY E+   E+  Q ++ YL EYN   K  M+LV+FR+ +EH++RI R+L+QP G++LLVG+GGSGRQS  +LATF+ D  +FQ E+++ Y +++WR+D++ L++  G KG +T FL  D QIKE  FLED++ +LN+G++PNLF   E ++ +E++  ++ I Q  N  +E + + ++  F+ R R+NLH+V+ FSPIGDAF +RLR FPSLINCCTINWFQ WPE+AL+ VANK L+ +E+    R++++++C+ FH S   LS+KF   +GR NYVTPTSYLELI  F  LL  K+  ++ +K+RY+ GL+KL F+E+Q+  M+ EL   QP+L +   +  K++++IE E+V+VE   KVV+ EE     KA +A+++K++CES+LAEA+P + AA+ ALDTLK +D++IVK+M+NPP GVKLVM AVC++K +KPEK  DP+G  + + DYW  +KKLLGD+ FL  LK YDKD IP   M KIR +Y+ NP FDP K+   SSA EGLC W+ A+EVYDR+ KVV+PKK  L VA+      MA L  K+ EL EVE +LA L++  + K +E+  L+  ++L   K+ERAEKLI GLGGEK RW K   DL   +DN+ GDVL+ AG++AYLG FT G+RQ C + W   CKS +IP  S   FSLS  LGDP+++R W I GLP DSFS+DN VIV+++ RW L+IDPQGQANKW+K  E E N L VIKL+D  Y+R LENC+QFGTP LLENVGEELD  LE +LLKQ FKQ  ++ IRLG+ V+E+S DFRFYITT+LRNPHYLPE + KV+L+NFMITP GLEDQ+LGIV AKE+PELE+ R  LI++SA+N++QLKEIED+IL+ L +S+GNILEDE AI+IL S+K++S +IS KQ+ A KTE +I   R GY+P+A H SILFF+I+DLA++DPMYQYSL+WF+NLYI+SI++S  S  +E RL+ L +HFT  +Y N+CRSLFEKDKLLFSFLLC  +   + +++   + FLLTGG+ L +   NP P+WL +KSW+E+   S+L   +G       +   +  I DSK P+    P  W ++LS  +++++ RCL P+K+ PA+ +YI G LG ++VEPP FDL  S+ +S+S  P++FVLSPG DPM+ L +FA  KN+   N K +SLGQGQGPIA   I  ++K   W+ LQNCHLA SW+  L KICE+        +P+FRLWLTSYPS +FPV +LQN VKMTNEPP GLR NLL+SY + P+SD  FF A S +  V+EKLL+ +CFFHA+VQER+ +G +GWNIPY FN+SDL+ISIRQLQ+F+N YE+V  EA+TYLTGECNYGGRVTD+ DRRL++++L   Y+K+++ +  +  + SG Y  P   S    Y+  I+  P    PEVFG+H N +++K+ Q+T  LF+S+++T       G S    + + D+A+DI +KLP+ F I+    K+PVLYEE MNTVL+QE+ R+N L   IR SL +L  A++GL++M   LE +  S+++GKVP  W++ SYPSLKPLGSYI+D + R+KF Q+W D  +P+ FW+SGF+FTQ+FLTG +QNYAR+    ID L FD+ ++     +   ++G ++HGL+L+  RW  +   L E H KVL+D +P+I I P            HC  +     T+ R+G LSTTGHSTN+V +I LP+S+  QHWI RG+A LCQL++
Sbjct:   92 ENLCDEVRESFHSCILKHTGKHTSVDFISPRVFSLVRTLDFARPWHDSFIRSRKLIKKNLHILHPVMKIILDICYVTFSDLLLVDLSACRSSGPVSCGSLKNKVALECERIETKLMNTWFPKVIHLLTSK-DTVQGIT-------TEKLDAFYNCASTLLSNQLKAVVERSVVAFV----------------NLFDPLSTHKL-PLFRMNLTFE---EEKMDFYPSFQDMEEAVLEIFTSISNTMQKVQTVQSWLSETNNSVIDAKLVDHVRAWAETTLKNA------VWKNLEAPNQHFQNYSNNYDWLVNRTAQDLVEKFIQEEHSFDQYTQVIEKFQALSREISSLPSVAHFDMIRLDCEELKQGLAKKAETFAQILLEQLINTQRQQCLEICEEFETIQKKAMKKPETTEDMIEMIAYISHARTKGLEELHSKIMETHQRFTYLLHVHTFSAEDLELNSKMVLWPQNINPIFDLNNELLEQAKQKGEQELQGKREKLMLKLEKLGRRMEEFAECSELDMMQQYVTEIKTVQKWLQEVEDSISFINKEEALYKWD-QTVYPEIDVMKENIEPYQKVFGLVLKWQRTEKRWMDGSFLDLNGESMEAELDEFFREIYKMLKSFQQKQKKAEQGRERQVAMKRRPGEGDDDHLESPTALMCIKVIE-QIKEFKEHIPMVSILCNPGIRARHWEQMSEIVNHDLTPNSGTTLRKVLKQNLSAYMEHFETISAAASKEFSLEKALQNMVETWDIISFSHHAHRESGVSILTAVDEIQTMLDDQIVKTQTMRGSPFIKPFEKEIKAWEERLIRIQDTIDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGQLFQTVDKHWREVMRHCVKDPKVLPATSLTGLLEKLQESNNLLEQIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLDFLPNLDIQAMYSSEGERVELIQLISTSEARGAVEKWLVQVEDVMLSSIRDVINRSRLAYPETKRSQWVREWPGQVVLCTSQMYWTQEVHEAIRSGVGGLKNYYNQLQSQLKDIVELVRGK-LPKQTRTTLGALVTIDVHARDVVMEMIEKGVSHETDFQWLAQLRYYW--------NNDNVRVCIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMKLEFFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPDENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPAADYQLFLDCAQECCKKHNVQPVKVFLDKMIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNERGYNDEEKVQYRTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREYASAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWLPLVTSWLNT-LPQPLQTQENSTLLLELFNWLIPPALRMLRKNCREVVSTTNSNTVVSLTRLFEMLLTEP------------------------------VTEEPGNKNIRT-WIMAAFAFSLVWSIGGSCDRDSRERFDQFLR---EILSGKLEEHPIPAAVSKWECPFN----DKGLVYDYSYEFKGKGCWIHWNESIKNVTLGD--KNTKVQDIIVPTIDTIFCTLFTTLIIFFSPFRPLLFVGPTGTGKSVYVKEKLMNNLNKERYLPFFINFSARTSANQSQNIIMARLDKRRKGVFGPPMGKKCIIFVDDMNMPAMEVFGAQPPIELLRQYFDHGNWYDLKDTSKITLVDVQLISAMGPPGGGRNAVTPRFLRHFNICSMNAFSDDTMSRIFSNVVAFYLRNNDFPNDCFSIGNQIVAATLEVYKKAMENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLEN------KRTMIRLFVHEVFRVFYDRLVDDQDRDWLYKLMKNIVKEHFKESFDTVF-----EHLKLCEEDMRSLLFGDYM-------------TPDVEASERLYAEVPSMESFSQVVESYLTEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMADMTLFQPEISKNYGMNEWREDLKLLLKKAGVKGQKTVFLLTDAQIKEEAFLEDVDSVLNTGEVPNLFAVDEKQEIMEVMHAVRPIAQAGNKSLEFSPLALFAFFVNRCRENLHVVVAFSPIGDAFRNRLRQFPSLINCCTINWFQPWPEEALERVANKFLETLEMSDHERQEVMLICKTFHTSAIHLSEKFLSELGRHNYVTPTSYLELIAAFRLLLTNKRDTVMNAKKRYTNGLDKLAFAESQVGEMKKELVDLQPKLEQAKIDNIKMVQVIEVESVQVEAKSKVVRVEEEAASQKAAEAQALKNECESDLAEAIPALEAALSALDTLKPSDVTIVKSMKNPPSGVKLVMAAVCVMKDIKPEKINDPAGTGQKILDYWGPSKKLLGDMNFLRDLKVYDKDNIPAPVMHKIRSEYMTNPDFDPTKVAKASSAAEGLCKWITAMEVYDRVAKVVAPKKANLIVAQQSLAATMALLNQKRAELKEVEDRLAALKKTLEEKTEEQAQLQFQVDLCARKLERAEKLIGGLGGEKTRWSKAADDLQNTYDNLTGDVLISAGVIAYLGAFTAGFRQNCTKEWTKLCKSKNIP--SSDDFSLSKTLGDPIKIRAWNISGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERE-NNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQIFKQGGMDCIRLGESVIEFSSDFRFYITTKLRNPHYLPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDKILETLQSSEGNILEDESAIQILDSAKIMSNEISKKQQIAEKTELKIAESREGYRPIAKHSSILFFSIADLANIDPMYQYSLNWFVNLYINSIQDSNKSKILEKRLRYLINHFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYAEFMFLLTGGVGLQNNVPNPDPNWLQDKSWDEICRASDLPGLQGLRYPPFCH---FLPIYDSKEPYNTPLPKPWCDKLSDFQKMIIYRCLRPDKIEPAISNYITGKLGKKFVEPPPFDLSKSYNDSNSTIPLVFVLSPGADPMASLLKFANDKNMGGANFKSISLGQGQGPIAVKMIQSAMKEGTWVCLQNCHLAVSWMSTLEKICED--FSPETCHPDFRLWLTSYPSPMFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPVSDPQFFSACSNKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNSYEEVPFEAITYLTGECNYGGRVTDDWDRRLLLTILADFYNKDIIENPRYMFSPSGKYYSP-PKSIYEDYVEFIRNLPATQHPEVFGMHENVDISKDLQQTKLLFDSLILTQGGGSKGGASSGGDSTLMDIANDIRTKLPENFNIDSALNKFPVLYEESMNTVLVQEMERYNNLCNTIRVSLQNLLKAIKGLVVMDAELEAIAGSLLVGKVPEKWAKRSYPSLKPLGSYITDFLTRLKFLQDWYDTTKPNVFWLSGFFFTQAFLTGAMQNYARKYSIPIDLLSFDYEVLPFDTSATSPEDGVYVHGLFLDGARWDKKSGVLAEQHPKVLFDSVPIIWIKPK-----------HCCTFLLLSCTSERKGTLSTTGHSTNFVISIMLPTSKRPQHWIKRGVAMLCQLDN 3895          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 2237.61 bits (5797), Expect = 0.000e+0
Identity = 1314/3714 (35.38%), Postives = 2102/3714 (56.60%), Query Frame = 3
Query: 1488 SSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYL--LNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDI--LLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMA---EKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFD---KLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKV--GFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTE----ETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQIS--RCQWVQDWPGQVVLAASAVHWTEQATNAI-------KSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENSVIFDI-INPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEK-PDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKA-PMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIK--QDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECV-ELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQK--NPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEIS----GESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEE--CMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHT-FWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSK--PADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQL-VQHWINRGLAALCQLND 12500
            S+  + F P+  ++   +  I   +I ++S F RL ++L  K         + +++  +E +   +  +   +  N+     Y + +   R +  +NK +    +Q +N    +  +++++ +   +++      T L +   +LDC  +   L+    + +  +   ++  +    + + +       RL++  +T  +LVE  + +E L+ G+L  ++ ++         L  Y +    ++  LL      W      ++DS    L K +++  + L    ++F + +   +  +++FN        V +E  L++++    +L    EE+  I     +  T   T     +++  +++  D   ++W+ +  +   +D+W  G    +  E +E+  Q+++K   +L++     +++         K ++E+FK  +P+I  L +P ++ RHW+ +  ++   FD     +  L  ++A+GL++H E + E+S  A KE S+E++   +   W+E      PYK+ G       +++   LED+ V  STM+ S F+  FE E++ W++ L  + + +   L VQ  W+YLE IF   DIR+Q+P E  +F+ ++  W+TIM+++  D+  +       LLE L    + LE+IQK L+ YLE KR  FPRF+FLSN++LLEIL ++++P  VQPHLKKCF+ I  L+  +    ++   GM SA+ E V+F +   P+  EG VE W+  VE  M+ +L++ ++   T   +++  R +WV+DWPGQ+++ AS + WT   T  +           L+   KK    +    + +R  NL  ++R+ + A + ++VHARDV+ KL  +     + F+W+ Q+R YW  ++      D+ +IR   T   YGYEYLGN+ RLVITPLTDRCY TL  A+ L+ GG+P+GPAGTGKTET KDL K +    +V NCSDGLDYKSMG+ + GLAQ+GAW CFDEFNRI +EVLSV+AQQI +I  A+   L  F+FEG ++ L  SC IFITMNPGYAGR+ELPDNLK +FR ++M+VPD  LIAEI+L+  GF   + LA K+  +Y L  +QLS Q HYD+G+RA+ S+L  AG+ +R    + +E ++L S+ D+N+ K    D+PLF+GII DLFP VE P IDY  L   + E L    L+  P+ + K+IQ+YE    RH  MIVG++   K+  ++ L  AL  ++++     +++ +  +NPKA+S+G LYG +D  ++EW+DG+L+   R   + E  + KWI+FDGPVD +WIE+MN+V+DDNK L L++GE I M  + +++FE EDL  ASPATVSRCGM+Y +   LG  P ++ WI +     +D  +R     LF+  I  ++ F    CK  V    L  V ++ +LY SL      V                        N   NEN          +   F  SLIWS                    C   D   +K  +  N         P K TI+++    K      TW S  +K P           + I++PTVDTVR  F +  ++  G+ P++  G  GTGK++V ++ +L  L    +   ++  S+QT+S+ VQ    S++++R +G Y P   K ++ F+DD++MP  + +G+QPP+E+LR  ID+ FW+DR+     +  D+ + ++M  P   R  ++ RL   FN+I +    +  +K IF  +++      F+  +K +  ++  AT +++ ++ A FLPTPAK HY+FNLRD S+V QG  LL+S    +    D+   + RLW+HE +RVF DRL+   D + F  L+         EK   LF D +  N  P     ++ +FGDFLK                  E  +Y ++ D +AL   M+  L++YNL     PM LVLFR AIEH+ R+ R++ QP G+ LLVGIGGSGRQS ++LA +IC++ +FQ+E+T+ Y   ++R+DI++L R TG     T FLF D QI +  FLEDIN +L+SG++PNL+++++      +       +   +  TA  M+N  IERVR NLH+VL  SP+G+ F +R+R +P+L+NC T++WF  WP+DAL  VA + LD + +   + ++ K+  +    HQSV+  S++    + R NYVTPT+YLEL+  +  LL +K+ E+     +   GL K++ + +++  M VEL+  + ++ E  K+ E+ + +I  +  E ++ +  V         +    K++ ++ + +L EA+P +  A++AL++L + D++ +K+   PP  V+ VM+AV IL+G +P              W  AK+ LG+  F+  L  +DKD I +  ++KI  QY   P F P  I  +S A + LC+WVRA+EVY RI +VV PK+ +L  A +    + A L   +++  EVE KL +L+  +  K  +K DL    E  ++K++RA KL++GL GE+ RW + +  L      ++GD LL A  ++Y+GPF   YR+E +  +W  + + + +P S    F+    L  P  VR+W I GLP D+FS +N VIVT  NRW L++DPQGQA KWIK +ES+R  L+VI L    +LR+LEN +QFG+P LL+NV EELD  L  +L K          ++LGD  VEY+ DF+FYITT+L NPHY PE S K T+VNF +   GLE Q+LGIV  +E+PELE+++  L+I  AS +R+L+E+ED+IL++L+ + G++L+D + +  L +SK+ + ++S + E + +TE +I+  R  Y+P A   SILFF ++D+  +DPMYQ+SL  +I+L+  SIE S+ S  +E R+ NLN + T AVY+  CR LFE+ KLLFSF +C  I +   K++   + F L GG+ LD   +  NP   WL++ +W+ +  L  L  F G +  F    + W     S  P     PG+WE   + L++++++R L  ++V   V S+I+  LG  +VEPP  D++   ++S + TP+IFVLSPGVDP   L + AE   + P+    +SLGQGQ PIA   I E +K+ +W+ L NCHL+ SW+P+L K+ E+L ++ S  +P+FRLWL+S P   FP+ +LQ  +KMT EPPKG+++N+ R Y    +  E  F    RP V+ KLLFSLCFFH+++ ER+ +  +GWNI Y FNDSD ++S   + +++++YE++  +AL YL    NYGG VTD+ DRRL+ + +   + +  + +  F L+   TY +P   S  ++Y  +I++ PP   PEVFG H NA++A +  ET  LF+++L   P+  S    G   S +  + ++++D+  K+P++   E       +L ++   +N VL+QE+ R+N L+  IR SL +L+  ++GL++M ++LEE+++ +   +VP LW + +YPSLKPL S+  DL  R++ F +W +   P   FW+SGF F   FLT VLQ+ AR++  ++D L ++F +    + +   P  +G FI GLYLE   W  ++  L+E+    L   +P I+  P        +N Y CP Y    R G         ++V  + L S  +  +HWI RG A L  L++
Sbjct:  867 STAQVEFSPTLQKLAQIVNSINSQLISTISVFQRLPDLLTRKRSQRKP---VHNIIEQDEEICKIQAAIAAGMTANASHLQAYLKTWDKHREIWEINKDSFIRRYQHLNPP--VSSFDSDIARYSEVANNVQKEETVLSVQFVLLDCSPLKFSLVQHCNEWQGKFTQLLSLMASTRLKELHSFLQDNAHRLSQPPQTLVELVEGLKLLETLQ-GDLNKIESQIPPIHEQFAILEKYEVSVEREVQDLLEALNGEWQGFQQVVIDSD-IMLKKHKDKFKSGLFFSAEEFKKKM---QTTMQDFNSTGPFGSNVSSEAALEQISVLRAQLESLKEEEGTIRHGLSIFKTEQPTS----KDMQNLEKDIDYLLQVWEISQQWDTHWDEWKAGQFASLQTENMESTAQTMYKNLNKLSRELKDKQWE----IVEFSKNRIEQFKRTIPMILDLRDPAMRDRHWNQIKQEMQRSFDHNS-AEFTLEKIVALGLEQHAERICEISGAARKELSIEQSLEGIAKTWEETSLDIAPYKDKGT------EEVFQALEDNQVTLSTMKASRFVRAFEKEVDRWERCLSLVLEVIEMILTVQRQWMYLEIIFLGEDIRKQLPHESTEFDDINSSWKTIMDRLNKDNNALRGTHHPGLLEKLSEMNSKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPDAVQPHLKKCFDNIKSLRINKVRNNKSEAAGMFSADGEFVEFTH---PVLLEGPVEAWLCDVERTMRWTLKDTLRNCRTALKKMTGKRDKWVKDWPGQMLITASQIQWTTDVTKCLITGKESADKSALKSMKKKQVSMLHRYSDAIRG-NLSKILRLKIVALVTVEVHARDVIDKLAKAGCCDVNAFDWLCQLRLYWEKDV------DDCIIRQTNTHFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKGLGMYVIVVNCSDGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLTNFIFEGRDICLVSSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFGEGFNNCKVLAKKVFTLYCLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRVRPDIADEEILLMSMKDMNIAKLTSTDLPLFNGIIQDLFPAVETPTIDYGKLKETIEEELHQSGLQVTPFTVTKVIQLYETKNSRHSSMIVGKTGSSKSVTWQILQKALSAMHRKGEPGFNLVHEYPLNPKAVSLGELYGEYDLSTNEWTDGVLSSLMRIACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAVASPATVSRCGMVYNDYSDLGWKPYVQSWIDKRQKMEVDHLKR-----LFDRYIKKTISFKRTHCKELVPITELNGVISLCRLYDSLASPENGV------------------------NPADNEN------YGRMVELWFIFSLIWSI-------------------CASVDEDGRK--KIDNFLREMEGTFPNKDTIYEYYVDTKN----KTWASFEDKLPKGWRYPSNAPFYKIMVPTVDTVRYHFLVNSLV-CGQYPVLLTGPVGTGKTSVAQS-VLQGLDPAKWTMLTINMSSQTTSNNVQAIIESRVEKRTKGTYVPVGGKKMLAFLDDLNMPAVDDFGSQPPLELLRLWIDYGFWYDRQ-----MKMDMFLLASMGPPGGGRTHISGRLQSRFNLINMTFPAESQIKHIFGTMINQKLQE-FQEEVKPIGSILTQATLELYYAISARFLPTPAKIHYLFNLRDISKVFQG--LLRS----HRDFHDTKQSITRLWIHECFRVFSDRLVDQADTEAFVALLA--------EKLGSLF-DLTYHNICPNK---QQPIFGDFLK------------------EPHVYEDLLDFKALKGFMESQLEDYNLTPGVVPMSLVLFRDAIEHVTRVVRVISQPRGNMLLVGIGGSGRQSLSRLAAYICEYMVFQVEVTKQYRKQEFREDIKKLYRLTGVDNKPTVFLFNDTQIIDESFLEDINNILSSGEVPNLYKSDE--FEEVQSALSDSARKENVLETADAMFNYLIERVRNNLHIVLCMSPVGEPFRNRIRQYPALVNCTTLDWFSEWPQDALLEVAERYLDGLILGNVEKIQTKVARIFVTMHQSVAQFSQRMKLELKRHNYVTPTNYLELVSGYKKLLAEKRAELGEQVSKLRNGLFKIDDTRSKVEAMSVELEDAKKKVAEIQKQCEEYLVVIVQQKREADEQQMAVSAHSEKIGAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGCEPT-------------WAEAKRQLGESNFIKQLVHFDKDNISDRVLKKIG-QYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKRARLHGAMTQLAEKQAALAEAENKRREVEEKLKQLKNQYDEKLNQKEDLRKKSEDMELKLDRAGKLVSGLAGERVRWEQTVESLEKDMGYLVGDCLLAAAFLSYMGPFLSNYREELLTNIWMKQFRDLEVPCSPGFNFAT--FLSKPTAVRDWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMESKRG-LKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSFTHIGGRVLLKLGDKEVEYNPDFQFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVSDQLETSEQTEIKIDTAREAYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNLSIEKSQRSHKLEERIINLNDYHTYAVYRYTCRGLFERHKLLFSFHMCAKILEVAGKLNMDEYSFFLRGGLVLDKEGQMDNPCTSWLADSNWDNITELDKLANFHGLMSSFEKYPKDWHQWYTSSEPENAPLPGEWETVCNELQKMLIVRSLRQDRVSFCVNSFIINNLGSRFVEPPVLDMKAVMEDSTTKTPLIFVLSPGVDPTGALVQLAEASGMGPS-FHALSLGQGQAPIATRMIKEGVKNGHWVFLANCHLSLSWMPQLDKLVEQLQVEDS--HPDFRLWLSSSPHPEFPIAILQAGIKMTTEPPKGVKSNMKRLYQ---LVTESQFSRCSRPVVYRKLLFSLCFFHSILLERKKFLQLGWNIVYSFNDSDFEVSENLMSLYLDEYEEIPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCEGAVNTPFFKLSSLPTYYIPRDGSQ-DTYREYIRQLPPVEHPEVFGQHPNADIASQISETRTLFDTLLSLQPQVTSTTATGAGPSREDKVLEISADVRQKVPELVDYESTQ---KLLQDDPSPLNVVLLQEIQRYNALLHTIRTSLTELEKGIKGLVVMSSSLEEMFQCIHDARVPPLWEK-AYPSLKPLASWTRDLCQRVEQFAHWAETAHPPVLFWLSGFTFPTGFLTAVLQSSARQHNVSVDTLSWEFIVSTVDDNNLLFPPKDGVFIRGLYLEGAGWDKKNSCLVEAEPMQLVCPMPTIHFRPVENRKKVAKNMYSCPCYYFPVRSG----GAGRPSFVVGVDLKSGAVSYEHWIKRGTALLMSLDN 4407          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Cavefish
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 1748.41 bits (4527), Expect = 0.000e+0
Identity = 1150/3404 (33.78%), Postives = 1846/3404 (54.23%), Query Frame = 3
Query: 2445 KLNECIEE--KKQINQEELLLSTGV-QTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPY----KETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTE----ETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQI-SRCQWVQDWPGQVVLAASAVHWTE------QATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMA---LGDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFRE-HASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFI---------GRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIF---MKKQFGCWTTWQSLIEK----PDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDF-LFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDR-KDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRK-LMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVI--MCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECV-ELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEP--FKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYED-----VQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPL----TESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKE-ISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKY-PVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECH---EYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGL 12476
            +L  C EE  K +  +++L+ +  +   P     E+L ++     L +    +     +W     + ++ + ++  T+   K+  +L      P+    M  A  ++ ++++FK +LP++  L N  L+ R+      ++           L D   +G  + ++++++                     W+ + FS   Y    +E G  IL +VD+IQ  L+D+ V   +M  S FIGPF + I  W+K L  + + +  W+ VQ  W+YLE IF   DIR Q+P E  +F+ +D+ ++ IM+    D  +       N L DLQ+    LE+ QK LNDYL+ KR  FPRFFF+S++ELL IL  + +P  VQ H+ K ++ I+ L+F      ETV   ++SAE E ++      P+ AEG VE W+  V   M+ + R + K+A+  Y Q  SR  W+ D+ G VVLA + V WT       Q  ++ +   ++++ KK  QQI ++V  +  + LK   R  L   +++DVHARD+V   +   ++   +F W SQ+R+YW      +   D+L +R  + E  YGYEY+G   RLVITPLTDR Y TL  A+ + LGGAP GPAGTGKTE++KDLAKA+   CVV NC +G+DY ++GK F GLAQ GAW CFDEFNRI+  VLSVI+ QIQTI+ A+  QL+ F FEG E+ LD    IFITMNPGYAGR+ELP+++K LFR V ++VPD   I EI L+S GF+ A+ LA K+  +Y+L  EQLS Q HYD+G+RA+KSVL  AG+LKR    L E+ V+++++ D+NLPKF+  D+PLF G+ISDLFPG++ P + Y +    +   L   K   +P  +DK++Q+YE ++ RH  M+VG +  GK+     L  A   LG L K            +NPKA+S+  LYG  D V+ +W+DGIL+  FR+ +  ++  ER++I+FDG VDA+W+ENMN+V+DDNK L L +GE I++ N   ++FE  DL+ ASPATVSRCGM++++P  L   P  + W+    P+     ++  ++ LF   +P  ++ +         G K K+ V    L +V  +    S +LD                               +    ++  EE   F I   + SL     A+L+   K   D   +  C ++    +    P  +       +P   T+FD  F    KK    W  W SL+ K    PD       T+  +IL+PTVDT R  + L +++K  R P++ VG +GT K+A  + F L++L N DF +  ++ FS++T+S  +Q S  + +++R +  Y PP  K+L+VF+DD++MP  ++YG Q P+ +L+ L+D    +DR K+     ++D+   +AM      R  V SR +  F++  I   ++E +  I+  I+  H    FE  ++ +   +   T +++++++    PTP+K HY+FNLRD SRV  G      + L N  +  +  + +R+W +E  RVF+DRLI+  D  L    IK +++  F  +                ++ MR  ++FGD+              T   E E ++Y +I D +A     Q  L+EYN  +K  M+LVLF  A++H+ R+ R++R   GH+LLVG+GGSG+QS  KLA F    ++F+I ++R YS S++R+D++ L    G +   T FLF D  + E  FLE IN +L SG +P LF ++++  ++ +++    +        ++  Y  FI +   NLH+VL  SP+GD   +R RNFP L+N   I+WF  WP  AL  VA   L E  +      + VI  +C   H SV + S  F + + R NYVTP +YL+ I T+  LL  K   I+   +R   GL+KLE +  Q++ +  +L   +  L E S   E L++ I T T   E+ +K+ +E+      + +     K D ES+LAEA+P + AA  AL  L ++D++ +++   PP  V++V E + +++G K            E  W TAK ++ +  FL  L   D D+I    ++ +R  ++ N      +++ IS A  G+  +V AV  Y  + + + PK+EK+A  E  +     +L+  Q EL  ++ +L  L E +     EK  L+   +L + ++  A+KLI+GLG E  RW + + +L  +   ++GD L+ A  ++Y G F   +R E V E+WQ +     IP+S         +L D V +  W    LP D  SV N ++ T  +R+ + IDPQ QA  WIKK E + N L++   +D  +L+ LE  +++G P L ++V E +D V+++VL K        + I LGD  V+Y  +F+ Y+ T+L NP Y P    K  ++N+ +T  GLEDQ+L ++   E+ ELE++R +LI E++ N+R LK++ED +L+ L+TS GN+L++ + +  L  +K  + ++  K + A  T  +I+ +R+GY+P A  G+ILFF ++++A ++ MYQYSL+ F+ ++ +S+  S  +S +  RL N+ +  T  VY   C  LFE+ KLLFSF + I I + + +  +    F L G +SL+  ++    DWL ++ W ++  L+ L P  F   ++D   N ++WK+  D  +P    FP  + + L+  ++L+++RC   ++V  AV  Y+   +G +YV+PP    E  F++S   +PI+F+LSPG +P +DL + AE        LK +++GQGQ  +A   +  ++    W++LQNCHL   WL +L K  E +    ++ +P+FRLWLT+ P   FP+ +LQ S+K+  EPP GL+ N+  +Y    +   +   +   P  +  L++ L FFHAVVQERR YG IGWN+PY+FN+SD  + +  L  ++    +     +   +L YL GE  YGGR  D+ DRR I+++    Y  + +     P      +   Y +P   S    Y+  I+  P    PEVFGLH NAE+    Q    ++  ++   P+   SG   S    I  +A DI +KLP  F ++ I  K  P +     + VL+QEL RFN+L+  + +SL +L+ A+ G + M + L+EV R++  G++P++W + +  +LK LG+++     R + + +W++ G+P   W+SG +  +S+LT ++Q   RRN   +D+      +       E ++   +G ++ GLYLE   W VE   L+ S  K L   LP++ ++P     +  +N+   PVY T+ RR  +         VF   L +++   HW+ +G+
Sbjct: 1121 RLRYCSEELAKIEAGRQDLVGAEKLFDLPITTYPELLNVQREMRALRQIYEVYKAAKTEWSQTLWVNLNIQLLQEGTEGFIKSLRKL------PKDVRAMPVAFFLEGRMKEFKESLPLLLDLKNEALRDRYLFLHCYRLYL---------LKDWSLIGSPQGVKEVVDT--------------------WEVMKFSVQRYFKGTQERGY-ILGSVDEIQQNLDDNAVNLQSMAGSRFIGPFLNVIQQWEKNLSLISEVIEVWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDHIDKMFKKIMSDTVRDPGIKRCCLVPNRLSDLQNLSDGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSEPACVQEHMIKMYDNIASLRFDSGTNGETVAGALVSAEGEVMELKQ---PVPAEGRVEDWMTAVLLEMRRTNRLITKEAIFYYCQKKSRVDWMLDYQGMVVLAGNQVWWTWEVEDVFQKMSSGEKQAMKQYAKKMHQQIDNLVRRI-TQPLKKNDRRKLNTVLIIDVHARDIVDSFVRDSITDAGEFEWESQLRFYW------DKKPDDLFVRQCSAEFSYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALILQLKRFQFEGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLLAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRGSPDLNEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPNFNDAVETILEENKYSLLPNQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQAQTRLGLLTK---------MYALNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINRPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWQKWVNSRPPK-----EQADLRKLFEKYVPSIIEMVVEGITDGKQGEKLKTIVPQTDLNMVVQL----SMMLD------------------------------ALLEPEDLSSEELECFFIEALYCSL---GAALLETGRKKFDDLVKKLSCLVSVQDEKTLAGPGEIPG----YLP---TLFDFHFDGTTKK----WMPWSSLVAKYIHNPD-------TKFIDILVPTVDTTRVNWLLEQMVKVKR-PVVLVGESGTSKTATTQNF-LNNL-NPDFTMVLTINFSSRTTSMDLQRSLEASVEKRTKETYGPPMGKSLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNCKQLKDLGFIAAMGKAGGGRNEVDSRFISLFSVFNIPFPEEEALHLIYSSILKGH-TRPFEECIRNMCDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYNG------LTLTNAERFLTEAQFVRVWRNECLRVFYDRLINETDKALVQGHIKSLIQEHFGSEL---------------DSAMRDPILFGDY-------------RTALSESEPRVYEDIQDYDACKALFQEILEEYN-ENKTRMNLVLFDDALDHLTRVHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGCDVFEIVLSRGYSESNFREDLKTLYVKLGIENKRTVFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLNQIRDEAVKMGSGHSKESVWQY--FINKSASNLHIVLGMSPVGDVLRTRCRNFPGLVNNTGIDWFLPWPPQALHAVAQSFLGESPMIPAAHSETVIGHVCM-VHGSVGEFSTLFQQKLRRSNYVTPKNYLDFISTYSTLLQDKDQFILAQCKRLEGGLDKLEEASVQLADLNKKLAEQKVVLAEKSSACESLLQEISTNTAIAEEKKKLAEEKAKEIEEQNKVILVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFAKPPKQVQVVCECILVMRGHK------------EINWKTAKGMMSEANFLRSLMEMDCDSISGGQVKTVR-GFLKNLNTSSEEMQAISKAGSGMLKFVEAVMGYCDVAREIKPKREKVARLEKNFFQSKRELEKIQSELEAIQKELGALGEKYSAAMGEKQLLQEEAQLMERRLIAADKLISGLGSENQRWTEDLEELKKKRVRLLGDCLISAAFLSYEGAFNWDFRNEMVYEVWQKDVLERGIPLSQPFRIES--LLTDEVEISRWGSESLPPDELSVQNGILTTRASRFPMCIDPQQQALNWIKKKEEK-NNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNVKGAEGRQVIVLGDKEVDYDPNFKLYLNTKLANPKYSPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLIQETSQNKRLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKSKAGEVFEKLKLAETTSADIDKLRDGYRPAAKRGAILFFVLAEMALVNSMYQYSLASFLEVFDYSLRKSLPNSILPKRLSNIMNTLTLNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQEELEFFLKGNLSLEKSKRKKPCDWLPDQGWEDIVRLNELFPNEFGALIEDIEKNPKEWKNWFDLDSPEQAPFPMKYRDSLTVFQKLLLLRCFRVDRVYRAVSDYVTATMGEKYVQPPVISFEAIFEQSTPNSPIVFILSPGCEPANDLMKLAERSGFGTNRLKFLAMGQGQEKVALQLLETAVSRGQWLMLQNCHLLVKWLKDLEKALERI----TKPHPDFRLWLTTDPIRDFPIGILQKSLKVVTEPPNGLKLNMRATYFKIQL---ETLMSCPHP-AYRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILNTYLTKAHNQGEGSIPWGSLKYLIGEVMYGGRAIDSFDRR-ILTVYMDEYLGDFIFDTFQPFHFFHNKDVDYRIPPDGSK-EVYVEEIESLPLANTPEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGDSGGGISRDEYIAQVARDIQNKLPSAFDLDVIRKKLGPDV--SPTSVVLLQELERFNRLVLRMSRSLSELQRALAGEVGMSSELDEVARALFNGQIPAIWRKLAPDTLKSLGNWMIHFRRRHQQYSSWVEVGEPAVMWLSGLHIPESYLTALVQATCRRNGWPLDRSTLYTHVTHYRSEDEVTEKPGQGCYVSGLYLEGADWDVEQGCLVRSKPKELVVQLPILKVIPIEAHRLRLQNTLRTPVYTTSMRRNAM-----GVGLVFEADLFTTEHHSHWVLQGV 4333          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Cavefish
Match: DNAH11 (dynein axonemal heavy chain 11 [Source:HGNC Symbol;Acc:HGNC:2942])

HSP 1 Score: 1496.1 bits (3872), Expect = 0.000e+0
Identity = 1020/3147 (32.41%), Postives = 1627/3147 (51.70%), Query Frame = 3
Query: 3147 FESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIF-GSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEE-TVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHT------LEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKD-NTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHF-NSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLL-VGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEV-EIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKL-MEDYWPTAKKLLGDLK-FLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVE-LWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLF--SFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSP--TNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPS-----SVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTS----DLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTI---IEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWI-DNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDF--DFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAAL 12485
            F +++      L R +  L  WL+VQ  W +LE +F GS DI+ Q+P++   F  ++  ++ +M K      V+       LLE L+  +  L   +K L  YLE KR+ FPRF+F+S+ +LL+ILS    P +V PHL K F+ ++ L F++E T   G+ S E E +    D    +  G VE W+ +VE  M+  +R  + +A+  Y +  R  W  + P Q VL AS + W      A +  T      L ++ KK   Q++S++ ++  E L    R  +     LDVHARDVV++L+  +VSS   F W+SQ+R+ W  + K      +   ++  T+  Y YEYLGN  RLVITPLTDRCY TL  ++ LN+GGAP GPAGTGKTET+KDL +A+     VFNCS+ +DYKS+G  FKGL Q+GAW CFDEFNRI +EVLSV+A Q++T+Q A+R +   F+F   E+ L  S  +FITMNPGY+GR+ELP+NLK LFR  AM+VPD  LI EI L + GF+ A+ L  K + +Y LC E LS Q HYD+G+RAVKSVL  AG+L+R  +   E++V+++++ D N+PK +  D+P+F G++ DLFPGVE       D   ++ +    +KL+P   F+ K+ Q+ E++ VRH + +VG +  GK+   + L           N +   +++ +NPKA+S   L+G     + EW DG     F    S E                W ++        ++ C +S                  L  ++PATVSR G++Y+ P  L  +  +  WI        D  QR T +     L    +     + ++  K  +L    +M+Q   SLLD +                             +T EN  +   R  + + +F  + IW+FG    +D    +   F          +Q +     +K  +++ +P   T+FD  ++  Q   +  W   +    L+       +  +L+PTV+TVR ++FL  +L  G +P+M VG TGTGKS++I+  +LD+LP+ DFL  S      TSS  +Q      L++R    Y PP  + LV FIDD++M   + YG   P  ++RQ +D+  W+D +     LII    I  A   P A    +  RL RHF+++ ++    ET+  IF PI+  H  N  F  ++  +   +V A   +  +   HFLPT     +VF+L D SR+ QG L  +   +K   +      L++LWVHE+ RV+ DR     D +LF++L                     TD  R    +   L         ++P   L  G  + E    +Y  +   E L   +   L  YN +  + M+LVLF+ A+ H ++       P+ H++  VG+GGSG+QS  +LA    + ++FQ  + R Y + + + D+  L   TG K + T  L  D QI +  FL  ++ L+ SG++P +   E+            + + + +  T  N +  F ERVR+ L +VL  SP+G++   R++ FP+L++C T++WF  WP+ AL  V+   L E+  I+  V+E I +   H H S     +++ +   R  Y TP S+LEL++ +  LL ++   +     R   GL+KL+ +  Q+  ++ +L + +  L   +   E LI  I  +T  V + R+    EE        +    + DCE++LA+A P + AA  AL+TL + +++ +K   NPP  V  V+ AV +L          P G++  E  W  A+  +G +  FL  L SYDK+ IP+  +  ++ +Y+++P F P  +   S A  GLC W   +  Y  +   V+PK++ L+ A +   +  A+L   + +L +++  L  L   F+    EK   +  +  T   I+ A +L+ GL  EK RW + + +L  +   + GDVLL A  V+Y G F+  YR++ +E  W+   + +S PV          +L D   V  W   GLP D  SV+NA I+T + R  LL+DPQ QA KW++ L      L +++   KGY+ ++E  L  G   L+EN+ E+LD VLE +L + T  +++   + LG    +     R  + T+L NPH+ PE   + TL+NF +T  GLE+Q+LG V ++E+P+LE  + +L I+    R +LKE+ED++L  LS ++G+ L+D   +E L  +K  +  I  K   A + E +IN  R  Y+PVA   ++L+F I +L S++P+YQ+SL  F  +++ +IE++E   D+  R+++L    T +V Q+I R LF++D+L F       + + +G  +V+EL     L    S  SP       +LS ++W  +  LS LE F G  +D   + ++W+ +V+S+ P  E+ P DW+++ S +++L+++R + P+++  A+ +++   LG EY++    + E  F+ES S++PI F+LSPGV+P++++         S    NL  VSLGQGQ  +AE  +  +    +W+ILQN HL   WL  L  + E   L     +P +R++LT  P+      + P  +L+NS+K+TNEPP G+ A+L  + +     ++D  + S   Q F+ LLFSLC+FHA V ERR +G  GWN  Y FN  DL IS   L   +     V  E L YL GE  YGG +TD  DRRL  + L  +++ +L   E F        L P   +    D   Y  ++    P   P ++ LH NAE+      ++ LF ++L   P++ +   +S Q++   + D    +L KLP+ + + E+  K        +  V +QE  R N LI  +  SL++L  A++G + +   +E +  ++  G+VP +WS+ ++PS K L  + SD++ + +    W  D   P   W+SGF+  QSFLT ++Q+ AR+N   +D++    D       +Y  P  EGA++HGLY++  RW      L E+  K L   +PV+ I       +  +N+Y CPVY+T  R   L         ++   L +      W+  G+A L
Sbjct:   38 FHAQVLVLQTRLSRAECVLMLWLEVQRRWAHLESVFIGSDDIQHQLPVDALHFLSINTDFKDLMYKSAETKNVIEATNKPGLLETLKDLQMRLAVCEKALAKYLETKRMMFPRFYFISSTDLLDILSNRTQPKQVTPHLAKLFDSVADLHFSQEGTEAVGIFSGEREYLPL--DTL-CDCTGPVEVWLGRVEEVMRAGVRRQIAEAVGAYEERPRELWALERPAQAVLTASQIWWAADVELAFQRVTEGFDTALRDYSKKQTAQLTSLISMLTGE-LSPGDRQKIMTVCTLDVHARDVVSRLVDQKVSSAQAFTWLSQLRHCWDEDQK------HCYAKICDTQFLYSYEYLGNKPRLVITPLTDRCYVTLTQSLHLNMGGAPAGPAGTGKTETTKDLGRALGVMVYVFNCSEQMDYKSIGNIFKGLCQTGAWGCFDEFNRIAVEVLSVVAVQVKTVQDALRHRKTRFVFLEEEISLKPSVGVFITMNPGYSGRTELPENLKALFRPCAMVVPDMELICEIMLMAEGFLNAKLLGRKFITLYNLCKELLSKQDHYDWGLRAVKSVLVVAGELRRGDKASPEDQVLMRALRDFNMPKMVMEDVPVFLGLVGDLFPGVEVQRQMDSDFEELVRQSALELKLQPEDPFILKVAQLEELLSVRHSVFVVGGAGTGKSQILRTLYRTYA------NRKQKPVWNDLNPKAVSTDQLFGFIHPATREWKDGTDFCCFEFRFSRE----------------WRDSSRV----RRRCCEISA-----------------LRNSTPATVSRAGILYINPQDLSWNMYVNSWI--------DRRQRQTERAHLTILFDKYVSRCIEQIRNSFKTITLVPENSMVQTLCSLLDGL-----------------------------LTPENVPVDSPRDVYEM-YFVFACIWAFGGATHQDQLRDYRAEF----------SQWW-----VKEMKSVKLPAHATVFD-FYLDPQTRRFVPWAERVPGFQLE---ADALLQGVLVPTVETVRLQYFLRLLLDRG-QPVMLVGGTGTGKSSLIRN-LLDTLPD-DFLSISAPLHYYTSSSSLQRLLERPLEKRAGRSYTPPGSRRLVYFIDDMNMTAADCYGTVQPHALIRQHLDYTHWYDTQTLRMKLIINTQYI--ACMNPQAGHYTINPRLQRHFSVLTMNSPSRETLSSIFSPILIQHLQNQSFSPSVASIGPALVQAAIALHNTASCHFLPTAKNFLHVFSLWDLSRLFQGLLFSRPECVKRGCE------LLQLWVHESRRVYSDRFTDPADQNLFYKL--------------------QTDAARQACEQEPGL---------QEPVVYLHYGGGAAE---PMYAPVLGWEELSSILNEALHSYNQLYSS-MNLVLFQQAMLHPSQ-----HPPSLHNIHPVGVGGSGKQSLTRLAAHFSNMDVFQPTVHRGYGLQELKVDLAGLCVKTGVKNLPTVLLLTDAQIPDDRFLNILSALI-SGEVPEVLSEEE--VDGVVRGVKTEVRALGLLDTTENCWRFFKERVRQQLKVVLGVSPVGNSLRVRVQRFPALLSCTTVDWFHEWPQKALHSVSLHFLRELPAIEPTVQEPISLFMAHAHASARQAGERYRQSERRHYYSTPRSFLELLRLYGVLLGERNQLLQEKLHRLHSGLQKLKTTAVQVEELKAKLNSQEVDLNVKNGAAEALISKIGQQTERVSQKRRDADLEEQKVAAIQAEVTLRQRDCENDLAKAEPALEAATTALNTLNKVNLTELKTFPNPPKAVMNVLAAVMVLLA--------PRGRIPKERGWKAARAFMGKVDDFLQALVSYDKECIPDQCLTVVKQEYLSSPDFLPEHVLTKSYAAAGLCAWTINIVRYYEVYCEVAPKRQALSQANTELDSATAKLFSIRKKLDDLDGHLQNLTAQFERAAGEKLRCQEEVTHTSTTIQMANRLVGGLQSEKVRWSEAVLELEAQQGALCGDVLLAAAFVSYAGYFSQPYREQLLENSWRPFLRQLSPPVPLTEGLDPVLLLADQASVAAWHNQGLPADRLSVENATILTRSQRCPLLVDPQQQAGKWLRNLYGP--GLRLVQHGQKGYVELVEEALACGEAVLIENLEEKLDPVLEPLLNRTT--RNSGRSVGLGAQQHQNPSSVRLILHTKLANPHFPPELQAQTTLINFTVTHAGLEEQLLGQVVSRERPDLENLKLELSIQQNLCRIELKELEDELLTRLSAAEGSFLKDAVLVEQLEHTKTTALHIHSKVVEARENELKINAARELYRPVAQRAALLYFIIKELHSINPLYQHSLQSFSAVFLRAIEDAEADEDVSARVRSLTQSLTYSVLQHINRGLFQRDRLTFLTHTTFQVLLMEGHIEVEELNLLLHLPAESSSGSPV-----SFLSAQAWGNIRALSVLEAFWGLDRDVEGSAKRWRKLVESECPERERLPLDWKKK-SSMQKLIILRAMRPDRMSYALRNFVEESLGCEYLDAGKVEFEKVFEESSSLSPIFFILSPGVNPLTEVETLGLKLGFSTEQGNLHSVSLGQGQEGVAEKALEAAALKGHWVILQNVHLVKHWLVRLSDLLE---LSGRNADPQYRVFLTGQPAPSPDQHIIPRAILENSLKLTNEPPTGMSASLHAALSNF---NQDTLEMSSHEQEFKLLLFSLCYFHACVSERRKFGPQGWNCCYPFNTGDLSISTSVLYNCLEANSKVPWEDLCYLVGEIMYGGHITDELDRRLCRTQLQELFNPKLFEGELF--------LCPGFPAPPDLDYAGYHRYVDETLPAENPSLYSLHPNAEIEFMTVTSDSLFRTLLELQPRDSALREESEQSVEEMVRDELEQLLEKLPEEYDLAELLAKTDRRSPYIL--VCVQECERMNLLISEMHTSLMELDLALKGELSISPHMEALQTALFYGRVPEIWSRLTFPSTKSLAPWFSDVLVQCRELDTWTQDFVLPAVVWLSGFFNPQSFLTAIMQSIARKNNWPLDRMALCVDVTRKTKDDYGHPPREGAYVHGLYIDGARWDCSAGVLSEAVLKDLTPAMPVLYIRAVPADQLELKNTYECPVYQTKLRGPTL---------IWNFHLKTRHPPAKWVLAGVALL 2979          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Cavefish
Match: ENSAMXT00000016172.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:1379218:1548247:-1 gene:ENSAMXG00000015711.2 transcript:ENSAMXT00000016172.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1115.91 bits (2885), Expect = 0.000e+0
Identity = 711/2171 (32.75%), Postives = 1148/2171 (52.88%), Query Frame = 3
Query: 6063 RNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFN-SGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVE-IKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDY-WPTAKKLLGDL-KFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVE-LWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVD----ELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLS--PTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSS-----VFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLY-----SVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEIS---GESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNW-IDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECH--EYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQL 12494
            + +  P +GT+FD+ ++  +   +  W  ++ + ++D  I    +   L+ T +T+R  +F+ R+L+  R+PIM VG  GTGKS ++    L SL    +   ++ F+  T+S  +Q      L+++    Y PP  K L+ FIDD++MPE + YG   P  ++RQ +D+  W+DR       I  V   S M  P++    +  RL RHF++ A+     + +  I+  I+  H +  GF   +++    +V    D  Q V A FLPT  K HY+FNLRD S + QG L  KS  +K  T +D    L+++++HE+ RV+ D+++  +D   F +L  ++V            G F  D +          M+  F     +P                 Y  +   E+L +T+   LD YN ++ A M+LVLF  A+ HI RI R+L  P G++LLVG+GGSG+QS  +LA FI   E+FQI + + Y ++D + D+  L    G K I T FL  D Q+ +  FL  +N LL SG+IP+L+ +++            + +   +  +  N +  FIERVR+ L + L FSP+G     R R FP+++NC  I+WF  WP++AL+ V+ + L EVE I+ +V++ +     + H SV+  SK +     R NY TP S+LE IK + NLL  K+ ++    ER   GL+KL  +  Q+  ++ +L A +  L + +++ ++LI+++  ET +V + + V  EEE      A      + DCE +LA+A P + AA EAL+TL +N+++ +K+  +P   V  V  AV +L          P G++ +D  W  AK ++  +  FLD L +++K+ I E  ++ I+  Y+ +P F P  +   S+A  GLC WV  +  +  +   V PK++ L  A +   +   +L V + ++  +   LAKL   F+    +K   +   E T   I  A +L+ GL  E  RW + +++   +   + GDVLL    V+YLG FT  YR E ++  W+     + +P+         S+L D   V  WQ  GLP D  S +NA I+TS  RW L++DPQ Q  KWIK      + L+VI++  +GYL  +E  L  G   L+EN+ E +D VL  +L ++T K+    YI++GD   EY+  FR  + T+L NPHY PE   + TL+NF +T  GLEDQ+L  V + E+P+LE+ +  L  +    +  LK +ED +L  LS++ GN L D + +E L  +K  + +I  K + A  TE +IN  R  Y+P A   S+L+F ++DL  + PMYQ+SL  F  ++  ++  +     ++ R+ NL    T +V+Q   R LFE DKL ++  L   I     +++    + + R+ +  G++      +PV D+LS  SW  +  L +++ F+   +D   + ++WK  V+ + P  EKFP +W+ + S L++L ++R L P+++  A+  ++   LG +YV   + D  +SF+ES + TP+ F+LSPGVDP+ D+ +       +    N   VSLGQGQ  +AE  +  + +  +W+ILQN HL   WL  L K  E+     S+   NFR+++++ PSS     + P  +L+NS+K+TNEPP G+ ANL ++       ++D  +   R   F+ +LFSLC+FHAVV ERR +G  GWN  Y FN  DL IS+  L  ++     V  + L YL GE  YGG +TD+ DRRL  + L       +   EL L+  FPL  +  Y         N Y  +I    P  +P ++GLH NAE+    Q + +LF ++L   P++     G   S    ++ +  + L KLP+ F + E+  K  V        V +QE  R N L + I++SL +L   ++G + M N +E +  ++ + +VP  W++ +YPS+  L  + +DL+ RI+  ++W  D   P   W++GF+  QSFLT ++Q+ ARRN   +DK+     +++ +  ++S P  EGA++HGL++E  RW  +   ++++  K L   +PVI I           N Y CPVYKT  R            YV+T  L + +    W   G+A L Q+
Sbjct: 2246 KTIKFPSQGTVFDY-YIDPETKKFEPWSKMVPRFEMDPEIP---LQACLVHTTETIRVSYFMERLLER-RRPIMLVGNAGTGKSVLVGG-KLGSLDPDKYTIKNVPFNYYTTSAMLQAVLEKPLEKKAGRNYGPPGSKRLIYFIDDMNMPEVDAYGTVQPHTLIRQHMDYNHWYDRSKLQLKEIHSVQYVSCMN-PTSGSFTINPRLQRHFSVFALSFPGVDALNTIYCSILGQHLSREGFSAVVQKSGPQLVQLALDFHQRVTATFLPTAIKFHYIFNLRDLSNIFQGMLFCKSECMK--TPQD----LVKVYLHESNRVYRDKMVEDKDFSTFDKLQSEMV------------GKFYEDMEEALEEAKVMNMYCHFALGIGEPR----------------YMPVQSWESLNKTLLEALDSYNEVNAA-MNLVLFGDAMSHICRINRILESPRGNALLVGVGGSGKQSLTRLAAFISSLEVFQITLKKGYGITDLKSDLGALCIKAGVKNIGTVFLMTDAQVADEKFLVLVNDLLASGEIPDLYPDDE--VENIINSVRNEVRGQGLLDSRENCWKFFIERVRRQLKVALCFSPVGSKLRVRSRKFPAVVNCTVIDWFHEWPQEALESVSLRFLQEVEHIEPEVKDSVSKFMAYVHVSVNKTSKDYLANERRYNYTTPKSFLEQIKLYRNLLALKRKDLTMKMERLENGLQKLNSTSAQVDDLKAKLAAQEVDLKQKNEDADRLIQVVGVETEKVSREKAVADEEEEKVASIAVVVTRKQKDCEEDLAKAEPALIAAQEALNTLNKNNLTELKSFGSPVAAVTNVTAAVMVLMA--------PGGRVPKDRSWKAAKVMMAKVDAFLDSLMNFNKENIHENCLKAIQ-PYLQDPEFKPELVAAKSNAAAGLCSWVINIVKFYEVYCEVEPKRQALNKANAELASAQEKLSVIKAKINHLNENLAKLTAKFEKATADKLKCQQEAETTARTISLANRLVGGLASENVRWAEAVNNFKQQERTLCGDVLLITAFVSYLGYFTKRYRHELMDNTWKPYLSQLKVPIPVTPGLDPLSMLMDDADVAAWQNEGLPADRMSTENATILTSCERWPLMVDPQLQGIKWIKN--KYGDNLQVIRIGQRGYLDSIERALSAGEVVLIENLEEAVDPVLGPLLGQETIKKGR--YIKIGDKECEYNPRFRLILHTKLANPHYQPELQAQCTLMNFTVTRDGLEDQLLAAVVSMERPDLEELKSNLTKQQNGFKITLKTLEDNLLSRLSSASGNFLGDTELVENLEITKRTAAEIEEKVKEAKVTEAKINEAREHYRPAAARASLLYFIMNDLNKIHPMYQFSLKAFSVVFQKAVLKAAPDEALKQRVLNLIDSITSSVFQYTTRGLFECDKLTYTAQLAFQILLMNKEINPSELDFLLRYPVQPGVT------SPV-DFLSHHSWGGIKALCSMDEFRNLDRDIESSAKRWKKFVECECPEKEKFPQEWKNKTS-LQKLCMMRALRPDRMNYAIRDFVEEKLGSKYVMGRSVDFAVSFEESGAATPMFFILSPGVDPLKDVEKHGRTMGYTFDNQNFHNVSLGQGQEVVAEQALDLAAREGHWVILQNIHLVAKWLGTLEKKLEQHGEGSSQ---NFRVFISAEPSSSPEGHIIPQGILENSIKITNEPPLGMHANLHKALDNF---NQDTLEMCARENEFKSILFSLCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVNVLYNYLEANSKVPYDDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFIKPEMMEGELYLAPGFPLPGNMDY---------NGYHQYIDDALPAESPYLYGLHPNAEIGFLTQTSEKLFRTVLEMQPRDAGSGEGSGTSRDEKVKAVLEETLEKLPEEFNMVELMGK--VEERSPYVVVALQECERMNILTQEIKRSLKELNLGLKGELTMTNDMENLQNAIYLDQVPDSWTKRAYPSMCGLALWFTDLLNRIRELESWSSDFNLPPAVWLAGFFNPQSFLTAIMQSTARRNEWPLDKMSLQCDVLKKNREDFSSPPREGAYVHGLFMEGARWDTQAGVIVDARLKELTPAIPVIFIKAVPVDKQETRNVYQCPVYKTRQR---------GPTYVWTFNLKTKENPSKWTLAGVALLLQI 4325          

HSP 2 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 406/1094 (37.11%), Postives = 611/1094 (55.85%), Query Frame = 3
Query: 2535 QEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLED-LMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIF-GSADIRRQIPIEGGQFEIVDEKWRTIM---NKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEET------VITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIK------SHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLL 5765
            +E+  +KE +D +  S V F+   + W   P  E++ EE+E E +   K    L K      +       +T+K  L     +L  I  L NP ++ RHW  +    G   +   +      L      H ED +  +  +A KE  +EK    +   W  + F +  +  T V +L + +D+   LED+ V+   + +S  +  F  E++ W K L      ++ W +VQ  W +LE IF GS DIR Q+P +  +FE +D  ++ +    +K  N  +  N     + LED+Q   AL E   K L +YL+ KRL FPRF+F+S+ +LL+ILS   DP +VQ HL K F+  +K+KF  +          GM S E E V F     P +  G VE W+ +V   M+ ++R  M +A+  Y    R QW+ D+P QV L  + + WT     A         + ++E+ KK   Q+++++ ++  + L    R  +     +DVHARDVVAK+++ +V +   F W+SQ+R+ W    K   +N      +   +  Y YEYLGNT RLVITPLTDRCY TL  ++ L + GAP GPAGTGKTET+KDL +A+     VFNCS+ +DYKS G  +KGLAQ+GAW CFDEFNRI +EVLSV+A Q+++IQ AIRD+ + F F G E+ L  S  IFITMNPGYAGR+ELP+NLK LFR  AM+VPD+ LI EI L + GF+EAR LA K + +Y+LC E LS Q HYD+G+RA+KSVL  AG LKR      E++V+++++ D N+PK +  D+P+F G+I DLFP ++ P     D  + + E +  +KL+    F+ K++Q+ E++ VRH + +VG +  GK+   K+L+          N++   ++  +NPKA++   L+G  +  + EW DG+ +   RE A+      KWI+ DG +D +WIE++NTV+DDNK L L S E I +     ++FE   L  A+PATVSR G++Y+    LG +P +  WI +   +     ++  + +LF+  +P  LD +  + K  +      +V  +  L   LL
Sbjct: 1136 KEVSILKELWDVV--SVVRFN--LEAWRTTPWREINVEEMELECKRFSKELRLLDK--EARAWDAFCGLDSTVKNTL----TSLRAIAELQNPAIRPRHWQQLMTATGVRFS-MDEDTTLTDLLNLNLHHFEDEVRAIVDRAVKEMGMEKVLTELDATWTAMEFGYESHPRTSVPLLKSDEDLVETLEDNQVQLQNLMSSKHVAFFLEEVSSWQKRLSVADSVISIWFEVQRTWSHLESIFIGSEDIRSQLPEDSKRFEGIDTDFKELAYDAHKTPNVVEATNKPGLYSRLEDIQGRLALCE---KALAEYLDTKRLAFPRFYFISSADLLDILSNGTDPHQVQRHLSKLFDNTAKMKFETDADGKPSKTGIGMFSKEEEYVPFNE---PCDCTGQVEMWLNRVLDTMRATVRHEMTEAVVAYEDKPREQWLFDYPAQVALTCTQIWWTSDVGLAFSRLEEGYENAMKEYYKKQVSQLNTLITMLIGQ-LSPGDRQKVMTICTIDVHARDVVAKIIAQKVENSQAFVWLSQLRHRWDEREKHCFAN------ICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRDKKKRFNFMGEEINLFPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFIEARLLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPERPEDQVLMRALRDFNVPKIVTDDMPVFMGLIGDLFPALDVPRKRDLDFEKFVRESVLDLKLQAEDNFVLKVVQLEELLAVRHSVFVVGNAGTGKSQVLKSLNKTYQ------NMKRRPVWADLNPKAVTNDELFGIINPATREWKDGLFSNIMRELANVSHAGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLVFEISHLRTATPATVSRAGILYINQADLGWNPPVSSWIDKREIQ----SEKANLTILFDKYLPACLDTLRSRFKKIIPIPEQSMVQMLCHLLECLL 2195          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001140.1 (pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 gene:ENSPMAG00000001005.1 transcript:ENSPMAT00000001140.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2188.3 bits (5669), Expect = 0.000e+0
Identity = 1228/2811 (43.69%), Postives = 1745/2811 (62.08%), Query Frame = 3
Query:  834 DTKQNFQTSVKKAILDYILL---NKLEQKRLGLMMPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICESTP-LSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLF----IKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAA-SLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVF-SHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKS--HTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDL-NKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXX--XXXXXXXXCEMTDSPNQKYPRPKNLKCAR---NLMVPKKGTIFDHIFMKKQFGCWTTW-QSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNS--GFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQG-CLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDR--LXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDP--SGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQ 9188
            + + ++  SVKKAI+D++L    NK  +KR  L  P++  + VL +  PW  +   ++  LQ+  +  +  ++ +L  +   Y +LRL+++E I   T  L L+   ++  ++     + L + W+ + + I   S  + + ++P+  +  +  +  +FNC A L +++L+ +  NSI +       Y D++C            V +   +LR+ L+ D      + F P F      L  + D ++ +++   R+E  L+    +    T   P +L      E +   +  +R  +   S  P ++ + Y  F  L+    E    +F++ +    ++E  +   + LS     S    + + +F L C+ +   L  R++ L    L  M+ + + F + +C +++SI  +       T  L+EL+EY++K+   E+  LQ KL +A   +LFLL++  L   ++  NNT F W  R+  I       LT++ E+    L+  +++F E+L     Q +EF+    L D  +  ++   +  KL    E  +  N EE   +    + Y Q ++I  +  P+ +L++ AV F   +  WM GP+ +V+ + VE +  + W+  Y+L +   + P+    +     +K+ +E F+ +LP+ Q LCNPGL+ RHWDA+S  VGF +  +    L   L M L+  L    ++S  ASKE+SLEKA  +M  +W E+ F+   Y+++G +IL  VDDIQ+LL+DHIVKT TMR SPFI PFES++  W++ L  L++ L+ WLKVQA WLYLEPIF S DI  Q+P EG +F  VD+ WR ++ +   D+ V+ V+  D +LE LQ S  LLE I KGLNDYLEKKRL+FPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGIS+++FTE   IT M S+E E V+    I   +A G VEKW+L++E  M  S+  V+ +A+  Y    R +WV+ WPGQ VL  S   WT +   AI+     LE +L + + QI  +V LVR + L    R+TL A +VLDVHARDV+  LL   ++ + DF W+SQ+RYYW         + +L  RM+   +PYGYEYLGNT RLVITPLTDRCYRTL GA+ L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGL   GAWACFDEFNRI+LEVLSV+AQQI TIQR I    +  +FEGTEL+L+ +C +FITMNPGYAGRSELPDNLK LFRTVAMMVPDYA+IAEI LYS GFV AR L+ KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     E+ ++L+SI+DVNLPKFL  D+PLF+GI SDLFPGV+ P  DY  L   + E    M L+   +F +KI+QIYEM++VRHG MIVG+ F GKTCA++ L+ ALGD+  K L  EN V   ++NPKAI++G LYG+FD +SHEWSDG+LA ++R  A+S S +RKW++FDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+ +  N+IFEP DLE ASPATVSRCGMIYMEP  LG  PL+  W+    P  L    +  +  LF  L+P  L F+ +  K         LV +++ L    +DD  +  K                       K  ++ ++     + ++   F  SL+WS GA      ++             ++   ++++   +N++      ++  P  G+++++ F+++  G W  W ++L   P +    +    ++I++PT+DT+R    L  +L   +KP++FVG TGTGKS  I  F+L  L    +   ++ FSAQT++ Q Q+    KLDRRR+G+Y P Q K +V+F+DD++MP +E+YGAQPPVE+LRQ +DH  W+D KD + + +E+V I  AM  P   R AVT+R LRHFN + I+EFDD++M  IF  IM WHF +   F      L++ +V +T +++++   + LPTP KSHY+FNLRDFSRVIQG CL L                + RLWVHE  RVF+DRL+   D       I+K +    KE F  LF   S  + +  + ++R LMF DF  +K D                K Y E++D E L   ++ +L+E+N +SK PM+LVLFRFAIEH+ RI R+L+QP  H+LLVG+GGSGRQS  +LA  + D E+FQ+E+++ Y+ ++WR+D++R++R + D      FLF D QIK+  FLEDIN LLNSG+IPNLF  +++  +    +     + ++ Q + + + + N F++R R  LH+VL  SPIGDAF +RLR FPSL+NCCTI+WFQ WP DAL+ VA + L++VE+ ++     + MC+ FH S   LS+KF     R NYVTPTSYLELI TF +LL KK++E++  K RY VGLEKLE + +Q++ MQ EL A QPQL+E   +    + +IE E+ EV +  +VVK +EA    +A  AK IKD+C+++LAEA+P++ +A+ ALDTL Q DI++VK M++PP GVKLVMEA+ ILKG+KP++  DP  SG+++ED W  AK+LLGD+KFL  L  +DKD IP A M+ IR +YI N  FDP KI+N S+A EGLC WV A+E YD++ KVV+PKK KL  AE+     M  L+ KQ+ L EV+ KLA LQ+  +  +Q+K DLEN +++   K++RAE+LI GLGGE+ RW +    L IR++++ GD L+ +GIVAYLG F   +RQ
Sbjct:   91 EMRDDYLVSVKKAIVDFVLQDPKNKDLKKREDLP-PHREELAVLPK--PWRERFFATRRRLQEELHSINPAMLAVLQLWHNTYCDLRLVNVEEIRGGTAALELSSFQKVVMRHVDLAKETLLSKWLSEIQTIYYQS--NKKKLVPK--LTNVTRLASYFNCAAALMTSLLQKLALNSIYD-------YTDLICST------QTGTVKHPGFVLRLILSKD-----TIKFEPDFKDFQVVLLNVFDVMMKTLATVPRVETKLYSDWPMDKAHTHLQPVVL-----REVLEELQSHVRAEIIQQSLLPREHLRHYEPFEGLVGGQAERDVERFLSEEHTFSEHEQLVSHYRELSHSILYSSQLVVRLGMFELHCDELVAALAKRAENLGSRLLGRMSQEHQKFIQRLCEEFESIAEKALSTPINTKALMELKEYIQKVEVQEMSQLQVKLNEAKDHLLFLLDHASLSPSEMRHNNTAFQWCGRMPGIFTEHRRILTEKTEQYQESLKFRRRRFEEDLEAYAKQAEEFSTLGDLADVNKYLKKAQVLHTKLEAATEMIESFNAEEEAFAWPT-SQYPQKKKIQDVLMPYLRLYEMAVEFTSKHKAWMEGPLADVNPDVVEQDVGNYWRGLYKLERSLQASPQ---ALLIQQQLKSNVEAFRTHLPMAQVLCNPGLRGRHWDALSEVVGFPLLTQEQVCLEKFLEMNLESFLSKFNDISDTASKEYSLEKALEKMVREWDEMQFTLIVYRDSGTSILSAVDDIQMLLDDHIVKTQTMRGSPFIKPFESDMKEWERKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFTTVDKTWRDLIKQTLTDTHVLAVVSIDKMLERLQKSTELLELILKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGISRVEFTEALDITHMKSSEGEVVQLIETISTSKARGQVEKWLLELEAVMIRSVHNVIGEAMEAYPSTPRAEWVRAWPGQTVLCVSQAFWTSEVHEAIRGGQQVLERYLAQCNGQIDEVVGLVRGQ-LSQQSRVTLGALVVLDVHARDVLVALLKGGIAHDSDFQWLSQLRYYW--------EDGHLQTRMINAGLPYGYEYLGNTPRLVITPLTDRCYRTLFGALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINTGSDTLMFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIMLYSFGFVSARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPSENEDILMLRSIVDVNLPKFLAHDLPLFEGITSDLFPGVKLPKPDYVVLLEAIKENCEKMNLQMTDFFAEKILQIYEMMIVRHGFMIVGEPFGGKTCAYRVLAAALGDICEKALMAENKVQITVLNPKAITMGQLYGQFDAISHEWSDGVLAVSYRAFATSTSPDRKWLVFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQLASTTNLIFEPMDLEVASPATVSRCGMIYMEPHILGWRPLLTSWLNARPPP-LSAPHKALICALFERLVPCCLQFVRKSTKELSPTSDTNLVCSLMNLMDCQMDDFHDETKI----------------------KAMDDRDV-----SAWIEGIFLFSLVWSVGASCSTHGQVLFDQLLRELMSGPLSADTSKRFHLSENVEPPAEPFSVPFPAAGSVYEYRFIQEGKGRWELWTEALSLAPPIP---RDMNFNDIIVPTLDTIRFT-ALMEMLVTHQKPVLFVGPTGTGKSVYITNFLLKHLDKNTYKPLTINFSAQTTAAQTQNIIMGKLDRRRKGVYGPAQGKRMVLFVDDVNMPAREEYGAQPPVELLRQWLDHSNWYDLKDCSMIKLENVQILGAMGPPGGGRNAVTARFLRHFNTVTINEFDDKSMFTIFSRIMGWHFTARFAFPTDFSVLTEQLVQSTMEVYKAATQNLLPTPTKSHYLFNLRDFSRVIQGVCLSLPETC-------PVAASIQRLWVHEVLRVFYDRLVDDADRTWLVAFIRKTIHTYMKEDFTQLFQHDSNGDGQVEDDDLRSLMFCDFSDSKDDA---------------KRYVEVSDVERLRLVVEGHLEEFNNLSKKPMNLVLFRFAIEHVCRISRILKQPRSHALLVGVGGSGRQSLTRLAAHMADCELFQVEISKGYATNEWREDLKRILRRSTDGEQNGVFLFTDTQIKQESFLEDINNLLNSGEIPNLFAPDEKQEICEKMRQIDRQRDKDKQTDGSPLALLNMFVDRCRDQLHVVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPGDALQAVATRYLEDVEVSEETLASCIDMCKLFHTSTIALSQKFQAEQQRYNYVTPTSYLELISTFKDLLEKKRLEVMRMKRRYEVGLEKLESATSQVAGMQAELAALQPQLLEAGIQVVNTMAVIERESEEVSRTERVVKADEAVANEQAMAAKVIKDECDADLAEALPILRSALAALDTLTQQDITVVKTMKSPPAGVKLVMEAISILKGVKPDRVPDPSGSGRMVEDLWGPAKRLLGDMKFLQSLHDFDKDNIPVAIMKTIRAKYITNLEFDPDKIRNASTAAEGLCKWVIAMESYDKVAKVVAPKKVKLNQAEAELAVAMGSLRRKQEALREVQDKLAGLQQTLEANKQKKADLENQVDMCTKKLDRAEQLIGGLGGERSRWMEAARLLGIRYNDLTGDTLVSSGIVAYLGAFISSFRQ 2804          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003955.1 (pep scaffold:Pmarinus_7.0:GL495754:4342:49943:-1 gene:ENSPMAG00000003592.1 transcript:ENSPMAT00000003955.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1558.5 bits (4034), Expect = 0.000e+0
Identity = 921/2213 (41.62%), Postives = 1302/2213 (58.83%), Query Frame = 3
Query:  969 PWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTN-FRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPM--RCAATIKAKLEKFKINLPIIQALCNPGL---KQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKS---HTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLN-KELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANM-LQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNL---KCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHF-NSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIR 7562
            PW      +++ ++   +  HS L  +L        +  L+ +       PL L           +K  + L +SW      +      S E+             E F  CV+TL SN LR ++  +I  +V               +DL  G A+ +     R+ L  D  S       PS + +   +  +   I  S+     +   L        S P  + +   E+ +      L   V+ N + P ++ Q Y + + +L+N T  +  H FI+ D+   +    +E+ ++L  E   LP+ L   +  L C  + Q L+D+++    + L+ + N+ R  N  IC  ++ + +R  K  E + +++EL  YV+  R+  +  L  K+++  R + FLL+  IL  +DI  N+    W   I P  D +   +   + +  ++L   +++ +  L  L  ++  F + ++L+   +   ++  + ++L +  +    IN+EE+L    + T Y ++  I T  +PF KL+   + + +   KWM+G  LE++ E +  E +  ++  Y+  K F   + K     +  A  K + +  +  +   Q   +P +   + RHW  MS  V  DITP   T L  +L   L  +L+   ++S+ ASKE+SLEKA   M   W  I F+   Y+ETGV+IL +VD+IQ  L+D IVKT TMR S FI PFE+EI  W++ L R+++ L+ WLKVQA WLYLEPIF S DI +Q+P EG  F+ VD  WR +M   T D KV+       LLE LQ+   LL++I KGLN YLEKKRL+FPRFFFLSN+E+LEILSETKDPLRVQPHLKKCFEGI++L F     I  M S+E E V+    +   EA G VEKW+LQVE  M  S+R+V+ +A T Y    R  WV++WPGQVV+  S + WT +   AIK      L E+ ++   Q+  IVELVR  +L    R+TL A + +DVHARDVV  ++   VS+E DF W++Q+RYYW +E         + +R+V   V Y YEYLGN+ RLVITPLTDRCYRTL+GA  LNLGGAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY +M KFFKGLA SGAWACFDEFNRIELEVLSV+AQQI  IQRAI+ ++  F FEGTEL L+ +C + ITMNPGYAGRSELPDNLKVLFRTVAMMVP+YALIAEISLYS GF+ A+ L+ KIV  YRLCSEQLSSQ HYDYGMRAVK+VL AAG LK K     E+ ++L+SI DVN PKFL  DIPLF+GI SDLFPG+  P  DY        E      ++PV  FLDK+IQ YEM++VRHG M+VG+ F GKT   + L+  L  ++ +    E  V    +NPKAI++G L+G+FD VSHEW+DGI+A TFRE ASS++ +RKW++FDGP+D +WIE+MNTVLDD  +LCLMSGEIIQM+   ++IFE  DL QASPATVSRCGMIYMEP QLG  PL++ W+    P    ++ R  +Q LF WL+ PSL  + ++CK  +    L+L  N   QL  S +   R                              + N I        L A F  SL+WS GA  D D ++KFD F R   E+    ++ +P P  +   +C     + ++G ++D+++  K  G W  W  LI+ P L +  K T++ +I++PT+DT R  + +   +++ R P++FVG TGTGKS  IK  ++++L  + +L   + FSAQTS++Q Q+   SKLD+RR+G++ PP  K  V+F+DD++MP  EK+GAQPP+E+LRQ  DH  W+D KD + + +ED+ + +AM  P   R AVT+R LRHFNI  I+ F DETM  IF  +M ++  N+ F      +   IV AT ++++  M + LPTP KSHY FNLRDFSRVIQG LLL+          D    ++RL+VHE YRVFHDRL+  +D    + L + ++   FKE F  +F D   + +     +MRKLMFGD++    +P+ +          E +LY E+   +     ++  L+EYN   K  M+LV+F + +EH++RI R+L+QP GH+LLVG+GGSGRQS  +LAT +    +FQ E++++Y  ++WR+D++
Sbjct:  190 PWRDSFEAARKDIKGNLHIMHSALRSILDMGHTVLSQTLLLDLSGYRAMGPLELTAFSNNVTLQLEKGEEKLMHSWFPRVVSLFADKHKSTEA----------DSTESFHGCVSTLLSNQLRDLIVRTIEAYVRL-------------FDLADGRALPH----FRVQLTFDDESMESY---PSSEDLRGAVLAVAAQIGRSLQAVPMVHAWL-----AGSSSPETIKVQTPEDVLTRASAALLHAVQANMQGPQEHLQSYIDRYGWLVNGTAMERVHTFISEDRSFDECATLVEEFRALVRELQGLPSVLHFPMVRLVCSELKQGLMDKARGFINLLLDKLLNQHRAHNAMICQAFEVMRQRCLKVPENSEEMIELGSYVDNARSKGIADLNDKIQECYRRMSFLLDVHILSPEDIAFNSQVLCWPREIAPAFDRNEELMEVAQRKGESELLARRERLLLELDKLSRRVDGFAECSELDMIAQYVSDMRMIGKRLQDADDTITFINKEEVLYKWEL-TSYPEVDAIRTKLDPFQKLFTLILRWQRAEKKWMDGSFLELNGETMATELEEFFREMYKHLKFFQQRQKKAEQERQRDAPRKKRGDSAEAEMEEAQEQSDPSVQMCRDRHWVQMSEVVENDITPDSGTTLRKVLKQNLIPYLDKFEQISAAASKEYSLEKALHTMVETWDTIAFTTLQYRETGVSILSSVDEIQSTLDDQIVKTQTMRGSAFIKPFETEIKVWEERLVRIQETLDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGRLFQTVDRNWREVMKFCTRDPKVLVATSMTGLLEKLQNCNGLLDKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIARLGFLPNLDIGAMFSSEGERVELVERVSTSEARGAVEKWLLQVEDVMLRSVRDVIVRARTAYANTQRKDWVREWPGQVVICVSQMFWTTEVHEAIKGGPQQGLREYSERLQDQLKDIVELVRG-DLSKQTRVTLGALVTIDVHARDVVFDMIDKGVSNETDFQWLAQLRYYWESE--------QVRVRIVNCNVKYAYEYLGNSPRLVITPLTDRCYRTLVGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMVTFAFEGTELVLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLIAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGITLPAADYTLFLEAARECCSRHNVQPVKVFLDKLIQTYEMMIVRHGFMLVGEPFAGKTKVLQVLADTLTLMSERGQGGEERVQLRTVNPKAITMGQLFGQFDPVSHEWTDGIVANTFREFASSDTPDRKWVVFDGPIDTLWIESMNTVLDDCLQLCLMSGEIIQMSQPMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWQPLVQSWLGTLPPTLQQEDNRDLLQELFTWLVAPSLRMVRKQCKMLM----LKLWLNTRTQLCPSDITKERYSNAPESCI-------------------FMHANSIYS------LQASFAFSLVWSVGASCDSDGRVKFDSFLR---ELLTGKSKDHPLPPTVGKWECP----LEERGLVYDYMYELKGRGHWVHWNELIKNPHLGD--KGTKVQDIIVPTIDTARYTYLMDLCIQHSR-PLLFVGPTGTGKSVYIKNKLMNNLDKERYLPFFVNFSAQTSANQTQNIIMSKLDKRRKGVFGPPMGKRSVIFVDDMNMPALEKFGAQPPIELLRQFFDHGNWYDLKDTSKIRLEDLQLLAAMGPPGGGRNAVTARFLRHFNICTINSFSDETMVHIFSSVMAFYLRNNDFPPEFFSVGNQIVSATLEVYKKAMQNLLPTPTKSHYTFNLRDFSRVIQGVLLLRR------EAADGRRSMLRLFVHEVYRVFHDRLVDDQDRRWLYGLSRDLLRDHFKESFDAVFEDLKEEGRPLCQEDMRKLMFGDYM----NPDLM---------DEERLYAEVPSVQQFSSVVEQCLEEYNQTHKNRMNLVIFGYVLEHLSRISRVLKQPGGHALLVGVGGSGRQSLTRLATAMSGMALFQPEISKSYGHTEWREDVK 2299          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Sea Lamprey
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 1555.04 bits (4025), Expect = 0.000e+0
Identity = 861/2163 (39.81%), Postives = 1297/2163 (59.96%), Query Frame = 3
Query: 6183 KTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDV-----LICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQD-VREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDS--PQKNPVPDWLSEKSWNEMFGLSNLEP-FKGWLKDFV--------------MNIQKWKSIVDSKTPHLEKFP-----GDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYT-TTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEIS-GESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEE-----CMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRI-------------MECHEYSK--------PA-DEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            K      +L+PT DT+R  + + ++L   +  ++F G TG GKS V +  +        ++   + FSAQTSS + Q+   SKL+++R+ +   P  K +++F+DD++MP+ ++YG+QPP+E+LRQ  D   ++DR+      I+D       +    A P   R  VT R +RHF+++ +    + ++K IFQ I+   F   F + +K+++  IV A  +++  +    LPTPAKSHY+FNLRD S+ +QG L   S  +++       N++ RL+ HE  RVFHDRLI++ED D F  ++ ++    F  +    +       K P       ++FGDF+K             V  +   ++Y ++TD E L   +Q YLD+YNL S   M LV F+ AIEH+ RI RM+RQ  G++LLVG+GG+G+QS  +LA  +C +  FQIE++R YS   + +D+R+L    G +  +T FLF D QI    FLEDIN +LNSG++PNLFE +D LE +    +   ++    E     +   FI RVR  LH+VL  SP+GDAF +R R FPS++NCCTI+WF  WP +AL  V+      V++  D ++E +  MC   H SV++L++ +Y  + R  Y TPTSYLELI  ++++L +K+ ++  S++R   GL KL  +   +  +Q+EL A +P L + S++ E L++ + T+    ++VR+VV E+EA   VKAE+ +++  D + +L EA+P + AA  ALD+L ++DIS V+   NPP+GV+ VMEA+CI+   KP+             W +AK+LLGD  FL  L  YDK+ I E  ++K+++ YINN  F P K++ +S AC+ +C+WVRA+++Y R+LK V PK+++LA A++     MA L  KQ  L +VE ++  LQ+ F     EK  L  N+ LT+ ++ RA KL + LG E+ RW + ++   +  +N+IG+V + +  VAY G FT  YRQ  ++ W + C+ + IP+++  +     +LGDP  +R+W   GLP D+ S +N ++VT   RW L+IDPQ QAN+WI+  E  +N L++IKL+D  +LR LEN ++ G P LLE + E LD  LE +LLKQTF       IRLGD  V+Y ++FRFY+TT++ NPHYLPE  +KVT++NF +T +GLEDQ+L  V   EKPELE++R +LI+   +++ QLK IED+IL++L TS+GNIL++E+ I+ L  SKV S  I  + + A  TE  IN  R  Y+PVA  GS+++F I+ L+ +DPMYQYSL +F  L+  +IE SE  SD+  RL+ L      A Y NI R LFE+ KL+FSF+LCI I +    V +  W   L G   +D   P K P   WL+E +WN    L +  P FKG  ++ V              +N + W+  +       E+       G W ERLS  ++LV+++    EKV+ A+  +++  LG  ++E P  DL   +++  + TP++FVLS G DPM    RFA     S   +  +SLGQGQGPIAE  I E++KS +W+ LQNCHLA SW+  + +I + L    + I+PN+RL+L+S P+  FPV VLQNSVK+TNEPPKGLRAN+ R++T  TP     FF+ +   Q + K++F +CFFHA++QER+ +G +GWNI YEFNDSD + ++  L +F  D   +  +AL Y+TGE  YGGRVTD+ D+R + ++L   +  +  L   +  + SG Y      + L  + ++I+  P N  PE+FG+H NA LA ++QET  L ++IL   P+    G   S+  I+++LA  IL+KLP+I  +E   M+     +E      + TVL QE+ RFN L++VIR SL  LK A+ G ++M   +E++Y S +  +VP LWS  +YPSLKPLG ++ DL  R  F   WI  G P +FW+SGF+F Q FLTG LQN+AR+    ID+L F ++              M   ++ +        PA  +G  +HGL+++  RW  ED  + ++ +  +   LPV++  P      +  + YH P+YKT+AR G LSTTGHSTN+V T+ +PS +   +WI++G A LCQLND
Sbjct: 2011 KEVPFFEMLVPTTDTMRFGYLMEKLLAV-KHSVLFTGTTGVGKSVVARGLLDKIQEEAQYVPLYINFSAQTSSTRTQEIIESKLEKKRKNIIGAPGKKRVIIFVDDLNMPKLDRYGSQPPIELLRQYQDFGGFYDREKMFWKEIQDAREDRGAMQPFCAPPGGGRNPVTPRFIRHFSMLCLPSPSEHSLKQIFQAILT-GFLVDFPVAVKQVATNIVEAAVEMYGRMSTELLPTPAKSHYIFNLRDLSKCMQGILQCDSGTVRD------QNQIFRLFCHECQRVFHDRLINNEDKDYFNTMLAEMASKQFGVQVEAEYF-----VKHP-------ILFGDFMK-------------VGVQRADRVYEDLTDVEKLKGVLQDYLDDYNLSSAKEMKLVFFQDAIEHVTRITRMIRQERGNALLVGVGGTGKQSLTRLACHMCGYRCFQIELSRGYSYDTFHEDLRKLYTIAGVEDKDTVFLFTDTQIVIEEFLEDINNILNSGEVPNLFE-KDELEKVLAATRPKAKEAGIPEGNRDEVLQFFINRVRARLHIVLCMSPVGDAFRARCRMFPSIVNCCTIDWFVQWPREALLSVSKTFFTPVDLGSDELKENLSEMCVEIHMSVTELAEHYYAELRRRYYTTPTSYLELINLYLSMLGEKRSQLTNSRDRIKNGLTKLLETNELVDKLQLELSALEPVLKQKSEDVEALMEKLATDQENADQVRRVVMEDEAVAKVKAEETQAMAADAQRDLDEALPALQAANRALDSLDRSDISEVRVFTNPPEGVRTVMEAICIVLSKKPD-------------WASAKQLLGDSNFLKRLTDYDKENISEDVIQKLKV-YINNKDFVPEKVERVSKACKSMCMWVRAMDLYSRVLKDVGPKRQRLATAQAELDATMAMLNDKQRRLKQVEDQIGALQDQFDMSVAEKESLAKNMALTQARMSRAGKLTSALGDEQIRWQESVAQFQVEINNVIGNVFIASACVAYYGAFTSHYRQMLIDRWISRCQELGIPINANFSLIG--ILGDPFEIRQWNTDGLPRDTVSTENGILVTRGRRWPLMIDPQDQANRWIRNKEM-KNGLKIIKLTDGNFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRLLIRLGDSDVDYDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRNELIVRINADKNQLKVIEDRILKLLFTSEGNILDNEELIKTLQESKVTSGAIKTRLKEAEATEEMINTAREKYRPVAARGSVMYFVIASLSEIDPMYQYSLKYFKQLFNMTIETSEKRSDLAERLELLLKQTLLATYTNISRGLFEQHKLIFSFMLCIEILRQHGHVSDAEWNLFLRGAAGMDKERPTK-PEIGWLAESTWNLCCDLEDHLPCFKGLKREIVAIPILVTLGRLEIRLNPEAWEGCMKEPLHFTEEVSENEIQGHWNERLSKFQKLVLVKSFMEEKVVFAMTDFVIENLGKAFIENPPVDLATLYQDMSASTPLVFVLSTGSDPMGAFQRFAREMGYS-ERVHAISLGQGQGPIAEKLIEEAVKSGDWVFLQNCHLAASWMLAMEEIIKALSEPNAVIHPNYRLFLSSMPTRNFPVTVLQNSVKVTNEPPKGLRANIRRAFTEITPA----FFEKNVLGQNWRKIIFGICFFHAIIQERKKFGPLGWNIHYEFNDSDRECALLNLNLFCQDGR-IPWDALIYITGEITYGGRVTDSWDQRCLRTILKRFFSPK-TLEPGYLYSTSGIYYASEEKT-LQDHKDYIENLPLNDDPEIFGMHENANLAFQRQETGTLVKTILEVQPRSSGQGAGTSNDEIVKELADSILAKLPEILDMEGA-MESLFTRDEKGRINSLTTVLEQEVDRFNTLLQVIRSSLHTLKKAIAGFVVMSEEMEKIYNSFLNSQVPVLWSDNAYPSLKPLGGWVKDLALRTTFIDAWIKTGPPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDELGFHYKTLPVYRDQTSVAEAMRTQQFGQELEADIQLPAVQDGVLVHGLFMDASRWDDEDMVMEDALAAQMNPPLPVLHFEPCQNYQPD-PSLYHAPLYKTSARAGTLSTTGHSTNFVVTVFIPSKRDSDYWISKGAALLCQLND 4111          

HSP 2 Score: 871.692 bits (2251), Expect = 0.000e+0
Identity = 501/1159 (43.23%), Postives = 719/1159 (62.04%), Query Frame = 3
Query: 2316 LEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKL------WKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLS--DMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKET-GVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFT--------EETV---ITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWV-QDWPGQVVLAASAVHWTEQATNAIKS------HTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENSVIFD-----IINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKC 5696
            LEK+ +   +++  L  ++K   QR Q    ++   +  K+ E L E +    +  Q+ L      +   +++     + E  D+L      W S   +     +W+      +D E++ +E     K   +L K         P      +K K+E  +  LP++  L NP LK RHW+ +   +G  +  + +TPL+   ++ + +  + E + +VS +AS E SLE    ++++ W+   F   P++++  V IL   D+IQ+LL+D I+  ST+ +S ++GP +S ++ W + L      L  W+  Q  WLYLE IF + DI+RQ+P E   F  VD+ W+ IM K+      +       LL+  +++ ALLEQIQK L  YLE KR+ FPRF+FLSN+ELLEIL++T++P  VQPHL+KCF+ I++L+F         E T    I  M+S E E+V        L+A G VE W+ +VE AM  SLR + K A+  Y  + R +WV    P QVVL  + + W    T  ++        ++  F K+N ++++S+  LVR  NL  + R  + A I +DVHARD+V  ++  +V + ++F W  Q+RYYW  EL      DN V RM  ++  YGYEYLG   RLVITPLTDRCY  LMGA++L+LGGAP GPAGTGKTET+KDLAKA+A QCVVFNCSDGLDYK MG+FF GLAQSGAW CFDEFNRI++EVLSVIAQQ+ TI+ A   ++  F+FEG E++L ++C  FITMNPGYAGR+ELPDNLK LFR +AMMVP+YALIAE+ LYS GF  +R LA K+  +Y+LCSEQLS Q HYD+GMRAVKSVL  AG LKR+   L E+ V+++++ D NLPKFL  D  LF GI+SDLFPGVE P  DY  L   +   L+  KL+ VP  + K+IQ+YE +LVRHG+M+VG +  GKT  + ALS ALG L++    +++  +      ++NPK+IS+G LYG  + ++ EW DG++A + R   + +S++ KWI+ DGPVDA+WIEN+NTVLDDNK LCL + E I++T + +MIFE +DL+ ASPATVSRCGM+Y++  +L   P ++ W+   + +F +D  +  + L  N+ +   L F+ +KC
Sbjct:  757 LEKFCQHLDKDILELNMEVKIVKQRAQDPMILDITSDKTKVREILKEQMIATDEFQQQALQYRAYQKNFKVEVTNFDALNEVCDELKRKQMMWDSLDEWEVFTKEWLECQFETLDPEQLNSEVAKYAKIVNQLEKGLP------PNNVVPLLKKKVEFIREKLPVVAFLRNPSLKARHWEMLEEIIGAPLRDK-ETPLTLAGLIELEVFHYAEQIQDVSGQASGEASLESILKKVEDGWKTAEFVVLPHRDSKDVFILAGTDEIQILLDDSIINISTITSSRYVGPIKSRVDEWQRQLLLFNQTLEEWMTCQRNWLYLESIFSAPDIQRQLPAEAKMFMQVDKSWKDIMRKIYRLPNALRAATQPGLLDTFKNNNALLEQIQKCLEAYLESKRVVFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDAIARLEFALAPAEGEQERTFTNDILAMVSPEGEKVSLGKG---LKARGNVEDWLGKVEEAMFQSLRRLTKMAIGEYQSMPRTEWVVSGLPSQVVLTVAQLMWCRDLTQCLEGGDHDHLQSVANFEKENFERLNSLACLVRG-NLPKIHRCIITALITVDVHARDIVTDMVQEKVETANNFEWQRQLRYYWDLEL------DNCVARMALSQYVYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKVPRFMFEGREIKLIQTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPNYALIAEVILYSEGFESSRVLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPHLREDVVLIRALRDSNLPKFLADDAMLFSGILSDLFPGVEIPNHDYGSLQSSIENALKARKLQAVPSMVHKVIQLYETMLVRHGVMLVGPTGGGKTTVYTALSDALGSLHEAGESKHNPFYQKVHTTVLNPKSISMGELYGEVNNLTLEWRDGLMALSVRVAVADDSEDHKWIVCDGPVDALWIENLNTVLDDNKMLCLANSERIKLTPQIHMIFEVQDLKVASPATVSRCGMVYIDSEELKWMPYVQTWMNGIIDKFGEDTGQYIMALFENY-VEDGLRFVNKKC 1897          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009595.1 (pep scaffold:Pmarinus_7.0:GL478108:144315:184457:1 gene:ENSPMAG00000008659.1 transcript:ENSPMAT00000009595.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1196.03 bits (3093), Expect = 0.000e+0
Identity = 768/2432 (31.58%), Postives = 1252/2432 (51.48%), Query Frame = 3
Query: 5346 RKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFI---------GRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMT----DSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEK-EKYGAQPPVEILRQLIDHKFWFDR-KDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWH---FNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSL--DEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKD----------DCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECV-ELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEP--FKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYED-----VQLEALTYLTGECNYGGRVTDNQDRRLIMSLL-----------YSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEI-SGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDF-----DFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGL 12476
            R++I+FDG VDA+W+ENMN+V+DDNK L L +GE I++ N   ++FE  DL+ ASPATVSRCGM+Y++P  L   P  + W+    P  +    +  +Q LF   +P  ++ I         G   K+ V    L +V+ +  + +++L                                    +E   EE    L  HF  +L  S GA L ++++  FD   + L  MT    D      P     +C          T+F++ F  ++   W  W  L+     D  ++     +IL+PTVDTVR  + L ++++  R+P++ VG +GT K+A    F L  L +   L   + FS++TSS  VQ S  + +++R +  Y PP  K L++F+DD++MP   ++YG Q P+ +L+ L++    +DR K+ T   + D+   +AM      R  V  R L  F +  +    +E++  I+  I+  H   F+        RL+      T  ++ + ++   PTP+K HY+FNLRD SR+ QG      + L    +  +   ++RLW +E  RVFHDRLI+++D  L    +++++E  F     V   D               ++FGD+  A       LS G      E +LY +I D EA     Q  L+EYN  S+ PM+LVLF  A+EH+ R+ R LR   GH+LLVG+GGSG+QS ++LA +    ++F+I ++R Y+ S  RDD++ L    G +G  T FLF D  + E  FLE IN +L +G +P LF ++++  +I +++    +        ++  Y  F+ +   NLH+VL  SP GD   +R RNFP L+N   I+WF  WPE AL  VA   L  +   I  D R  +V      H SV D S +F   + R NYVTP +YL+ + T+  LL +K + I+   +R   GL+KL  +  Q++ +   L   +  L   S   + L++ I   T  V + +           +  E A+ I+D          + E  L  A+P + AA  AL  L ++D++ +++   PP  V+ V E + +++G K            E  W  AK ++ +  FL +L   D D I +  ++ IR   + + G    ++  IS A  G+  +V AV  Y  + + + PK++K+A  E  +     +L+  Q EL  ++ +LA L   ++    E+  L+   E+ + ++  A+KLI+GLG E  RW   + +L  R   ++GD LL A  + Y G F+  +R   + + W+ E +   IP+S         +L D V +  W   GLP D  SV N ++ T  +R+ L IDPQ QA  WI++ E + N   V   +D  +L+ LE  +++G P L ++V + +D V+++VL +    Q   +Y+ LGD  V+Y   FR Y+ T+L NP   P    K  ++N+ +T  GLEDQ+L ++ A E+ ELE++R +LI E++ N+R LKE+ED +L+ L+TS GN+L++ + +  L  +K  + +++ K   A KT  +I+ +R+GY+P A  G++LFF+++D+A +  MYQYSLS F+ ++  S+  S   + +  RL N+    T  +Y   C  LFEK KLLFS  + I + + + +V +    F L G ISL+   +    DWL E+ W ++  L+ + P  F         N Q W    D  TP     P  +   LS  + L+V+RC   ++V  A+  Y+   +G  YV+PP  +LE   ++S   +P++F+LS G DP  DL + AE    S + LK++++GQGQ   A   +  ++   +W++LQNCHL   WL EL K  E +    S+ +P+FRLWLT+ P+  FP+ +LQ S+K+  EPP GL+ NL  +Y        +   +   P  F  L+++L FFHAVVQERR YG +GWN+ Y+FN+SD ++ +  L  +++   +     +   +L YL GE  YGGR  D+ DRR++ + +           + V+H        F  +E+   L P    D       ++  P    PEVFGLH+NAE+    Q    ++  ++   P+   +G   S    I  +A DI ++LP  F++ +   +   +       VL+QE+ RFN L++ + +SL +L+ A+ G + M   L+EV R++  G +P++W + +  +LK L +++     R + +  W+++G+P   W+SG +  +S+LT ++Q   R+N   +D+         FR  E  E ++   +G F+ GL+LE   W VE   L+ S  KVL   LPV+ I+P     +  +++   PVY T+ RR  +         VF   L +++   HW+ +G+
Sbjct:    1 RRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNTCALLFEVGDLQYASPATVSRCGMVYVDPKNLEYQPYWQRWLNS-RPAKVRLHDQAELQRLFEKYVPSCMEMIVDGVVDGRQGEPLKTIVPQTDLNMVSQLCAMLNAVL------------------------------------HEEEAEEEEAVLECHFLEALYCSLGATLLEEARATFDSHVKGLSAMTTVADDLKTSAQPGELPGQCP---------TLFEYHF-DRESQSWVPWSRLVPAYVYDAQVR---FCDILVPTVDTVRTSWLLEQMVRT-RRPVLLVGESGTSKTATTHNF-LKGLDSDTTLLLPINFSSRTSSLDVQRSLEASVEKRTKDTYGPPVGKRLLIFMDDLNMPRVVDEYGTQQPIALLKLLLERGSLYDRGKEMTCKTLRDLGYVAAMGKAGGGRNQVDPRFLSLFTVFHVTFPSEESLHYIYASILRGHTLMFSEEVRAACDRLTS----CTLQLYHAAVSELPPTPSKFHYIFNLRDLSRIYQG------LCLTTPERFTTVGHMVRLWRNECLRVFHDRLINTDDKILVERHVRRLLEEHFPHDVEVTMRD--------------PILFGDYRSA-------LSPG------EPRLYEDIQDYEAARALFQEILEEYN-SSETPMNLVLFEDALEHVTRVHRTLRMERGHALLVGVGGSGKQSLSRLAAYAAGCQVFEITLSRGYNESSLRDDLKALYTRLGVEGKPTAFLFTDAHVVEEGFLELINNMLTAGIVPALFPDDEKEALIGQVRDEAARAGCGPARESVWHY--FVSKCASNLHIVLAMSPDGDTLRTRCRNFPGLVNNTCIDWFLPWPEQALLAVAQSFLAGENPMIPGDHRGAVVSHVVSVHCSVGDFSVQFQRKLRRSNYVTPKNYLDYLATYTRLLEEKDLYILGQCQRLEGGLDKLAEASVQLAELNERLAEQKVVLAAKSLACDALLEEISRSTETVNEKK----------QLAEEKAREIEDQNRVIAVEKGEAEEALTAALPALQAARRALQELDKSDVTEIRSFATPPKQVQTVCECILLMRGHK------------EVSWKAAKGMMSESNFLRNLMEMDCDAIGQGQVKLIR-GILKSLGTTYEEMVPISRAGAGMLKFVEAVMGYCEVAREIKPKRDKVARLERDFYQSKRELERIQAELATLQEELAALGSKYEAAMSERQQLQAENEVMERRLLAADKLISGLGSENARWTSELQELRQRRVRLLGDCLLSAAFLCYSGAFSWEFRSAMLSDAWEKEVREREIPLSQPFRVES--LLTDDVEISRWGSEGLPPDELSVQNGILTTHASRFPLCIDPQQQALNWIRRKEQKNNLKVVSSFNDPDFLKQLEMAIKYGFPFLFQDVDDYIDPVIDNVLERNIKGQQGRQYVVLGDKEVDYDPSFRLYLNTKLANPRLSPSIFGKAMVINYTVTLKGLEDQLLSVIVAFERSELEEQRERLIQETSHNKRLLKELEDSLLRELATSTGNMLDNAELVLTLEDTKAKATEVAEKLALAEKTALDIDRLRDGYRPAAKRGALLFFSLADMAQVSGMYQYSLSAFLGVFDLSLRKSLPDTVLPKRLVNITDTLTHNIYNYGCTGLFEKHKLLFSLNMAIRLEQAEERVPQSELDFFLKGNISLEKSARARPFDWLPEQGWQDVVQLAEVSPDAFASLPDHVERNGQAWGQWFDLDTPEQAPLPDGYAHSLSAFQHLLVLRCFRVDRVYRAISDYVASTMGERYVQPPVVNLEGVLEQSSPTSPVVFILSAGSDPAGDLAKLAERTGFSGSRLKMLAMGQGQEKAALQLLGHAVSRGHWLMLQNCHLLPRWLKELEKALEGI----SKPHPDFRLWLTTDPTPSFPIGILQRSLKVVTEPPNGLKLNLRATYFRV---SHEALDSCPHP-AFRPLVYTLAFFHAVVQERRKYGKLGWNVSYDFNESDFQVCMEILCTYLSKAHEQANGRIPWASLKYLIGEVMYGGRAIDSFDRRILTTYMDEYLGDFLFDSFQVFH-------FFCNSETDYRLPPDGPKDAYIVTAEVESLPLANTPEVFGLHSNAEIGYYTQAARDMWRHLVDLQPQTGETGSGVSRDEFISGVARDIQARLPLPFELGQTRKRLGAVLSPTA-VVLLQEMQRFNALLQRMARSLAELQKALAGEVGMSGELDEVARALFNGTIPAIWRRLAPDTLKSLANWMVHFHQRHQQYSAWVEDGEPTVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLYTQVTTFRGPE--EVTERPGQGCFVSGLFLEGADWDVEASCLVRSKPKVLMVQLPVLKIIPIESHRLKLQSTLRTPVYTTSTRRNAM-----GVGLVFEADLFTTKHPSHWVLQGV 2292          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003938.1 (pep scaffold:Pmarinus_7.0:GL495754:984:26133:-1 gene:ENSPMAG00000003592.1 transcript:ENSPMAT00000003938.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1179.47 bits (3050), Expect = 0.000e+0
Identity = 628/1260 (49.84%), Postives = 851/1260 (67.54%), Query Frame = 3
Query: 4155 VPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLN-KELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNL---KCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHF-NSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQ 7919
            V Y YEYLGN+ RLVITPLTDRCYRTL+GA  LNLGGAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY +M KFFKGLA SGAWACFDEFNRIELEVLSV+AQQI  IQRAI+ ++  F FEGTEL L+ +C + ITMNPGYAGRSELPDNLKVLFRTVAMMVP+YALIAEISLYS GF+ A+ L+ KIV  YRLCSEQLSSQ HYDYGMRAVK+VL AAG LK K     E+ ++L+SI DVN PKFL  DIPLF+GI SDLFPG+  P  DY        E      ++PV  FLDK+IQ YEM++VRHG M+VG+ F GKT   + L+  L  ++ +    E  V    +NPKAI++G L+G+FD VSHEW+DGI+A TFRE ASS++ +RKW++FDGP+D +WIE+MNTVLDD  +LCLMSGEIIQM+   ++IFE  DL QASPATVSRCGMIYMEP QLG  PL++ W+    P    ++ R  +Q LF WL+ PSL  + ++CK  V+     LV ++ +L+  LL  +  +G++ D                             K  R  +++A F  SL+WS GA  D D ++KFD F R   E+    ++ +P P  +   +C     + ++G ++D+++  K  G W  W  LI+ P L +  K T++ +I++PT+DT R  + +   +++ R P++FVG TGTGKS  IK  ++++L  + +L   + FSAQTS++Q Q+   SKLD+RR+G++ PP  K  V+F+DD++MP  EK+GAQPP+E+LRQ  DH  W+D KD + + +ED+ + +AM  P   R AVT+R LRHFNI  I+ F DETM  IF  +M ++  N+ F      +   IV AT ++++  M + LPTP KSHY FNLRDFSRVIQG LLL+          D    ++RL+VHE YRVFHDRL+  +D    + L + ++   FKE F  +F D   + +     +MRKLMFGD++    +P+ +          E +LY E+   +     ++  L+EYN   K  M+LV+F + +EH++RI R+L+QP GH+LLVG+GGSGRQS  +LAT +    +FQ E++++Y  ++WR+D++ L+++ G KG +T FL  D QIK+  FLEDI+ LLN+G++PNLF  ++R +I+E ++ + Q  N  +E++ + ++  F+ R R+NLH+V+ FSPIGDAF +RLR FPSLINCCTI+WFQ
Sbjct:    1 VKYAYEYLGNSPRLVITPLTDRCYRTLVGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMVTFAFEGTELVLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLIAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGITLPAADYTLFLEAARECCSRHNVQPVKVFLDKLIQTYEMMIVRHGFMLVGEPFAGKTKVLQVLADTLTLMSERGQGGEERVQLRTVNPKAITMGQLFGQFDPVSHEWTDGIVANTFREFASSDTPDRKWVVFDGPIDTLWIESMNTVLDDCLQLCLMSGEIIQMSQPMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWQPLVQSWLGTLPPTLQQEDNRDLLQELFTWLVAPSLRMVRKQCKELVQTSDGNLVVSLTRLFEMLLCGL--LGQEPDS----------------------------KNVRV-WIMASFAFSLVWSVGASCDSDGRVKFDSFLR---ELLTGKSKDHPLPPTVGKWECP----LEERGLVYDYMYELKGRGHWVHWNELIKNPHLGD--KGTKVQDIIVPTIDTARYTYLMDLCIQHSR-PLLFVGPTGTGKSVYIKNKLMNNLDKERYLPFFVNFSAQTSANQTQNIIMSKLDKRRKGVFGPPMGKRSVIFVDDMNMPALEKFGAQPPIELLRQFFDHGNWYDLKDTSKIRLEDLQLLAAMGPPGGGRNAVTARFLRHFNICTINSFSDETMVHIFSSVMAFYLRNNDFPPEFFSVGNQIVSATLEVYKKAMQNLLPTPTKSHYTFNLRDFSRVIQGVLLLRR------EAADGRRSMLRLFVHEVYRVFHDRLVDDQDRRWLYGLSRDLLRDHFKESFDAVFEDLKEEGRPLCQEDMRKLMFGDYM----NPDLM---------DEERLYAEVPSVQQFSSVVEQCLEEYNQTHKNRMNLVIFGYVLEHLSRISRVLKQPGGHALLVGVGGSGRQSLTRLATAMSGMALFQPEISKSYGHTEWREDVKALLKSAGAKGRKTVFLITDTQIKQETFLEDIDNLLNTGEVPNLFAADERQDIMEAVRPVAQAGNKNVELSPLALFAFFVNRCRENLHVVVAFSPIGDAFRTRLRQFPSLINCCTIDWFQ 1200          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 369.392 bits (947), Expect = 2.754e-102
Identity = 283/1020 (27.75%), Postives = 505/1020 (49.51%), Query Frame = 3
Query: 2529 QLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGF-----DITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFG-SADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQ----WVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLS-VXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFR----EHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIY 5543
            QL  ++   + +D +W+S     +   +    P   VD   ++++  +  + A  L +     E    +     +   + K      I+  L +  LK RHW+ +   +G      ++  +++  L D++ + L  +   L ++  +A KEF +EK+  R++  W+E  +    +  +G+ ++   D ++   ++ + +  +M+ S +   FE +    +  L +L +   +W++VQ  WL L  I G + DI+  +P+E  +F+ +  +++ I  +       + VI   N    L+ +   L+ I+  L+ +LE++R  FPRF+FL N++LL+I+   K   +V   +KK F  I  + F E+  ITG+ S E E +     I  L+     ++W+  ++  +K S   V  +   C  Q+         V  +  Q +L ++ V WTE     ++++   ++ K+ D +I  +++ +   +    V+  +EA +V  +H  +V+ +L +     E    W    ++Y   +   +L  +++ I      + Y +EY+G   RL+ TPL    + TL  ++    GG   GPAGTGKTET K   + + +  VVFNC D  DY+ + +   G+ Q GAW CFDEFNR++ +VLS V A   Q        +  + L E  E  L     +FIT+NPGY GRSELP+NLK  FR  +M  P    IAE+ L  MGF ++++LA+KIV    L S + SS +HY +G+R +K VL               E+ V++S+  V LP     D  +F   +S +F     PL + + + + L +  +         FL K +Q Y M   +  L++VG++ CGKT  +K +  A+   +   N    V++ +I+ K ++   LYG     + EW DG+     R    +   +  + R W++FD  +D  ++E MN+VLDDNK L L +GE + +     ++FE ++L+  +PAT++RCG+++
Sbjct: 1220 QLTHVVEEVKTYDLVWRSIKNLWEDVQRTFETPWCRVDVLLLQSDLANFLRRADELPRAVKQFEMYKSLFSQVNMLTSVNK------ILVELKDGALKPRHWNMIFRDIGKRQIQKNLLDKLEFSLKDVMVLNLTLNEILLTKIIERAQKEFVIEKSLNRIKKFWKEAQYEVIEHS-SGLKLVREWDVLEQACKEDLEELVSMKASNYYKIFEQDCLDLESKLTKLSEIQVNWVEVQFYWLDLYGILGENLDIQNFLPLETSKFKSLTSEYKMITTRAFQLDTTIEVIHIPNFDTTLKLTIDSLKMIKSSLSTFLERQRRQFPRFYFLGNDDLLKIIGSGKHHDQVSKFMKKMFGSIESIIFLED-FITGVRSVEGEVLNLNEKI-ELKDSIQAQEWLNILDTEIKLS---VFTQFRDCLGQLKDGTDIEVVVSKYIFQAILLSAQVMWTELVEKCLQTNQFSKYWKEVDMKIKGLLDKLNKSS--DNVKKKIEALLVEYLHFNNVIGQLKNCSTKEEARLLWAKVQKFYQKNDTLDDL--NSVFISQSGYLLQYKFEYIGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNCDDSFDYQVLSRLLVGITQIGAWGCFDEFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLE-EETPLSPHTAVFITLNPGYNGRSELPENLKKSFREFSMKSPQSGTIAEMILQIMGFEDSKSLASKIVHFLELLSSKCSSMNHYHFGLRTLKGVLRNCSP--LISEFGEGEKTVVESLKRVILPSLGDTDELVFKDELSKIFDSAGTPL-NSKAIVQCLKDAGQRSGFSMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTATWKTVIDAMAIFDGHAN----VVY-VIDTKVLTKESLYGSMLKATLEWRDGLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEYVEAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLW 2214          

HSP 2 Score: 304.679 bits (779), Expect = 1.151e-82
Identity = 310/1398 (22.17%), Postives = 633/1398 (45.28%), Query Frame = 3
Query: 6201 NILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFL-FHSLTFSAQTSSDQVQDSFFSKLD--RRRRGLYKPPQD--KTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPS-ASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEIT--LKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENE--DRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIK-------------------QDVREKIVIMCQHFHQSVSDLSKKFYEVMG-RINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRK-IRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAE----SIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDN-AVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHS-IENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSF-LLCI 10280
            +I+IPT+DT++       +L N ++ I+  G  G+GK+ +    M ++L N        + FS  T+++ +  +     +     +GL   P+   K LV+F D+I++P+ +KYG+Q  V  LRQL++ + ++   +N  + IE + I  A   P+   R  ++ R  RH  I+ +     +++  I++     ++ + F++    +  ++    A+  ++    A +  T  +SHY+F+ R+ +R+++G          N     +   LIRLW +E +R+F DRL+  ++ + F +L+ + V+     +           N   T+     L+  DF +  K                  L N I   E  F+T   + DE     +  + +V+    ++HI RI R L+Q  GH +L+G   +G+    +   ++   +I Q ++ R  ++SD+   +++ + +   K   T  +  +  I ET FLE +N LL + DIP+LF+ E  D+L       +   +    +  T   +Y+ F+  + KNLH+V T     +   S + + P+L N C INW   W    +  VAN  +D + ++                   Q +R+ +V +  HF        + FY+ M   +N  +P  +++ ++  + L+  K  ++  ++   +VGLEKL  S  +++ +   L     +L E  KE    +  +  E  E E+ ++  +E +    V+ ED +  K+    ++ +  P +  A   +  +K+  ++ +++M NPP GVK+VMEAVC + G +               W   ++ +    F+ ++  YD     +  +RK +  +++++P F    I   S AC  L  WV A   + ++L+ V P ++++   E          +A  ++ QD    +E    K     ++ +  KT++ N     +  ++R+  L+  L  EK RW       +     +IG+ ++ +    Y G      R + + + +      ++       F    V  D     +W   GL  + + ++N ++++ S +    L+DP       I       NK  ++   ++G+++ LEN ++FG+  ++++ GE  D ++  ++ ++     N   + +GDH V+ S DF+ +I +   +         +V LV+F+     +E ++  I   +E  E++++R  LI  +   + +LK +E ++L+ L+ S+GN+LE+++ +  L++ K  +  I  K   + +   + + +   Y  +  H   +F  +         Y  S+  F++ +    I+ S  +     R+  +     + VY     +L +K K++ +  + C+
Sbjct: 2389 DIVIPTIDTIKHEKIFYDLL-NSKRGIILCGPPGSGKTMI----MNNALRNSSLYDVVGINFSKDTTTEHILSALHRHTNYVTTSKGLTLLPKSDIKNLVLFCDEINLPKLDKYGSQNVVLFLRQLMEKQGFWKTPENKWVTIERIHIVGACNPPTDPGRIPMSERFTRHAAILYLGYPSGKSLSQIYEI----YYKAIFKLVPEFRSYTEPFARASVHLYNECKARY-STGLQSHYLFSPRELTRLVRGV-----YTAINTGPRQTLRSLIRLWAYEAWRIFADRLVGVKEKNSFEQLLYETVDKYLPNQ--------DLGNISSTSLLFSGLLSLDFKEVNK----------------TDLVNFI---EERFKT---FCDE-----ELEVPMVIHESMVDHILRIDRALKQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHSNLSDFDMILKKAISDCSLKESRTCLIIDESNILETAFLERMNTLLANADIPDLFQGEEYDKL---LNNLRNKTRSLGLLLDTEQELYDWFVGEIAKNLHVVFTICDPTNNKSSAMISSPALFNRCIINWMGDWDTKTMSQVANNMVDVIPMEFTDFIVPEVNKELVFTEPIQTIRDAVVNILIHF-------DRNFYQKMKVGVNPRSPGYFIDGLRALVKLVTAKYQDLQENQRFVNVGLEKLNESVLKVNELNKTLSKKSTELTEKEKEARSTLDKMLMEQNESERKQEATEEIKKILKVQEEDIRKRKEVVMKSIQDIEPTILEAQRGVKNIKKQQLTEIRSMVNPPSGVKIVMEAVCAILGYQFSN------------WRDIQQFIRKDDFIHNIVHYDTTLHMKPQIRKYMEEEFLSDPNFTYETINRASKACGPLYQWVNAQINFSKVLENVDPLRQEMKRIEFESLKTKANLLAAEEMTQDLEASIEVSKRKYSLLIRDVEAIKTEMSN----VQANLDRSISLVKSLTFEKERWLNTTKQFSKTSQELIGNCIISSIYETYFGHLNERERADMLVILKRLLGKFAVKYDVNYRFIDYLVTLD--EKMKWLECGLDKNDYFLENMSIVMNSQDAVPFLLDPSSHMITVISNYYG--NKTVLLSFLEEGFVKRLENAIRFGSVVIIQD-GEFFDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHSCDPSGDIPIFLRSRVRLVHFVTNKESIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNMLENDELMVTLNNLKKEAMNIEKKLSESEEFFPQFDNLVEEYSIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCFKRVFIKKSRETRAARTRVDEILWLLYQEVYCQFSTALDKKFKMIMAMTMFCL 3705          

HSP 3 Score: 55.4546 bits (132), Expect = 2.274e-7
Identity = 53/226 (23.45%), Postives = 96/226 (42.48%), Query Frame = 3
Query: 10752 YRFAELKNLSPTNLKVVSLGQGQG-PIAESYIYESLKSENWIILQNCHLATSWLPE-LGKICEELLLKKSEINPNFRLWLTSY-PSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQ--MFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVY 11414
            ++  EL   S  +LK++ LG  +    A+  I +S     WI+LQN  ++ SW+   L K  EE   K +E +  F++++T +      P  +LQ + +   E   G+        T   +    FF             F L +FHA++  R      G++  Y FND D + +   L+  +  N   ++    +        YGG++ + +D  ++  L   V+
Sbjct: 3798 FKLIELAKASKESLKIIPLGSIENLNYAQEEISKSKIEGGWILLQNIQMSLSWVKTYLHKHVEET--KAAEEHEKFKMFMTCHLTGDKLPAPLLQRTDRFVYEDIPGILD------TVKDLWGSQFFTGKISGVWSVYCTFLLSWFHALITARTRLVPHGFSKKYYFNDCDFQFASVYLENVLATNSTNNIPWAQVRDHIATIVYGGKIDEEKDLEVVAKLCAHVF 4015          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Nematostella
Match: EDO34727 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNG1])

HSP 1 Score: 3697.52 bits (9587), Expect = 0.000e+0
Identity = 1982/3929 (50.45%), Postives = 2690/3929 (68.47%), Query Frame = 3
Query:  819 NQFLIDTKQNFQTSVKKAILDYILLNKLEQKRLGLM-MPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLI-SIENICESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCY-EGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISN-KEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLL--------------------------DYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQL--NDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSG--KLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIM-ECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            N+   +  +++  SV+KAI+DY+L +  E+ RL +   P       +R  +PWH+   QS +   K  + T+  ++++ + +  ++ + R +   E +    P+S ++  E+  +   +  ++L+ +W+  C  +L S       ++P +  E    +++FF+CV+ L S  LR +V NS+ +FV+F+  Y+D   + E Y DL   M   +V          DLT     +  P          Q   +   + +   ++E  LF  +     LP  L  +  EE ++ +  ++  D  KLN+  P KY   Y  ++ LLN   E     F+  D  LL                          D++ ++++ +SLS E ASL   +P+++  L+C+ +NQ L  R+ +L    ++++ +++R  NR IC QYD +  ++ +  + T  LV L +++EK  T  ++ LQ  ++ A   +LFLL+Y  LP +DI LN+T F W + I  I + S   +   ++ A++ L+   K + E L G   +++ F ++  +   +  +N ++LD++   L+   +E   +N EE LL     T +  LQ ++  KEP++KLW++A+ F   ++ W+NGP +E++AE+VE E   +++T  +L+K F   +   P R A ++++K++KFK++LP++Q +CNPG+++RHW  MS  VGFDI P   T L +ML   L KHL+ L E+S  ASKEF LEKA  +M+ +W ++ F F PY++TGV+IL  VDDIQ+LL+DHIVK  TM  SPFI PFE+EI  W + L  ++D +++WLK QA WLYLEPIF S DI  Q+P EG +F IVD  W+ IM +   D+KV+      N+L  LQ S  LLE+IQKGLN YLEKK+L+FPRFFFLSN+ELLEILSETKDPLRVQPHLKKCFEGI++L+FTEE  + GM+SAE+E V F+  I P +A+G+VEKW++QVE  M DSL++V   A+  Y    R +WVQ+WPGQ                        E+L+K+++QI  IV LVR + L   VR+TL A  V+DVHARDV A++    V S +DF W+SQ+RYY F E +       +++RM+TT + YGYEYLGN+ RLVITPLTDRCYR           GAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLD+K+MGKFFKGLAQ+GAWACFDEFNRIELEVLSV+AQQI TIQ+AI +  + F+FEGTEL L+ +CT+FITMNPGYAGR ELPDNLKVLFRTVAMMVPDYALI+EISLYSMGF+ AR+LA KIVA Y LCSEQLSSQ HYDYGMRAVKSVLTAAG LK +     E  ++L+++++VNL KFL  D+PLF+GIISDLFPG + P  DY  L   L E      L+   W++ KIIQ+YEM++VRHG MIVG    GKT AFK LS A+ DLNK       VI+ IINPK+I++G LYG FD VSHEWSDG+LA +FR+ ASS +++RKW+IFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+NKQ++IFEP DLEQASPATVSRCGMIYMEP QLG  PL++ ++   LPE L  E R TV+LLF+WL+ P L+FI   CK ++    + LV    +LYS L+D++R                          +     + +  ++ TN+L+  +  S++WS G  L+ DS+ KFD FFR L   TD   + +P+PK +K ++  + P +GT++D+ F+K+  G W  W  L  K     + KT +   + I T DT RQ FFL   L +   P++FVG TGTGKSA+  ++++  LP + +L  ++ FSA+TS+ Q QD    KLDRRR+G+Y PP  K  V+F+DD++MP KEKYGAQPP+E+LRQL+DH  W+D KD + L + D+L  SAM  P   R  +T R +RH N+I+ID FDD TM  IF  I DWHF  GF+ T +RL K++V AT  +++S +  FLPTP+KSHYVFNLRDF+RV+ G LL+ S      T  +  +KLIRLW+HE YRVF+DRLI   D  +FFE+IK  ++  FK +   L G      ++  +  +R L FGD++ A + P+              K+Y+E++D +AL   M+ YLDEYN MSK PM LV+F+FAIEHI+R+ R+L+Q NGH LLVGIGGSGRQSA +LATF+ D+++FQIE+T+ Y+ ++WRDD+++++   G  G  T FLF D+QIKE  F+EDINM+LN+GD+PN+F  +++ ++IEKMQ + + +  +I+ T + MYN FI+RVR NLH+VL  SPIGDAF +RLR FPSLINCCTI+WFQ WPEDAL+MVANK L+EV+I  +V+++ V MC++FH+SV  LS+++YE + R NYVTPTSYLELI TF  LL+ K+ EI+  K RY  GLEKLEF+ +Q+S+MQ EL   QP+LI+TS ETEKL+  IE +TVEVE  +++V  +EA     A  A+ IK++CE +LAEA+P + AA++ALDTLK +DIS+VK+M+NPP  VKLVMEAVCI+K +KPE+K DPSG  +++EDYW +++K+LGD+KFLD LK+YDKD IP   M+KIR +Y+ NP F+P  I+ +SSACEGLC WVRA+EVYDR+ KVV+PKKEKLA AE+    QM +L +K+ EL EV  KL  L + F     +K +LE NI+L + K++RAEKLI GLGGEK RW +    L  RF  + GDVLL +G VAYLGPFT+ +R EC++ W  EC +  IP S   + +    LGD V++R W I GLPVD+FSVDN +IV +  RW L+IDPQGQANKWIK +E E NKL VIKLSD  Y+R LEN + FGTP LLEN+GE+LD +LE +LLKQTFKQ  VEY++LG++ +EYS+DF+FY+TTRLRNPHYLPE SVKVTL+NFMITP GLEDQ+LGIV AKEKPELE+++ +LI+ESA N++QLKEIED+IL++LS+S+GNILEDE AI++LSSSKVLSE+IS KQE A  TE EI+  RNGYKPVA H S+LFF ISDLAS++PMYQYSL+WFINLY+ SI NSE S ++  R++ LN HFT+++Y N+CRSLFEKDKLLFSF+L IGI KG+NKVD+ VWRFLLTGG++LD+P  NP P+WL +K+W+E+   S+L   KG LKD + N   WK   DS TP  E  P  W + LS L+R+VV+RCL P+K++PAV  +IV  +G  Y+EPP F+L+LS+ +S    P+IFVLSPG DPM+ L +FA  K      ++ +SLGQGQGPIA   I ++LK   W++LQNCHLATSW+P+L KICEE ++   + + +FRLWLTSYPS  FPV++LQN VKMTNEPPKGLR+N+LRSY   PISD +FF A  +P  +EKLLF LCFFHA+VQERR +G +GWNIPYEFN+SDL+IS+RQLQMF+NDY+++ L+ALTYL G+CNYGGRVTD++DRRL++ LL     ++++ +E                                        H N            LF+ IL+TLP++  G  KS   +IE+LA+DILSK P +F +E +  KYPV+Y + MNTVL QELIRFN+L  V+  +L +L+ A++GL++M   LE+V+ +M++GKVP++W+  SYPSLKPLGSY++DL+ R+KFFQ+WID+G P+ FW+SGFYFTQSFLTG  QN+AR+    ID + F+F +M E  +     ++G +++GL+LE  RW  E   + ES  K+L+D LPV+ I+P  KS    + +Y CPVYKT+ARRG LSTTGHSTN+V  + LPS +  +HW+NRG+A LCQL+D
Sbjct:  228 NELKSEVAEDYDFSVRKAIVDYVLKDPSEKNRLHIKSTPKPFPQRTVRAPVPWHTPYRQSWDINAKNLFITNPVMMEIQNLWYDRFAQSRFVDGNELLASGLPVSPSEFEELVVKQCARTREFLKKTWIPACANLLYSGRSHWSYLVPGNEGESTVLVQQFFSCVSALMSIQLRSMVINSLKDFVDFLNHYQDGNDFGESYSDLRYVMGEHSV----------DLTVGWWALPSP----------QTPFDYPHARTGTRQVETELFPDMRDK-RLP--LRSVAVEEMLVQDYMDRAVDVFKLNTVGPQKYLNTYKKYQDLLNNKAETDVQAFLQDDPVLLALAKKHTHWLPLSTFVTKLKRIFLIGDFQ-KIDEFQSLSREIASLHLTVPLNMLCLNCQEVNQELSLRASKLADTMIHYVVDQNRDKNRGICRQYDEVSDKVQEMPDNTKDLVTLTQFLEKASTVMVVQLQSHVDDAGERLLFLLDYATLPYEDIKLNSTVFHWPEHIQKIFELSKNRIGHRKDLAMDDLKHRVKMYEEKLNGYNKEVEAFRKKEIMAAEEMKKNVEKLDELGTALDAARDELMDLNTEEELLQWE-PTQFPILQSMMAYKEPYEKLWRTALNFQNKHEAWLNGPFVEINAEDVEEEIGGMFRTVIKLSKTFG--DSPAPRRVAESVRSKIDKFKVHLPLLQVICNPGIRERHWTQMSEVVGFDIKPEASTSLCNMLEYNLHKHLDRLEEISGSASKEFGLEKAMEKMKVEWNDMFFEFVPYRDTGVSILSAVDDIQMLLDDHIVKAQTMSGSPFIKPFEAEIKSWCEKLILMQDIIDAWLKCQATWLYLEPIFSSEDIMAQMPEEGRKFGIVDSYWKDIMTESVKDTKVLVATGQPNMLGRLQESNQLLEEIQKGLNAYLEKKQLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIARLEFTEEQEVVGMVSAENETVPFSTKIVPAKAKGMVEKWLIQVEEVMMDSLKKVAGDAVAAYVNTVRGKWVQEWPGQ------------------------EYLEKSNKQIDEIVALVRGK-LDPGVRVTLGALTVIDVHARDVTAQMAHDGVHSLEDFQWLSQLRYY-FEEKR-------VIVRMITTSINYGYEYLGNSGRLVITPLTDRCYRH----------GAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDFKAMGKFFKGLAQAGAWACFDEFNRIELEVLSVVAQQIHTIQKAIAEHKKKFIFEGTELVLNPTCTMFITMNPGYAGRQELPDNLKVLFRTVAMMVPDYALISEISLYSMGFLNARSLAQKIVATYTLCSEQLSSQSHYDYGMRAVKSVLTAAGNLKLRYPDDDEAELMLRAVLEVNLAKFLSQDVPLFEGIISDLFPGTKWPNPDYGVLMDSLRENCSRRNLQATDWYMKKIIQVYEMMIVRHGFMIVGDPLGGKTMAFKVLSEAMTDLNKAGYPFQKVIYKIINPKSITMGQLYGCFDPVSHEWSDGVLANSFRDFASSTTEDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKQSLIFEPADLEQASPATVSRCGMIYMEPYQLGWKPLMESYLNT-LPESLSKEHRETVRLLFDWLMEPCLNFIRHDCKFFLTSSDMHLVTCFQRLYSCLMDEIR------------------------AQDHAEGADRMSSQQITNWLMGLYIFSMVWSIGGTLNGDSRKKFDAFFRLLISGTD---KDHPKPKEIKMSKQNVFPDRGTVYDYYFVKQASGSWGNWIELTHKGK-SVIPKTAKASELTIETDDTARQIFFLETFLTH-EVPMLFVGPTGTGKSAITNSYLV-KLPKEKYLPVNINFSARTSAGQTQDIIMGKLDRRRKGVYGPPPGKKCVMFVDDLNMPAKEKYGAQPPIELLRQLLDHGHWYDPKDTSKLELLDLLFVSAMGPPGGGRNDITGRFVRHANVISIDSFDDNTMNKIFTSIADWHFAKGFDATFQRLGKIVVMATMQVYKSAVDKFLPTPSKSHYVFNLRDFARVMFGTLLVPS------THLNEGDKLIRLWIHEVYRVFYDRLIDDTDRQMFFEVIKDTIKQQFKLEMDRLVGHLVPTGQKLKDEHIRNLFFGDYM-APESPD--------------KIYDEVSDLKALTTQMEAYLDEYNQMSKTPMSLVMFKFAIEHISRVSRVLKQDNGHCLLVGIGGSGRQSATRLATFMADYDLFQIEITKNYTKTEWRDDLKKMLIKAGVDGKPTVFLFSDNQIKEESFVEDINMILNTGDVPNIFAADEKADVIEKMQTVARVEGKKIDATPLAMYNFFIDRVRCNLHVVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEEVDISLEVKKQCVFMCKYFHESVRMLSERYYETLRRHNYVTPTSYLELIMTFKTLLDIKRNEILALKNRYLTGLEKLEFAASQVSVMQKELSDLQPELIQTSAETEKLMVKIEQDTVEVEAKKEIVAADEAVANEAAGVAQGIKEECEGDLAEALPALEAALKALDTLKPSDISMVKSMKNPPGAVKLVMEAVCIMKSVKPERKPDPSGSGRMIEDYWGSSQKILGDMKFLDSLKAYDKDNIPVPVMKKIREKYVTNPEFNPDNIRTVSSACEGLCKWVRAMEVYDRVAKVVAPKKEKLAAAEAELAIQMEKLNLKRAELKEVADKLQALNDEFDAMTTKKKELEANIDLCEKKLDRAEKLIGGLGGEKERWTETARLLEDRFFKVTGDVLLSSGEVAYLGPFTVDFRNECIDGWVKECTTRKIPCSESFSLNA--TLGDAVKIRAWNICGLPVDAFSVDNGIIVDNARRWPLMIDPQGQANKWIKNMEKE-NKLSVIKLSDANYVRTLENSITFGTPVLLENIGEDLDPILEPLLLKQTFKQGGVEYLKLGENSIEYSRDFKFYMTTRLRNPHYLPEISVKVTLLNFMITPLGLEDQLLGIVAAKEKPELEEKKNELILESAHNKKQLKEIEDKILEVLSSSEGNILEDETAIKVLSSSKVLSEEISAKQEIATATEKEIDETRNGYKPVATHSSVLFFCISDLASIEPMYQYSLTWFINLYLQSILNSERSPELSERIEFLNDHFTQSIYSNVCRSLFEKDKLLFSFILTIGILKGRNKVDDQVWRFLLTGGVALDNPYPNPCPEWLGDKNWSEIVRASDLPNLKG-LKDDLAN-PGWKKFYDSSTPQSESMPDPW-DLLSGLDRMVVLRCLRPDKIVPAVQDFIVENMGRSYIEPPTFNLQLSYDDSHCCAPLIFVLSPGADPMAGLLKFANDKGFGGNRIQTISLGQGQGPIAAGMIDQALKKGTWVVLQNCHLATSWMPKLEKICEE-VINPDDTHQDFRLWLTSYPSPDFPVSILQNGVKMTNEPPKGLRSNILRSYLNDPISDSEFFTACNKPAAWEKLLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISMRQLQMFLNDYDEIPLDALTYLIGQCNYGGRVTDDKDRRLLVCLLSICVCRDIVDNE---------------------------------------KHKN------------LFDCILLTLPRQSGGGGKSPAEMIEELAADILSKFPPLFDLEMVIKKYPVIYTDSMNTVLRQELIRFNRLTAVVISTLRNLQKAIKGLVVMSGELEDVFNNMLLGKVPAVWAAKSYPSLKPLGSYVTDLLDRLKFFQDWIDHGPPNVFWMSGFYFTQSFLTGARQNFARKYTIPIDHVGFEFNVMKEERDMDHKPEDGVYVNGLFLEGARWDRETMLVAESLPKILFDTLPVMWIIPGEKSKFKSKPNYPCPVYKTSARRGTLSTTGHSTNFVMFVDLPSDKTERHWVNRGVALLCQLDD 3976          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Nematostella
Match: EDO45806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRR2])

HSP 1 Score: 3391.67 bits (8793), Expect = 0.000e+0
Identity = 1828/3918 (46.66%), Postives = 2543/3918 (64.91%), Query Frame = 3
Query:  834 DTKQNFQTSVKKAILDYILLNKLEQKRLGLMMPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENI-CESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTP-SLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAA-SLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKS--HTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDL-NKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKC-KSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCE--MTDSPNQKY-------PRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNS-----GFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFG--DFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLF--ENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDP--SGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKAS--KRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            + K+++  SVKKAI+D++L +  E++        +  + + +   PW+   L +   +++  + T+ T+  +L  + K +  LRL+   +I      L L     +  ++ +   + L   W  + + I      +    +P +  +  + +E FFN  + L +N L+ +  NSI+++ E         C        S   + +   I+R+ L  D        F P F      L  + D +I +V    R+E  L+ +  GT  +L  I+S    EE V   K K+   ++     P ++ + Y  ++ L+ +  E    QF+    +   +  E+EK   L DE   +    + + +F L C+ + + L  R   L    L  M+   +V N+ +C +Y+ I  +       T  L+EL+ Y+E++    +  L+ +L +    + FL++Y      D+ LNN+ F W+ R+  + +     +   R +  N L+  +++FVE L     Q++EF     +++     ++   + ++L    E+    N EE        T Y Q Q+++    P+ KL+++ V F   Y +WM GP   +D ++VE+ET + W++ Y+L K  +  E     R A  +K K+E+FK  LP++Q + NPGL+ RHW+ MS  +GF + P  D  L+ M  M L+ +L     +S  ASKEFSLEKA  +M  +W  + F   PY+ETG +IL ++DDIQ LL+D IVKT TMR SPFI PFE+EI  W+  L   ++ ++ WLKVQA WLYLEPIF S DI  Q+P EG +F  VD+ WR  M     D  V+ VI  + +L  L+ S  LLE I KGLN+YLEKKRLYFPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGI+ L+FT+   IT M S+E E V     I   +A G VEKW+L+++  M  S+R+V+ +A+  Y +  R +WV+DWPGQ VL  +  +WT +   AI+     L+++L++N+ QI  IV LVR + L    R TL A +VLDVHARDV+ KL    +SSEDDF W++Q+RYY+          +N++ RM++  + YGYEYLGN+ RLVITPLTDRCYRTL GA++L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGLA  GAW+CFDEFNRI+LEVLSV+AQQI TIQ  I+   +  LFEGTE++LD +C +FITMNPGYAGRSELPDNLK LFRTVAMMVP+YA+IAEISLYS GFV AR+LA KIV  Y LCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     E+ ++L+SI DVNLPKFL  D+PLF GI SDLFPGV+ P  DY  LT    E  ++M L+ V  FL KI+QIYEM++VRHG MIVG+ F GKTCA++ L+ AL D+  K L  EN V   +INPK+I++G LYG+FD VSHEWSDG+LA  +R  ASS + +RKW+IFDGPVDA+WIENMNTVLDDNKKLCL SGEIIQ+ +  N+IFEP DLE ASPATVSRCGMIYMEP  LG  PL+  W+   LP+ L++E +  ++ LF+ +    L FI +   K         LV + + +  +L+D+  +  +                       K  NE E+       +L   +  S +WS GA LD + +  FD   R++ E  ++     KY       P P+   C      P K T++D+ F+K+  G W  W   I+  D   + K    + I+IPTVDTVR  + + +++ +G KP +FVG TGTGKS  I  F+L  L  + +    + FSAQT++ Q QD   SKLD+RR+G+Y PP  K  VVF+DD++MP +E YGAQPP+E+LRQ +DH  W+D KD +P+ + D+ I +AM  P   R  +T R LRHFN I+I +FDD TM  IF  IM+WH  +     GF      +  ++V+ T +I+++ + + LPTPAKSHY+FNLRDF+RVIQG LL        +T+ D    L RLW HE +RVF+DRL+   D D  +  +++V +     +F  LF   DF  D K   + ++R L+F DF  AK DP               K Y E+ D + L   ++ YLDE+N MSK PM LVLFRFAIEH++RI R+++QP GH LLVG+GGSGRQS  +LA  + DF++FQ+E+ + Y+ ++WR+DI+ ++R T +      FLF D QIKE  FLEDIN LLN+G++PNLF  + +  +    +     + ++ Q + + + ++N FIERVR  LH+VL  SPIGDAF +RLR FPSL+NCCTI+WFQ WP DAL++VA + L+E EI+ DV+E  V MC+ FH S  DLS ++   + R NYVTPTSYLELI TF  LLNKKQ E++ +K RY VGLEKL  +++Q++ MQ EL+A QPQLI+  KE + ++ IIE +++EV K  K+VK +EA    +A  AK+IKD+C+ +L EA+P++ +A+ AL+TL   DI++VK M++PP GVKLVMEA+CILKG+KP++  DP  SGK +ED+W  +K++LGD+KFL  L++YDKD IP   +++IR +Y +NP FDP KIK  S+A EGLC WV A++ Y++   + +  K    +  S+       L  K+  L EV+ KLA+LQE ++   ++K+DLE  ++L   K++RAEKLI GLGGEK RW +V + L +R+ N+IGDVL+ +G+VAYLG FT  +RQ     + +  + +           L +++  PV++R+W I+GLP DSFS++N +I+ + NRW L+IDPQGQANKWIK +E ++N L VIKL+D  Y+R LENC+QFGTP LLENVGEELD +LE +LLKQTFKQ     I++GD V+EYS+DFRFYITT+LRNPHYLPE +VKVTL+NFMITP GLEDQ+LGIV A+E+PELE+ +  LI++SA N+RQLKEIED+IL++LS+S+GNILEDE AI +LSSSKVL+ +IS KQ  A +TE +I+  R GY P+A H +ILFF+I+DLA+++PMYQYSL+WFINL+I SI+NSE S +++ RL+NL +HFT ++Y N+CRSLFEKDKLLFSFLLC+ I     +V    WRFLLTGG+ LD+P  NP   WL  +SW+E+  L ++  FKG+ + F   ++ WK I DS  P     PG+WEE+    +++V++RCL P+K+ P V +++   LG +Y+EPP FDL  +F +S+S  P+IFVLSPG DP + L +FA+ +  S + L  +SLGQGQGPIA   I +++K   W++LQNCHLATSW+P L K+CEE  L     +P+FRLWLTSYPS  FPV VLQN VKMTNEPPKG+RAN++RSY   PISD +FF  +  K PQ F+K+LF LCFFHA+VQERR +G +GWNIPYEFN++DL+IS++QL MF+N Y++VQ EAL YLTGECNYGGRVTD++DRR ++++L   Y   ++  + +  + SG Y  P    D  +Y+ + +  P    PE+F +H N    +       +      T    +SG  +S   I+  ++ DILSK+PQ F  +    K+P  Y + MNTVL+QE++RFN+LI+V+R SLV+++ A++GL++M + LEEV   ++ GK+P LW + SYPSLKPLGSY++DL+AR+KF Q+W DNG P  FW+SGF+FTQ+FLTG  QN+AR+    ID L FDF ++E  +Y  P ++G +++GL++E  RW  +  ++ ES +KVL+D LPV+ + P     I     Y  PVYKT+ RRG LSTTGHSTN+V  + LPS Q  +HW+ RG+A LCQL+D
Sbjct:  131 EMKEDYLLSVKKAIVDFVLKDPREKEEDKKEEVLEHRIELDQVPKPWYKSYLMASAAIEQDLFVTNPTMAGVLDLWHKTFGTLRLVDKNDIQMRPEALELAMFQNVVMRHIEIAKETLLKRWFPEVQNIYYQG--NKRKQVPSN--QNAKRLEAFFNSASVLMTNQLQMLALNSISDYTELF-------CPPSS----SIRVLEHPGFIMRLVLEGDTVK-----FEPDFKDFEVVLLNVYDVMIKAVMVVPRVETKLYSEWSGTKKTLKPIIS----EEIVNEAKAKVHAVIEHEMAGPKEHLKFYDKYKDLITRKAEADVDQFLLEGHKFNRFSKEVEKFAKLVDEIQYNSRKVIRVGMFELHCDELIRALAKRGDGLRTKLLQRMSKDHQVLNKMLCEEYEKIAEKALTSPANTEHLMELKNYIEQVENETIFDLEKRLVETKSRLGFLVDYASFSPADMRLNNSVFQWHFRMPEVFEEHKKIVNANRVQYENSLKMRRERFVEELESYSKQLEEFQTFGDMSEVPRYLKKAQALHQRLETAAEKIVTFNVEEEAFGWDT-TSYPQRQQLINTLNPYLKLYETTVEFQNKYKEWMEGPWGTIDPDKVESETGNYWRSLYKLEKQLT--EVPLAQRIAGRMKTKVEEFKEYLPLVQVVFNPGLRDRHWEQMSEILGFPLKPDEDMNLAKMAEMNLEPYLAQFETISEAASKEFSLEKAMEKMVGEWDAVEFVMIPYRETGTHILSSIDDIQTLLDDQIVKTQTMRGSPFIKPFENEIKEWEGKLILTQEIIDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFSTVDKNWRETMKVAVLDKHVLTVIGIEKMLGKLKKSNELLELILKGLNEYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLQFTDTLDITHMKSSEGELVLLKDVISTSKARGQVEKWLLELQEDMVASVRKVIMEAMEAYLKEERVKWVRDWPGQTVLCVTQYYWTAEVHKAIRGGQKQLDQYLQQNNSQIDDIVTLVRGK-LSKQNRATLGALVVLDVHARDVLTKLCELGISSEDDFEWLAQLRYYF--------EEENVMTRMISAHLAYGYEYLGNSGRLVITPLTDRCYRTLFGALQLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQMGIKSGGDTLLFEGTEIKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPNYAMIAEISLYSYGFVNARSLAVKIVTTYTLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPDENEDILMLRSINDVNLPKFLAHDLPLFAGITSDLFPGVQLPKPDYTVLTAAAAEVCKSMNLQMVDEFLTKILQIYEMMIVRHGFMIVGEPFGGKTCAYRVLAKALSDVAEKGLMEENKVQIVVINPKSITMGQLYGQFDPVSHEWSDGVLAVNYRAFASSTTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLNSGEIIQLASTTNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWKPLLTSWLHT-LPKTLNEENKELIKDLFDRMEEALLQFIRKGGFKELSPTNDTNLVNSHMNMMDTLMDEFHDEQR----------------------FKELNEREV-----AAWLECIYLFSCVWSLGATLDGEGRKSFDKLLREIVEGPLSLESKSKYHILEIVDPPPRPFLCP----FPSKATVYDYRFIKEGMGKWELWTEEIK--DAPPIPKDMAFNEIIIPTVDTVRYTYLMEQLVTHG-KPSLFVGPTGTGKSVYITNFLLKKL-EETYKPLLINFSAQTTAKQTQDIIMSKLDKRRKGVYGPPLGKKTVVFVDDLNMPAREVYGAQPPIELLRQWLDHWQWYDLKDTSPIHLVDIQILAAMGPPGGGRNPITPRFLRHFNTISITKFDDGTMVKIFSRIMNWHLTTNASCRGFSKDFGPIGDMLVNGTLEIYRNAIVNLLPTPAKSHYLFNLRDFARVIQGTLLSAP---DRITEHDM---LKRLWSHEVFRVFYDRLVDGGDRDWLYNNLREVCKSHLNVEFDTLFQRLDFDGDGKVKED-DLRSLVFCDFTDAKADP---------------KPYVEVEDLDKLRGVVENYLDEFNNMSKKPMTLVLFRFAIEHVSRISRVIKQPRGHCLLVGVGGSGRQSLTRLAAHMADFDLFQVEIGKGYTSTEWREDIKAILRKTAEGETNGVFLFTDTQIKEESFLEDINNLLNAGEVPNLFPLDEKQEICEKMRQFDRQRDKSKQTDGSPVALFNYFIERVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPADALQVVAQRFLEECEIEADVKEGCVEMCKSFHTSTRDLSLRYQSELKRHNYVTPTSYLELISTFKALLNKKQQEVVKAKRRYEVGLEKLNSAQSQVASMQEELEALQPQLIQAGKEVDDIMVIIERDSIEVAKTEKIVKADEAVANEQAMAAKAIKDECDKDLGEAIPILESALAALNTLTPADITVVKTMKSPPAGVKLVMEAICILKGVKPDRIPDPSGSGKKIEDFWAPSKRILGDMKFLQGLQTYDKDNIPAPAIKQIRQKYTSNPEFDPDKIKVASTAAEGLCRWVIAMDSYEKYDHLTTTFKSIDLLLMSVL-CDFQGLNKKRAALKEVQDKLARLQEKYEANVKKKSDLEKQVDLCSKKLDRAEKLIGGLGGEKTRWTEVANALGVRYTNLIGDVLVSSGVVAYLGAFTAAFRQGTCRAYSSSGRLVEY------GRVLVALIAQPVKIRDWTIFGLPTDSFSIENGIIINNANRWPLMIDPQGQANKWIKNME-KKNNLHVIKLTDADYVRTLENCIQFGTPVLLENVGEELDPLLEPLLLKQTFKQGGSICIKVGDSVIEYSKDFRFYITTKLRNPHYLPETAVKVTLLNFMITPEGLEDQLLGIVVARERPELEEEKNALILQSAENKRQLKEIEDKILEVLSSSEGNILEDETAINVLSSSKVLANEISEKQAIAEETEEKIDKTRMGYTPIAVHSAILFFSIADLANIEPMYQYSLTWFINLFIMSIDNSEKSEELDKRLENLRNHFTYSLYCNVCRSLFEKDKLLFSFLLCVNILMHDGEVCRDEWRFLLTGGVGLDNPHSNPA-SWLPSRSWDEICRLDDMSKFKGFRQKFPRTLEGWKKIYDSNEPQTMPLPGEWEEKFDFFQKMVLLRCLRPDKITPCVQNFVTVKLGKKYIEPPPFDLGKAFADSNSCAPLIFVLSPGSDPTAALLKFADDQGFSGSKLSSLSLGQGQGPIALRMIEKAVKDGTWVVLQNCHLATSWMPTLEKLCEE--LNPDTTHPDFRLWLTSYPSPNFPVTVLQNGVKMTNEPPKGIRANIIRSYLGDPISDPEFFTGTGQKSPQ-FKKMLFGLCFFHALVQERRQFGPLGWNIPYEFNETDLRISVQQLHMFMNKYDEVQYEALKYLTGECNYGGRVTDDRDRRTLLTILNKFYTPGVIKDDRYKFSPSGNYYAP-DDGDYETYIEYARSLPLINHPEIFDMHANVFSLRTSMRHISVLTHQTCTQCVLLSGGGRSDDEIVASVSEDILSKMPQEFDTDAALRKFPTTYTQSMNTVLVQEMVRFNRLIKVVRSSLVNIQKAIKGLVVMSSELEEVVSGILKGKIPGLWMKKSYPSLKPLGSYVNDLLARLKFLQDWYDNGAPSVFWISGFFFTQAFLTGSKQNFARKYTIPIDLLTFDFEVLEDKKYETPPEDGVYVNGLFMEGARWDRDTKAIGESQAKVLFDSLPVMWLCPCKTEDIKKRPHYVTPVYKTSERRGTLSTTGHSTNFVMEMRLPSDQPQEHWVMRGVALLCQLDD 3941          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Nematostella
Match: EDO37961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE81])

HSP 1 Score: 2336.61 bits (6054), Expect = 0.000e+0
Identity = 1255/2577 (48.70%), Postives = 1700/2577 (65.97%), Query Frame = 3
Query: 4131 VIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHF-NSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDR--LXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDP--SGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQ---------SNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKA-SKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLI 11816
            ++R++   V YG EYLGN+ RLVITPLTDRCYRTLM A  LNLGGAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY  MGKFFKGLA  GAWACFDEFNRIELEVLSV+AQQI  IQRAI    + F+FEGT+L L+ +C + ITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALI EI LYS GFV+AR L+ KIV  Y LCSEQLSSQ HYDYGMRAVK+VL AAG LK K     E  ++L+SI+DVNLPKFL  DIPLF+GIISDLFPG++ P  DY      + E      ++ V +F +KIIQ YEM++VRHG        CG            G L    +   S +  +I  +         R+      W+DGI+A TFRE+A+       W                                                    PATVSRCGMIY+EP  LG DP+++ W+ + LPE L  E    +  LF W +P  L F+ + CK  V C    L  +++ L   +L +                               + E   +K  +  ++++ F  S++WS GA +D +S+ KFD FF+   ++       +P P  L       +P +G ++D++F +K  G W  W  LI+   L    K T I++I++PT+DT R  + +  ++ N  KP++FVG TGTGKSA +K  +++ LP   +L   + FSAQTS++Q QD   SKLD+RR+G++ PP  K  V+F+DD++MP  EKYGAQPP+E+LRQ +DH+ W+DRKD T + + D+    AM  P   R  V+ R LRHFN++++  F+DETM+ IF  I+ ++F N+ F          +V AT +I++  M + LPTPAKSHY FNLRDFSRV+ G LL+K   L +         + RLWVHE YRVF+DRL+  +D D     +       F      LF   S D       +MR LMF DFL    +P+ +          E +LY E+T+ + L++ ++  LDEYN   K  M+LV+FR+ +EH+ RI R+L+QP G++LLVG+GGSGRQS ++LA  I  F +FQ E++++Y +++WR+D++ L+++ G +   T FL  D QIKE  FLED++ LLN+G++PNLF  +++  +    +     Q ++   E + + ++N F+   ++ LH++L  SPIGDAF +RLR FP+LINCCTI+WFQ WPEDAL+MVANK L++  +  + R++IV +C++FH S  +LS+K+ EV+GR NYVTPTSYLELI +F  LL +KQ E++ SK RY VGLEKL F+ +Q++ MQVEL+  QPQL+  + E +K++ IIE E+ EVE   ++V+++EA   ++A +A+++KD+CE++LAEA+P + AA+ AL+TLK  DI+IVK+M NPP GVKLVM AVC++K +KPEK  DP  +GK + D+W  +KKLLGD+ FL  LK YD+D I    M KIR +YI NP FDP K+K  SSA EGLC WV A+E+YDR+ KVV+PKKE LA AE+     M+ L  K+ EL EVE+KLA L+  FQ   ++K +LE  ++L   K+ RAEKLI GLGGEK RW      L   FDN+ GDVL+ +G++AYLG FT G+R+EC   W   C+S +IP S +   S    LG+ +++R W I GLP DSFS+DN VIV    RW L+IDPQGQANKWIK  E E N+L VIKL+D  Y+R LEN +QFG P LLENV EELD  L+ +LL +  K+           V  IRLG+ V+EYS DFRFYITT+LRNPHYLPE S KVTL+NFMITP GL+DQ+LGIV AKE+P+LE+ R  LI++SA+N++QLKEIED+IL+ LS+S+GNILEDE AI+IL SSKVLS++IS KQ+ A++TE +IN  R GY P+A H S+LFF+I+DL ++DPMYQYSL+WF+NL+++SI +S  S  +E RL+ L+ HFT  +Y N+CRSLFEKDKLLFSF+LC  I K ++++D   + F LTGGI L++  +NP P WLS++SW+E+  + +L  FK + K F     +W+ I DSK PH    P  W E+L+  ++++VIRCL P+KV+P V +++   LG ++++PP FDL  S+ +S++  P++F+LSPG DPM+ L +FA+ K  S      +SLGQGQGP+A   I E++++ +W++LQNCHLA SW+  L KICE+  L     + +FRLWLTSYPS+ FPV VLQN VKMTNEPP GLR NLL+SY T PISD +FF    ++  V+EKLLF LCFFHA+VQERR +G +GWNIPY FN+SDL+IS+RQLQMFIN+YE+   +A+TYLTG CNYGGRVTD+ DRR +MS+L   ++ +++    +  + SG Y  P   S  + Y+  I+  P + +PEVFG+H N +++K+ + T  L    L        G  K S+  + ++A+DILSKLP+ F +E    KYPV YEE MNTVL+QE+ RFNK +
Sbjct:    1 MVRIINASVKYGCEYLGNSGRLVITPLTDRCYRTLMSAFHLNLGGAPEGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYLQMGKFFKGLASCGAWACFDEFNRIELEVLSVVAQQILCIQRAIAAHQDRFIFEGTDLNLNPNCYVAITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIGEIMLYSYGFVDARNLSVKIVTTYTLCSEQLSSQFHYDYGMRAVKAVLAAAGNLKLKYPNNDENVLLLRSIMDVNLPKFLSHDIPLFEGIISDLFPGIKLPKADYDTFLDTVQEVCAKKNIQFVDFFREKIIQTYEMMVVRHG--------CGT-----------GSLTPSPSQWYSFLASLIQFRI--------RY------WTDGIVANTFREYAADHDGNPMW----------------------------------------------------PATVSRCGMIYLEPSSLGWDPVLQSWLGE-LPEVLK-EHDKLIDALFKWALPACLTFVRKSCKEAVHCSDSNLARSLMNLVEIMLKEA------------------------------SEEGADIKHLKI-WVVSSFLFSVVWSVGACVDTESRAKFDVFFK---DLMGGKLDDHPIP-TLVGKIESPIPPEGMVYDYLFERKNRGNWLQWTKLIKSTSLGG--KGTRINDIIVPTMDTARYSYLMDLMIHNN-KPLLFVGPTGTGKSAYVKDKLMNGLPKDLYLPAFVNFSAQTSANQTQDIIMSKLDKRRKGVFGPPVGKRFVIFVDDVNMPALEKYGAQPPIELLRQYLDHRNWYDRKDTTKISLIDLQFICAMGPPGGGRNPVSPRFLRHFNVVSVATFNDETMQRIFSSIVQFYFRNNDFPTDALCAGNQVVSATMEIYKEAMINLLPTPAKSHYTFNLRDFSRVVLGVLLIKKDALAD------KKTITRLWVHEVYRVFYDRLVDDKDRDW----LHTTCNCDF---LCTLFSQASED-------DMRSLMFCDFL----NPDAM---------AEDRLYQEVTEIDELYKIVEACLDEYNQTHKTGMNLVVFRYVLEHLVRISRVLKQPGGNALLVGVGGSGRQSLSRLAADIAGFAVFQPEISKSYGMTEWREDVKTLLKSAGCQMKPTIFLLTDTQIKEESFLEDVDSLLNTGEVPNLFPTDEKAEIIEAVRPHAQAQAEDKNAEFSPLALFNFFVNSCKEKLHIMLCMSPIGDAFRNRLRQFPALINCCTIDWFQPWPEDALEMVANKFLEDAVLTDNERKEIVTLCKYFHTSSRNLSEKYLEVLGRHNYVTPTSYLELISSFKTLLGRKQDEVLRSKRRYEVGLEKLAFAASQVAKMQVELEELQPQLVVAAAENDKMMIIIEKESKEVEATSELVRKDEAAANIQAAEAQALKDECEADLAEAIPALEAAMSALNTLKPADITIVKSMANPPAGVKLVMSAVCVMKDIKPEKVNDPGGTGKKILDFWGPSKKLLGDMTFLTSLKEYDRDNISPHIMAKIRKEYIPNPDFDPSKVKTASSAAEGLCKWVIAMEIYDRVAKVVAPKKESLAKAEASLAETMSLLNAKRRELAEVEAKLAALKSQFQEMTEKKENLEFQVDLCSKKLVRAEKLIGGLGGEKDRWSLAAKTLQDTFDNLTGDVLISSGVIAYLGAFTAGFRKECTHEWTKICQSKNIPCSDDFLLSK--TLGEAIKIRAWNIAGLPTDSFSIDNGVIVDCARRWPLMIDPQGQANKWIKNSEKE-NQLSVIKLTDGDYIRTLENSIQFGNPVLLENVEEELDPSLQPMLLGRDSKKPYHVKITLVGGVVCIRLGESVIEYSSDFRFYITTKLRNPHYLPELSTKVTLLNFMITPEGLQDQLLGIVVAKERPDLEEERQALILQSAANKKQLKEIEDKILETLSSSEGNILEDETAIQILDSSKVLSDEISKKQKIADETEAKINESRRGYNPIAAHASVLFFSITDLPNIDPMYQYSLTWFVNLFLNSIHDSNKSKILERRLRYLSDHFTYNLYCNVCRSLFEKDKLLFSFVLCANILKSKSELDMTEFMFFLTGGIGLENKLENPDPSWLSDRSWDEICRMCDLSGFKDFRKSFSNTTHEWRKIYDSKEPHRAPLPSPWSEQLTDFQKMIVIRCLRPDKVVPLVTNFVEDKLGKKFIQPPPFDLAKSYVDSNACAPLLFILSPGADPMAGLMKFADDKGFSGDKFNAISLGQGQGPVAARLIQEAVQNGSWVVLQNCHLAVSWMTALEKICED--LNPETTHTDFRLWLTSYPSNKFPVTVLQNGVKMTNEPPTGLRQNLLQSYITDPISDPEFFNGCGEKAPVWEKLLFGLCFFHALVQERRKFGPLGWNIPYGFNESDLRISVRQLQMFINEYEETPYDAVTYLTGACNYGGRVTDDNDRRCLMSILADFFNPDIVHDSKYKFSLSGNYYAP-PKSTYDEYVEFIQELPQSQSPEVFGMHDNVDISKDCKHTRVL----LTQAQGAGGGGGKKSEDTLLEIATDILSKLPKNFDLEAALAKYPVTYEESMNTVLVQEMERFNKYV 2409          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Nematostella
Match: EDO34077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG6])

HSP 1 Score: 2064.27 bits (5347), Expect = 0.000e+0
Identity = 1229/3398 (36.17%), Postives = 1928/3398 (56.74%), Query Frame = 3
Query: 1425 SGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIY----TNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVR----RLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDI--LLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGV------QTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVG--FDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFT------EETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKA-LTCYNQIS-RCQWVQDWPGQVVLAASAVHWTEQATNAIKSHT----LEEFLKKNDQQISSI---VELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENSVIFDI-INPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFD-HIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKA-PMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEI-KQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQ-------AFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECV-ELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQK--NPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVP 11477
            +G   S  N +LR+ +   +     + F P+  ++   +  I   +   +  F RL ++L  K   +   P  L +   EE      +K++  +K    A   + Q Y      +R +     +    ++   +  +  ++A++ +   +++      T L +   +LDC  +   LL    +    + N  T   R       T+ ++ ++    +L+   ET  +L +    +E+L+  +L  ++ K     +    L  Y +   +++  +L+  +  W      ++DS    L K +E+    L    ++F + + GL     +F  +   + ++  ++ L+++ +   + +  K Q    E  L  G+      Q     LQ +    E  +++W     + +L+D W  G  +E+   ++E + Q L+K   RL K+    + K    C  +IK+++E+FK  +P+IQ L N  ++ RHW  +  +V   FD T   D  L  ++ +GLD+  E + E+S  ASKE S+E+A   + + W ++     PYK+ G   L   D++   LED+ V  STM+ S ++  FE+E++ W++TL  + + +   L VQ  W+YLE IF   DIR+Q+P E  +F+ V+  W+ IM ++  D   +    +  LLE L      LE+IQK L+ YLE KR  FPRF+FLSN++LLEIL ++K+P  VQPHLKKCF+ I  LK        ++T   GM SAE E V+F + +     EG VE W+  VE +M+ +L+E++K   L     +S R +WV++WPGQ+ + +S + WT     A+ S       +       +Q+S +    E++R  +L  + R+ + A + ++VH RDV+ KL+ +  +    F W+SQ+R YW  ++      D+ V+R   T+  YGYEYLGN+ RLVITPLTDRCY TL  A+ L+ GG+P+GPAGTGKTET KDL KA+    +V NCS+GLD+KSMG+ + GLAQ+GAW CFDEFNRI +EVLSV+AQQI +I  A+      F+FEG E+ L  SC IFITMNPGYAGR+ELPDNLK +FR ++M VPD  +IAEI L++ GF   + LA K+  +Y L  +QLS Q HYD+G+RA+ SVL  AG+ KR    +++E ++L S+ D+N+ K    D PLF+GI+SDLFPG+E P+IDY  L   ++  L+    +P P  + KIIQ+YE    RH  ++VGQ+  GK+  ++ L  A+  L ++     +V+ +  INPKA+S+G LYG FD  ++EW+DG+L+   R+  S E  E KWI+FD PVD +WIE+MN+V+DDNK L L++GE I M +  +++FE EDL  ASPATVSRCGM+Y +   LG  P +  W    L   +D +    +Q LF   +P  L+F    CK  V    L  V ++  L+ +L  +   V                         +++N      E     L   F   LIWS                    C   D  ++K  +  N         P K T+++ H+ +K++   W +W+  +          +   + I+IPTVDTVR  F +  +++  ++P++  G  GTGK++V +  +L  L  K +    +  SAQTSS+ VQ+   SK+++R +G+Y P   K ++ F+DD +MP K+ +G+QPP+E++R  ID+ FW+DR   T   ++D+ + ++M  P   R  ++ RL   FN+I +    +  +K IF  +++      FE  +K L  ++  AT +I+ +++A  LPTP + HY+FNLRD S++ QG  LL++    N    D+   + RLWVHE +RVF DRLI + D + F  L+   +   F   FH    +   + + P        +FG+F+K                  +  +Y ++ D +A+ + M+  +++YN+      ++LVLFR AIEH+ RI R++ QP G+ LLVGIGGSGRQS  +LA++I ++++FQIE+T+ Y   ++RDD++RL    G     T FLF D Q  E  FLED+N +L+SG++PNL++ ++      +           ++ T  +M++ FIERVR NLH+VL  SP+GD F +R+R +P+ +NC TI+WF  WP DAL  VA + L+ +E+  ++ +  +  +    H+SV D+S +    + R NYVTPT+YLEL+  + +LL +K+ E+  +  +   GL+K++ +  ++ +M VEL+        FQ Q  E      +  +  + +   V+   + +  EE  C V AE+A       + +L EA+P +  A++AL++L + D++ +K+   PP  V+ VMEAV IL+  +P              W  AK+ LGD  F+  L +YDKD + +  ++KI   Y   P F P  I  +S A + LC+WVRA+EVY RI +VV PKK++L  A +  + + A L   + +L EV  ++ +L+  +  K  +K +L    EL ++K++RA KL++GL GE+ RW   ++ L      ++GD L+ A  ++Y GPF   YR E V + W  + + + +  +   +FS    L  P  VREW I GLP D+FS +N V+VT  NRW L+IDPQGQA KWIK +E  ++ L++I L    YLR LEN +QFG+P LL+NV EELD  L  +L K   K      I+LGD  VEYS DFRFYITT+L NPHY PE S K T+VNF +   GLE Q+LGIV  +E+PELE+++  L+I  A+ +++L+E+ED+IL++L T++G++L+DE+ +  L+SSK  S++++ +   + +TE +I+  R GY+P A   SILFF ++D+  +DPMYQ+SL  +I+L+ +SIE S+ S +++ R++NLN + T AVY+  CR LFE+ KLLFSF +C  I +   K++   + F L GG+ LD   +  NP   WL++ SW+ +  L  L  F G +  F    + W     S  P     PG+WE   + L+R++V+R L P++V     S+IV  LG ++VEPP  D+     +S + TP+IFVLSPGVDP S L + AE   +S      +SLGQGQ PIA   I E +K  NW+ L NCHL+ SW+P+L K+ E+L ++  + +P+FRLWL+S P   FP+++LQ  +KMT EPPKGL+AN+ R Y    I+++ F +  K+ + ++KLLF LCFFH+V+ ERR +  +GWNI Y FNDSD ++S   L +++++YE+   +AL YL    NYGG VTD+ DRRL+ S +  +++ + + +  + L+   TY VP
Sbjct:  678 NGDGKSIPNPLLRVKV---VLEGDKVEFSPTLTKLASMMDNIASTLTTCLQIFKRLPDLLTRK--KSIKEPVHLVIERDEE-----TKKIQTSIKAGMSANASHLQSYLSTWDGYREIWEIQKDAFIRRYQRLNPPVSSFDADIARYTEIANNFQKEETVLNIDFVLLDCSPLKFALLSHCNE----WQNKFTTLLREMASQKLTELNNFLKGNAKKLSAPPETLDELGDSLSLLEQLQN-DLPNIEAKFAPLHQQFAILEKYEVAIPEEVQGMLDALSGEWLLFQQCLIDSD-VMLKKSKEKFKTGLIHSSEEFKKTVNGL---FDDFQSKGPFSSSIGVKEALEQVTQYHEQVVNLKSQ----ETSLRRGLNIFKIEQALSKDLQNLEKDLEHLEQVWTVTKEWEELWDTWKVGKFVELVTTDMETQAQLLFK---RLNKIIREVKDKNWEICD-SIKSRIEQFKRTMPLIQDLKNSAMRDRHWSQIKTEVQKPFDHTGD-DFTLEKIIELGLDQFGEQICEISGAASKELSIEQAISGIASIWDQVSLDIGPYKDRGHFRLKQTDEVFQQLEDNQVTLSTMKASRYVKAFEAEVDKWERTLSLILEVVEMILTVQRQWMYLENIFLGEDIRKQLPRESAEFDDVNANWKIIMQRLNKDPNALRGTHYPGLLETLNDMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSKNPEAVQPHLKKCFDNIKTLKMARVGLTFDKTEAVGMYSAEGEYVEFGHSVL---LEGPVEAWLCDVERSMRWTLKELLKHCRLGLKKSLSKRDKWVKEWPGQLTITSSQMQWTSDCNKALSSSKERGDKKALKSLKKKQVSMLNKFSEMIRG-SLTKMQRLKIVALVTIEVHGRDVIEKLIKAGCNDVTAFEWLSQLRLYWDKDI------DDCVVRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGNYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGATRFVFEGREINLVWSCGIFITMNPGYAGRTELPDNLKSMFRPISMCVPDSGMIAEIILFAEGFNNTKVLAKKVHTLYTLAVQQLSKQDHYDFGLRALTSVLRYAGRKKRANPDMSDEEILLLSMKDMNVAKLTTQDAPLFNGIVSDLFPGIEAPVIDYGKLRNAIVAELKDGGYQPTPNTILKIIQLYETKNSRHSTIVVGQTGSGKSVTWRVLQSAMTRLKRDGEPGFNVVREFPINPKAVSLGELYGEFDLNTNEWTDGVLSSVMRQTCSDEKPEEKWILFDAPVDTLWIESMNSVMDDNKVLTLINGERISMPDMVSLLFEVEDLAVASPATVSRCGMVYTDFRDLGWQPYVDSW----LDRRVDKQSVEHLQRLFEKFVPKVLEFRKHHCKEPVPTSELNSVVSLCVLFDALATEENGV-------------------------RMSN-----GESYARMLELWFLFCLIWSV-------------------CASVDEDSRK--KMDNFLRELEGQFPAKDTVYEYHVDIKQK--TWASWEDKLRSGW--RYNPSVPFYKIMIPTVDTVRYDFLVYNLIQ-AKRPVLLTGPVGTGKTSVAQK-VLQKLDPKTYGLLVINMSAQTSSNDVQEIIESKVEKRTKGVYVPIGGKQMITFMDDFNMPAKDTFGSQPPLELIRLWIDYGFWYDRMKQTVKYVKDMHLLASMGPPGGGRMVISKRLQSRFNLINMTFPQESQIKRIFGTMINQKLQD-FEEDVKPLGDIMTQATIEIYNTIVAKMLPTPTRIHYLFNLRDISKIFQG--LLRA----NKDLHDTKTAISRLWVHECFRVFSDRLIDNTDRESFVTLLSDKLGSMFDLTFH----NLCPNKQSP--------IFGNFMK------------------DDTMYEDLVDFKAIKRYMEDQMEDYNMEPGVIAINLVLFRDAIEHVTRIVRVIGQPRGNMLLVGIGGSGRQSLTRLASYIIEYKVFQIEVTKHYRRQEFRDDLKRLYYQAGVDNKPTVFLFNDTQALEEGFLEDVNNILSSGEVPNLYKPDE--FEEVRTALSDIAAKEDVQDTPESMFHFFIERVRSNLHIVLCMSPVGDPFRNRIRMYPAFVNCTTIDWFSEWPGDALLEVAERYLENIELGDEETKANVAQIFVTVHRSVVDMSARMLLELKRHNYVTPTNYLELVSGYQSLLAEKKKELGDAASKLRNGLDKIDDTRAKVEVMSVELEDATLKVAEFQKQCEEYLVVIVQQKREADEQQKMVQARSEKIAIEEDKCRVMAENA-------QHDLDEAIPALQEAMKALESLNKKDMTEIKSYGRPPALVEKVMEAVMILRQSEPT-------------WAEAKRQLGDGNFIKQLVNYDKDNMTDRILKKIG-TYCAQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKKQRLHQATAQLEEKQAILAEAKAKLKEVTDRMEELKRQYDEKSAQKEELRAKAELLEIKLDRAGKLVSGLAGERDRWEASVTILEENIGYLVGDCLIAAAFMSYAGPFLSNYRDELVLKTWLAQVRQLGVACNPNFSFSG--FLAKPTTVREWNIQGLPSDAFSTENGVMVTRGNRWPLMIDPQGQALKWIKNMEG-KSGLKIIDLQQSDYLRTLENAVQFGSPVLLQNVQEELDPSLAPILNKSVVKVGGRYLIKLGDKEVEYSPDFRFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDALVINIAAGKKKLEELEDEILRLLQTAQGSLLDDEQLVNTLNSSKTTSQEVAEQLTVSEQTEIKIDAAREGYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNNSIEKSQRSPNLDNRIQNLNEYHTYAVYKYTCRGLFERHKLLFSFQMCSKILEAAGKLNMDEYNFFLRGGVVLDREGQMDNPCTQWLTDTSWDNVTELDKLPNFHGIVTSFEQYPRDWNQWYTSSEPENTPLPGEWENACNELQRMLVVRSLRPDRVSFTATSFIVNNLGSKFVEPPVLDMSSVVDDSSTRTPLIFVLSPGVDPTSALLQLAENCGMS-NRFHALSLGQGQAPIATRMIKEGVKDGNWVFLANCHLSLSWMPQLDKLVEQLQVE--DPHPDFRLWLSSSPHPEFPISILQVGIKMTTEPPKGLKANMKRLYQL--ITEQQFSRCHKQDK-YKKLLFGLCFFHSVLLERRKFLMLGWNIVYGFNDSDFEVSENLLSIYLDEYEETPWDALKYLVAGVNYGGHVTDDFDRRLLHSYINEMFNDQAIQTPYYKLSSLPTYYVP 3907          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Nematostella
Match: EDO47920 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKK0])

HSP 1 Score: 1763.81 bits (4567), Expect = 0.000e+0
Identity = 1136/3370 (33.71%), Postives = 1803/3370 (53.50%), Query Frame = 3
Query: 2535 QEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDH-IVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIF-GSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDN---LLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETV------ITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIK------SHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAI--PSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFN-SGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLF----FELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVE-IKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDY-WPTAKKLLGDL-KFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECV-ELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRR-----QLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKV--DELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLS--PTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSS-----VFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELL-----LSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQT---IIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWI-DNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDK--LDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAAL 12485
            +E++ +K+    LW          ++W   P  E+D E +E E +   K    L K      + G     +T+K  +     +L  +  L NP +++RHW  +            DT L+D+LA+ L    +++  +  KA+KE  +EK    +   W ++ F    +  T + +L + +++   LED+ +V+   +  S +IG F  E+  W K L      +  W +VQ  W +LE IF GS DIR Q+P +  +F+ +D  ++ + N+    +K+ NV++  N   L E L++ +  L   +K L +YLE KRL FPRF+F+S+ +LL+ILS    P+ V  HL K F+ +++LKF E+          GM S E E V+F       + +G VE W+ +V   M+ ++R+   +++  Y +  R QW+ D+P QV L  + + WT +   A         + ++++ KK   Q+S+++ ++   +L    R  +     +DVHARDVVAKL+  +V S   F W+SQ+R+ W  +     +N      +   +  Y YEYLGNT RLVITPLTDRCY TL  ++ L + GAP GPAGTGKTET+KDL +A+     VFNCS+ +DYKS G  +KGL+Q+GAW CFDEFNRI +EVLSVIA Q+++IQ AIRD+ E F+F+G ++ L  +  +FITMNPGYAGR+ELP+NLK LFR  AM+VPD+ LI EI L + GF+EAR LA K + +Y LC E LS Q HYD+G+RA+KSVL  AG LKR  R   E++V+++++ D N+PK +  D+P+F G+I DLFP ++ P     D   ++ + +  +KL+P   F+ KI+Q+ E++ VRH + ++G +  GKT   ++L+    +  ++      ++FD +NPKA++   L+G  +  + EW DG+ +   R+ ++  SD  KWI+ DG +D +WIE++NTV+DDNK L L S E + +T    ++FE   L+ A+PATVSR G++++    +G +P +  WI     +     ++  +Q+LF+  +P  LD +  + K       + +V  +  L   LL                              N   + N+ L E        +F  + +W+FG  + +D  + +          T+         K +K       P  GT+FD+ ++  +   +  W   ++K +LD  +    +  +L+ T +T R RFF+  +++N R+P+M VG  GTGK+ ++  +   SL     +  ++ F+  T+S  +Q      L+++    Y PP +K L+ FIDD++MP  + YG   P  ++RQ +D+  WFDR   T L ++D+     +A   P+A    +  RL RHF + AI     + +K I+  I++ H     F   + + ++ +  A   + Q V + FLPT  K HYVFNLRD S + QG L      +K            RLW+HE  RV+ D+LI  +D ++F     ++ KK  E   +E  +           +P        MF  F           SSG     GE K Y  + D E L + +   L+ YN ++ A M+LVLF  A++H+ RI R+L  P G++LLVG+GGSG+QS A+LA FI   E+FQI + + Y + D + D+  L    G K I T FL  D Q+ E  FL  IN LL SG+IP L+ +++            + +   ++ T  N +  FIERVR+NL +VL FSP+G     R R FP++ NC  I+WF  WP++AL  V+ + ++++E ++ + +  +     + H SV++ S+ +     R NY TP S+LE I  + NLL KK  E+    ER   GL KL+ +  Q+  ++ +L + + +L + +++ +KLI+ +  ET +V K + +  +EE    V A+D    +  CE +LA+A P + AA EAL+TL + +++ +K+  +PP  V  V  AV +L          P+ K+ +D  W  AK ++G +  FLD L +YDK+ I E+ ++ ++  Y++NP F+P  IK  S A  G+C WV  +  +  I   V PK++ L  A +       +L   + ++ E++  LA+L  NF+    EK   +   E T   IE A +L+ GL  E  RWG+ +     +   + GDVLL    V+Y G FT  YR   + + W     S +  +         S+L D   +  W    LP D  S +NA I+T+  RW L+IDPQ Q  KWIK  E   N L +++L  KGYL  +E  +  G   L+EN+GE +D VL++++ + T K+     I++GD  VEY  DFR  + T+L NPHY PE   + TL+NF +T  GLEDQ+L  V +KE+P+LE+ +    I   + ++     +LKE+ED +L  LS + GN L D   +E L  +K  + +I ++   A +TE +IN  R  Y+P A   S+L+F ++DL  ++PMYQ+SL  F  ++  +IE +E + +++ R+ NL    T +V+    R LFEKDK++F+  +   +   + ++   EL +       +++ SP      D+LS  SW  +  LSN+E F+   +D   + ++WK   +S+ P  EKFP +W+ + + L++L ++R L P+++  AV +++   LGH+YVE       +SF+ES   TPI F+LSPGVDP+ D+    +    +    N   VSLGQGQ  +AE  +  + K  +W+ILQN HL  +WLP+L K  E         NP++R+++++ P+      + P  +L+ S+K+TNEPP G+ ANL ++       ++D  +   R   F+ +LFSLC+FHAVV ERR +G  GWN  Y FN  DL IS+  L  ++     V    L YL GE  YGG +TD+ DRRL  + L      E+L     L+  FPL  +         SD   Y  +I    P  +P ++GLH NAE+      ++ LF ++L   P++  G   +SQT    ++ +  DI  KLP+ F + E+  +  V        V  QE  R N L   ++ SL  L   ++G + + + +E++  ++ +  VP  W++ +YPS+  L ++  DL+ RIK  + W  D   P+  W+SGF+  QSFLT + Q+ AR+N   +DK  L  D       +++ P  EGA++HGL++E  RW  +   + +S  K L   +PV+ I        + +N Y CPVYKT  R            YV+   L + +    W   G+A L
Sbjct: 1277 REVILLKQ----LWDMIFVVLTSIEEWKFTPWAEIDVENMEMECKRFVKEIRSLDKEMR--AWDGFTGLDSTVKNMV----TSLRAVGELQNPAIRERHWQQLMQATKVKFVMDDDTTLADLLALNLHNFEDEVRGIVDKATKELGMEKVLKELDVTWSQMEFEHEEHVRTHIPLLKSSEELIETLEDNQVVQLQNLMTSKYIGHFLEEVTSWQKKLSTADSVITIWFEVQRTWSHLESIFIGSEDIRNQLPEDSKRFDGIDVDFKELTNE---GAKIPNVVECCNRPGLFEKLENLQERLSLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNQPVEVARHLSKLFDNMARLKFKEDDAGNVTKDAVGMYSKEGEYVEFDS---VCDCDGQVEIWLNRVMDRMRATVRKEQSESVVSYEEKPREQWLFDFPAQVALCGTQIWWTTEVGIAFGRLEEGYENAIKDYYKKQVSQLSTLINMLIG-DLSKGDRQKIMTICTIDVHARDVVAKLIQQKVDSAQAFLWLSQLRHRWDDQQSHCFAN------ICDAQFKYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLSQTGAWGCFDEFNRISVEVLSVIAVQVKSIQDAIRDKKERFIFQGEDICLVPTVGLFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLEARALARKFITLYSLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRSDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRDPDFEALVKKSVTDLKLQPEDSFILKIVQLEELLAVRHSVFVLGPAGTGKTQVIRSLNKTYMNQKRK-----PMMFD-LNPKAVTADELFGFINPATREWKDGLFSTIMRDLSNIASDSPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERVPLTPSMRLLFEIGHLKTATPATVSRAGILFLNFADVGWNPYVSSWIDTREVQ----SEKANLQILFDKYVPVCLDLLRVRFKKITPIPDITMVTTLCYLLECLL---------------------------TPANTPPDCNKELYE-------LYFVFAAVWAFGGAMFQDQLVDYR---------TEFSKWWVTEFKTIK------FPSAGTVFDY-YIDSETKKFVPWTDKVQKFELDPEVP---LQAVLVHTAETTRVRFFMDLLMEN-RRPVMLVGGAGTGKTVLVNDY-FQSLDPDVSMVGNVPFNYYTTSAMLQQVLEKPLEKKAGRNYGPPGNKKLIYFIDDMNMPMVDTYGTVQPHTLIRQHLDYSHWFDR---TKLTLKDIRNTQYIACMNPTAGSFTINPRLQRHFAVFAISFPGLDALKTIYLSILNGHMKVHNFASAVSKFTEKVTDAALAMNQKVTSTFLPTAIKFHYVFNLRDLSNIFQGILFATHECIKTPVD------FARLWMHECNRVYRDKLIDDKDMEVFDKIQIDMTKKFFEELDEEAMYA----------KPN-------MFSHF-----------SSGI----GEPK-YLAVPDWEVLSKLLTEALENYNEVN-AVMNLVLFEDAMQHVCRINRILESPRGNALLVGVGGSGKQSLARLAAFISALEVFQITLRKGYGIPDMKLDLANLCTKAGLKNIGTVFLLTDAQVPEENFLVLINDLLASGEIPGLYPDDE--VENIISGVRNEVKGAGLQDTRENCWMFFIERVRRNLKVVLCFSPVGATLRVRSRKFPAVTNCTAIDWFHEWPQEALVSVSRRFIEDLEQLEAEYKPPVAEFMSYVHTSVNEESQMYLANERRYNYTTPKSFLEQINLYRNLLKKKSKELTQKTERLENGLLKLQSTAQQVDDLKAKLASQEVELKQKNEDADKLIQKVGVETEKVSKEKAIADDEEKKVQVIAKDVSEKQRSCEEDLAKAEPALLAAQEALNTLNKGNLTELKSFGSPPGAVVNVCSAVMVLLA--------PANKIPKDRSWKAAKIMMGKVDAFLDQLINYDKENIHESNLKAVQ-PYLDNPEFEPDFIKGKSLAAGGICAWVINIVQFYYIFCDVEPKRKALEAANAELAAAEEKLSKIKAKIQELDENLAELTANFERATSEKLKCQQEAESTAKTIELANRLVGGLASENVRWGESVKSFKEQEKTLPGDVLLTTAFVSYHGCFTRRYRDNLLNDKWLVFLASQNPKIPITEGLDPLSLLTDNATIATWNNENLPADRMSTENATILTNCERWPLMIDPQLQGVKWIKTREG--NDLRIVRLGQKGYLDTIERAVSNGECVLIENMGENVDPVLDALIGRNTIKKGRA--IKMGDKEVEYHADFRMILHTKLANPHYKPEMQAQTTLINFTVTREGLEDQLLADVVSKERPDLEETKASDRIFPLTQQQNAFTIKLKELEDSLLARLSAAGGNFLGDYALVENLEITKRTAAEIEVQVTEAKQTEIKINDAREAYRPAAARASLLYFILNDLNKINPMYQFSLKAFSVVFQKAIERAEPAEEVKARVVNLIDCITYSVFIYTTRGLFEKDKIIFTAQVAFQVLLMKKEIIPHELDFLLRFPAVMNVTSPV-----DFLSNLSWGGIKALSNMEEFRNLDRDIEGSAKRWKKFAESECPEKEKFPQEWKNK-TALQKLCMMRALRPDRMTYAVSNFVEEKLGHKYVEDAPTPFAMSFEESGPATPIFFILSPGVDPLKDVEAHGKKIGFTFDAKNFHNVSLGQGQEIVAEQCLDLAAKEGHWVILQNVHLVKNWLPKLEKKLEAF---SEGSNPDYRVYISAEPAGTPDAHIIPQGILETSIKITNEPPTGMMANLHKALNNF---NQDTLEMCARENEFKSILFSLCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVDVLYNYLEANAKVPWTDLRYLFGEIMYGGHITDDWDRRLCKTYLEEYMKPEMLEGELNLAPGFPLPPN---------SDFKGYHLYIDETLPPESPYLYGLHPNAEIGFLTTTSDNLFRTLLEMQPRDAGGGEGASQTREEKVKQVLDDIFEKLPEEFNVPEMMAR--VEDRTPYTVVAFQECERMNMLTNEMKTSLKQLDLGLKGELTITSEMEDLSNALFLDDVPESWTRRAYPSMFGLAAWFVDLLLRIKELEQWTSDFCLPNVVWLSGFFNPQSFLTAIEQSMARKNEWPLDKMALQVDVTKKNKEDFNSPPREGAYVHGLFMEGARWDTQTGMIADSKLKDLTPAMPVMFIRAIPVDKQDTKNVYECPVYKTRQR---------GPTYVWNFFLKTRENPSKWTLAGVALL 4468          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Medaka
Match: dnah12 (dynein axonemal heavy chain 12 [Source:NCBI gene;Acc:101164478])

HSP 1 Score: 3161.32 bits (8195), Expect = 0.000e+0
Identity = 1737/3787 (45.87%), Postives = 2438/3787 (64.38%), Query Frame = 3
Query: 1293 FFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKL------WKSA----VTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAAT--------------------------IKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIEN-SVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLK---CARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSG-FEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRR-LVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQ-NDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSG--KLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQ--EAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKA--SKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTL-PKEISGESKSSQTIIEDLASDILS-KLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            F+NC +TL SN LR ++   I EFV      R                  +   I ++ L  D      +   P+   +   + +I++ I  +  +   +++ L     G  S  F+ + +  + F+ + +  ++  V  N E P K+ Q Y ++ +L+N T +     F+  +    +Y  ++E   +L+ E +SLP  +   +  LDCE + Q L +++K                    IC+++++I +++    + T ++ ++++Y++  +   +  L  ++++A   +++LL   +  ++DI LN+T + W   I+   + S   L   R++   +L   +++    L  L+  IK F   ++L    E   ++    ++L E  E    IN+EE      + T Y +++ +    EP+ K+      W+      +TFH L  +WM+G  L+++ E +E +    ++  Y++ K F   + K     A T                          +  +++KFK  +P++  LCNPGL+ RHW+ MS   GFD+TP   T L  +L + L+  LE+   +S  ASKEFSLEKA   M   W  + F   P+K+TGV+I   +DDIQ++L+D IVKT TM  SPF+ PF+SE+  W++ L  ++++++ WLK+QA WLYLEPIF S DI +QIP EG  F+ VD  WR IM     DSKV+       LLE LQ S ALLE+I KGLN YLEKKRL+FP                                               M S+E E V+   +I   EA G VEKW+LQ+E  M  S+R+++ ++   Y + +R QWV++WPGQVVL  S + WT +   A+    L+++ ++   Q++ IVELVR E L    R TL A + +DVHARDVV  L+  +VS E DF W++Q+RYYW         NDN+ + ++  +V Y YEYLGN+ RLVITPLTDRCYRTL+GA  LNLGGAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY +MGKFFKGLA SGAWACFDEFNRIELEVLSV+AQQ+  IQRAI  +LE F FEGT L+L+ +C + ITMNPGYAGRSELPDNLKVLFRTVAMMVP+YALIAEISLYS GF+ A+ L+AKIV  YRLCSEQLSSQ HYDYGMRAVK+VL AAG LK K     E+ ++L+SI DVN PKFL  DIPLF+GI SDLFPGV  P+ DY+       E  +   ++P   F DK+IQ YEM++VRH  M+VG+SF GKT     L+  L  +N+  + E   VIF  +NPK+I++G L+G+FD VSHEW+DG++A TFRE A +E+ +RKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQM+N+ ++IFE  DL QASPATVSRCGMIYMEP QLG  PL+  WI          + R+ +  LF+WLIPPSL  + R C+  V   +   V  + +L+  +LD+    G                                  E    +++A F  SL+WS G   D DS+ KF+DF R   +     N+++P P+ ++   C  N    +KG ++D+ +  K+ G W  W   IE  +L E+   T+   I++PT+DTVR  + +   +  G  P++FVG TGTGKS  +K  +L++L    +L   + FSA TS++Q Q+   SK+D+RR+G++ PP  K  V+F+DD++MP +E++GAQPPVE+LRQ +DH   +D KD + + + DV   +AM  P   R AVTSR LRH NII+I+ F D+TM  IF  I+ +      F      +   IV A  ++++  MA+ LPTPAKSHY FNLRDFSRVIQGCLLLK   L      +    LIRL+VHE YRV+HDRL+  ED    ++L+  +V+  F   F  +FG     +K     +M+ L+FGD++    +P+          EG+ +LY E+   E   + ++  L+EYN M K  M+LV+F + +EH++RI R+L+QP G++LLVG+GGSGRQS  +LAT +    +FQ E+++ Y +++WRDD+++ L+RN G KG +T FL  D QIK+  FLEDI+ +LN+G++PNLF  +++ EIIE ++ I Q     +E++ + ++  F+ R ++NLH+V+ FSPIG AF  RLR FPSLINCCTI+WFQ WPE+AL+ VAN  L+ +E+ ++ R++++ +C+ FH S + LS  F   +GR NY+TPTSYLELI TF  L+++K+  I+ +K+RY  GL++L F+E++++ M+ EL   QP+L +   +  K++++IE E++EVE   +VV  +E    +KA +A+++K +CE++LAEA+P + AA+ ALDTLKQ +DISIVKAM+NPP GVKLVM AVC++K +KP++  DP+G  K + DYW  +KKLLGD+ FL  LK YDKD IP   M+ IR +++ NP FDP K+ N SSA EGLC W+ A+EVYD++ KVV+PKK KLA A+       A L  K+ EL EVE +L  LQ+ F+ K +EK  LE  +E    K+ERAEKLI GL GEK  W K   DL   +DN+ GDVL+ AG++AYLGPFT G+RQ C +LW   C+S +IP  S   FSLS  LG+P+ +R W I GLP DSFS+DN VIV ++ R  L+IDPQGQANKW+K LE + N L VIKL+D  Y+R LENC+QFGTP LLENVGEELD  LE +LLKQTFKQ  VE I+LG+ V+EYS DFRFY+TTRL+NPHYLPE + KV+L+NFMITP GLEDQ+LGIV AKE PELE+ R  LI++SA+N+RQLKEIED IL+ L +SKGNILEDE AI+IL S+K++S +I+ KQ  + A KTE +I   R GY+ VA H SILFF+I+DL ++DPMYQYSL WF+NLYI+SI++ + S  ++ RL+ L  HFT  +Y N+CRSLFEKDKLLFSFLLC  +   + +++     FLLTGGI L +   NP P WL +KSW+E+   S L  F+G L+ F+ N + +K I DS+ P     P  W E+L+ L+++++ RCL P+ ++PAV  ++   LG ++V+PPAFDL  SF +S+S  P++FVLSPG DPM+ L +FA  K +  +  + +SLGQGQGPIA   I+ ++++ +W+ LQNCHLA SW+  L KICE+  L  +  + +FRLWLTSYPS  FPV +LQN VKMTNE P GLR NLL+SY T P+SD +FF     K+P V+EKLLF LCFFHA+VQER+ +G +GWNIPY FN+SDL IS+RQLQ F+N+Y+ V  EA+TYLTGECNYGGRVTD+ DRRL+M+ L   Y ++++ +  +PL+ SG Y  P   S    Y+  I+  P +  PEVFGLH N +++K+ Q+T  LF+S+L+T     + G S      + D+A++IL+ +LP  F  E + +KYPVLYEE MNTVL+QE+ R+N L   I  SL +L  A++GL++M + LE V  ++++GKVP  W+++SYPSLKPLGSYI+D +AR+KF Q W +NGQP  FW+SGF+FTQ+FLTGV+QN+AR+ +  ID L FDF ++   +   P ++G +++GL+L+  RW  E   L E H ++L+D +P+I + P  K+ I  ++ Y CP+YKT+ R+G LSTTGHSTN+V  + L + +  QHWI RG+A L QL+D
Sbjct:   88 FYNCASTLISNQLRSVLHKGIEEFVSVFDPSR-----------------QHCLPIFQMALTFD---DEKMEMYPTPRDVEKSVLEILNVITNTFQKVQTVQSWL-----GHASPSFVNAKVTGDYFLWA-QSTVKSAVLKNMEGPGKHFQSYDSYSWLVNGTAQTQVDTFLKEEHSFEEYTKKVETFHNLAKEISSLPPKVYFTMVQLDCEELKQGLTNKAK--------------------ICSEFEAIKQKVLDIPKNTEEIAQMEKYIDFTKKNIVPELNNEVKEANSHIIYLLETHVAKSEDIKLNSTVYLWPHNILLAFEQSEEVLQSSRQKEEKELIARRERLTVQLEKLEHNIKTFPLYSELGLIQEYIADVRTTGKRLQEAEENIVGINKEEAFYKWEI-TCYPEVKAMKEQMEPYQKVFECILKWQHTESINLTFHTLLKRWMDGSFLDLNGETMETQVDEFYREIYKMLKFFQQKQSKAAQEVAKTYGKAEGQPDEKNSSKQECPTVNLCSIVIEQIQKFKDYIPVVSILCNPGLRGRHWEKMSQIAGFDLTPNFGTSLRKLLQLKLEPFLEEFETISVAASKEFSLEKAMQTMTQVWDGVSFHHQPHKDTGVSIFTALDDIQMMLDDQIVKTQTMMGSPFVKPFQSEMKQWEERLLHIQESIDEWLKLQAQWLYLEPIFSSQDIMQQIPEEGRLFQTVDRNWREIMGHCVKDSKVLQATSLPGLLERLQDSNALLEKIMKGLNAYLEKKRLFFP-----------------------------------------------MYSSEGERVELIQNISTSEANGAVEKWLLQLEDGMISSVRDIIDRS-RAYEKTARNQWVKEWPGQVVLCTSQIFWTLEVHKAL---GLKKYYQQLQNQLNEIVELVRGE-LPKQTRTTLGALVTIDVHARDVVKDLIE-KVSDETDFEWLAQLRYYWM--------NDNVRVHIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFHLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQVLCIQRAIMHKLEYFDFEGTMLKLNPNCFVSITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSAKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLLAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGVSLPVADYKLFLEAAEECCKIHNVQPTKVFTDKLIQTYEMMIVRH-FMLVGESFAGKTKVLHVLADTLSLMNERGHGEEEKVIFRTLNPKSITMGQLFGQFDLVSHEWTDGVVANTFREFALAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEANDLSQASPATVSRCGMIYMEPSQLGWKPLVISWINTLPDPLQSPDNRSLILDLFHWLIPPSLQMLRRHCREVVPTTNSHTVVALCRLFKMILDEPVKTGPDD-------------------------------ESIRTWIMAAFASSLVWSVGGCCDTDSREKFNDFIR---QTVSGKNKEHPIPETIERWECPIN----EKGLVYDYFYEFKEKGRWIHWNDTIENINLGEI--NTKGQEIIVPTIDTVRYTYLMDLCISQG--PLLFVGPTGTGKSVYVKDKLLNNLDKDCYLPFFINFSAHTSANQTQNIIMSKMDKRRKGVFGPPLGKRYVLFVDDLNMPAREQFGAQPPVELLRQFLDHGH-YDLKDTSKISLVDVQFIAAMGPPGGGRNAVTSRFLRHLNIISINPFSDDTMVHIFSSIVAFSMKKNLFSPEFVIVGNQIVTAMMEVYKKAMANLLPTPAKSHYTFNLRDFSRVIQGCLLLKKGSL------EGKQTLIRLFVHEVYRVYHDRLVDDEDRTWLYQLMNSIVKDHFNVPFDQVFGQLKQGDKL-EEKDMQNLLFGDYM----NPD---------LEGDERLYTEVPSIETFAEVVKSCLEEYNQMHKNRMNLVIF-YLLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATSMAHMTLFQPEISKNYGMTEWRDDLKQMLLRNAGVKGQKTVFLITDTQIKDEAFLEDIDSVLNTGEVPNLFAVDEKQEIIETIRPIAQAGKKSVELSPLTLFAFFVARCKENLHVVVAFSPIGKAFRKRLRQFPSLINCCTIDWFQPWPEEALERVANSFLESLEMSENERQEVITICKTFHTSANQLSD-FQAELGRYNYITPTSYLELIATFQQLISQKRETIMNAKQRYINGLDQLAFAESEVAKMKKELVDLQPKLEQAKIDNTKMMEVIEVESIEVEAKSRVVHVDEEAAAMKANEAQALKSECENDLAEALPALEAALTALDTLKQPSDISIVKAMKNPPSGVKLVMAAVCVMKNVKPDRIPDPAGTGKKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPVPVMQTIRNEFMTNPDFDPSKVANASSAAEGLCKWITAMEVYDKVAKVVAPKKAKLAEAQESLAATKAVLDQKRAELKEVEDRLTALQKTFEEKTEEKARLEMQVESCARKLERAEKLIGGLSGEKI-WSKAADDLQNTYDNLTGDVLISAGVIAYLGPFTSGFRQNCTKLWTTLCQSKNIP--SSDDFSLSKTLGNPIEIRAWNIAGLPNDSFSIDNGVIVRNSRR-PLMIDPQGQANKWVKNLEKDNN-LNVIKLTDGDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQTFKQG-VESIKLGERVIEYSADFRFYVTTRLKNPHYLPEVATKVSLLNFMITPEGLEDQLLGIVVAKE-PELEEERTALILQSANNKRQLKEIEDSILETLQSSKGNILEDESAIQILDSAKIMSNEITKKQQIQIAEKTELKIAESREGYREVAKHSSILFFSIADLTNIDPMYQYSLIWFVNLYINSIQDIK-SKVLKQRLEYLKDHFTYNLYCNVCRSLFEKDKLLFSFLLCCNLL-ARKEIEHSDLMFLLTGGIGLQNTVANPDPSWLQDKSWDEICRASELPGFQG-LEAFIKNPEDFKLIYDSREPCSIDLPAPWCEKLTDLQKMIIFRCLRPD-MVPAVTKFVTRNLGKKFVQPPAFDLTKSFLDSNSTIPLVFVLSPGADPMA-LLKFASDKKMDGSRFQSISLGQGQGPIAAKMIFTAMQNGSWVCLQNCHLAVSWMSNLEKICEDFSL--TTCHQDFRLWLTSYPSPKFPVGILQNGVKMTNEQPTGLRLNLLQSYLTDPVSDPNFFNGCPDKKP-VWEKLLFGLCFFHALVQERKKFGPLGWNIPYGFNESDLHISMRQLQQFVNEYDKVPFEAITYLTGECNYGGRVTDDWDRRLLMTTLADFYCEDIIKTFRYPLSPSGKYFAP-PKSSYEDYIQFIENLPISQQPEVFGLHENVDISKDLQQTKLLFDSLLLTQGGGAMGGVSSGGDNTLYDIANNILTQQLPPTFDREAVLLKYPVLYEESMNTVLVQEMERYN-LCSTICVSLQNLLKALKGLVVMDSELEAVAGNLIVGKVPEKWAKFSYPSLKPLGSYITDFLARLKFLQVWYENGQPKVFWLSGFFFTQAFLTGVMQNFARKYQIPIDLLTFDFEVLPIDKSETPPEDGVYVNGLFLDGARWDKEGV-LTEQHPRILFDSMPIIWVKPEKKNMIQTDSLYVCPLYKTSERKGTLSTTGHSTNFVIAMMLSTKKRPQHWIKRGVAMLLQLDD 3682          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1099.35 bits (2842), Expect = 0.000e+0
Identity = 711/2172 (32.73%), Postives = 1180/2172 (54.33%), Query Frame = 3
Query: 6081 KKGTIFDHIFMKKQFGCWTTWQSLIEK----PDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFD-RKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHF--NSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEI---KLYNEITDEEALFQTMQFYLDEYNLMSKA-PMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLD--EVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCIL--KGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLD---SPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQL---EALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKE-ISGESKSSQTIIEDLASDILSKLPQ---IFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRC-AIDKLDFDFRIMECHEYSK--------PADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQL 12494
            ++ T+FD+    +  G W  W + +E+    PD+     T +  +IL+P VD VR  F +  I K G K ++ +G  GT K+ ++K+FM    P    L   L FS+ T+    Q +  S +D+R    Y PP  K + + IDDI+MP   ++G Q   EI+RQL++ K +++  K      I DV   +AM  P   R  +  RL R F+I       + ++  IF  I + HF    GF   ++R    +V  T  ++Q      LPTPAK HY+FNLRD SR+ QG L   + V+      +S + L+ LW HE  RV  DR    +D + F + + K+VE    E           ++K+  +  + +  F DFL+   DP E  ++G   +E +    K+Y  I   E+L   +  +L +YN   +   MD+V F+ A+ H+ ++ R++R P G++LLVG+GGSG+QS  +LA+FI  ++IFQI +TR Y+ ++  +D++ L R  G +G   +F++ D++IKE  FLE +N +L+SG++ NLF   +  EI+  +  +++++  +   T  N+Y+ F+ RVR NLH+VL FSP+G+ F +R   FP+LI+ CT++WF  WP+DAL  V++  L   +++    V+ ++V     F   V++    ++    R  +VTP SYL  I+ +  +  +K+ E++ +      GL+KL+ +   ++ +  EL+  + +L   +++ + ++K +  +    E V+  V++ +       +   + K   E  L  A P +  A  AL T+K +DI+ V+ +  PP  +   M+ V +L  + + P  + +     +   W  +  L+    FL  LK + KDTI E  +  ++  Y N P ++  + +  SS   GL  W +A+  +  I K V P K  LAV E+        L+  Q EL   +++L  ++  ++    EK  L  + +  + K++ A  LI+GL GEK RW +   + A +   ++GDVLL    ++Y GPF   +R   +  WQ E K  SIP  +    +   +L D   V EW + GLP D  S+ N +IVT   R+ LLIDPQ Q   WIK  E+ +N+L++  L+ K +   LE  L  G P L+E+VGEELD VL++VL K   K  +   +++GD  V+  + F+ Y+TT+L NP Y PE S + ++++F +T  GLEDQ+LG V   EK E+EK R  L+ +   N+R++KE+ED +L  L++++G++++DE  I +L ++K  +E+++ K + A  T+ +IN  R  Y+PVA  GSIL+F I++++ ++ MYQ SL+ F+ L+  S+  S  SS+   R+K++  + T  VY    R L+E+ K LF+ LL + I      V    +  L+ GG SLD    PQK    +W+ + SW  +  LS L  F   L     + + WKS  D + P  E  P  ++  L    RL++IRC CP++ I     YI   +G +Y E    D+E +++ES+  TP+I  LS G DP   +    +   +     + VS+GQGQ   A   + +++ +  W +LQNCHL  +++ EL     + +++   IN +FRLW+T+     FP+ +LQ S+K TNEPP+GL+A L R+Y      ++D    S   Q ++ +L+ + F H+ VQERR +G +GWNIPYEFN +D   +++ +Q  ++D +  QL     + Y+ GE  YGGRVTD+ D+RL ++    V+  + +    F   +   Y +P  +S ++ YL +I+  P    PEVFGLH NA++  + ++   + ++IL   PK+  SG  ++ +  +  +A D+L KLP     F+++ +    P+   + MN  L QE+ R  ++I ++R +L+DLK A+ G I+M   L +    M   ++P+ W + S+ S   LG + ++L+ R + FQ W+  G+P+ FW++GF+  Q FLT + Q  AR N+  A+D      R++ C+E +K        P  +G +++GLYLE   W   +C L ES  KVL++++PVI +     + +     Y CP+YK   R  +        N + ++ L ++Q  +HW+ RG+A LC +
Sbjct: 2022 REETMFDYYVTAE--GHWVHWSTRVEEYIYPPDV-----TPKYSSILVPNVDNVRTDFLIDTISKQG-KAVLLIGEQGTAKTVIMKSFMSKYDPEIQ-LGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVI------NSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGE-----------EHKKVVDCGVERY-FVDFLR---DPPE--ATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRLYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEVMNT------GLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNP-VEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQ-PYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITE--LLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEA-KNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKP--AEWILDMSWLNLVELSKLWQFSEILDQISHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIET---RYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDEL----MDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGI---NQDLLDVSNTNQ-WKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRL-LNTFSKVWFNKNMFERDFNFYKG--YGIPKCSS-VDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEVKRLQKMGPL---KPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMK-SWAS-STLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALD------RMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAE-NNVVKDPRLYSCPIYKKPTRTDI--------NCIASVGLKTTQPPEHWVLRGVALLCDV 4112          

HSP 2 Score: 589.341 bits (1518), Expect = 4.051e-168
Identity = 357/969 (36.84%), Postives = 549/969 (56.66%), Query Frame = 3
Query: 2751 IKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDT-PLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILC--TVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQI---QKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKA-LTCYNQ-ISRCQWVQDWPGQVVLAASAVHWTEQATNAI-KSHTLEEFLKKNDQQISSIVELVRD---ENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLF-EGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLR-TMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMAL---GDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLP 5606
            +K  +++F    P+++ + +  +  RHW  ++   G ++    +   L +++     K+ E++ ++   A KE  +E+    +  +W    F+F  +K  G  +L   +  ++   LED ++   ++ ++ +  PF+++I  W + L    D +  W+ VQ  W+YLE +F   DI +Q+P E   F  +D+ W  IM +      V+     D  +  L     LLEQ+   QK L  YLEKKRL FPRFFF+S+  LLEIL +  D   +Q HL   F+ I  ++F  E +   +L+  S E +      P+ AEG VE W+  +    + SL  V+++A L   N+      ++  +  QV L    + WT  +  A+  +H     + K +Q   +++  + D   ++L ++ R   E  I + VH RD+   L    + +  DF W+ Q R+Y+      N  +D + I +      Y  E+LG T RLVITPLTDRCY TL  A+ + +GGAP GPAGTGKTET KD+ + + K  VVFNCSD +D++ +G+ FKGLAQSG+W CFDEFNRIEL VLSV AQQI  +    +D+ + F+F +G  + ++    IF+TMNPGYAGR ELP+NLK+ FR+V+MMVPD  +I  + L S GF++   LA K   +Y+LC EQLS Q HYD+G+R + SVL   G  KR     TE  +V + + D+NL K +  D  LF  +I DLFPG+E     Y +L   + ++++ T  +   PW L K+IQ+YE   VRHG+M +G S  GKT   + L  A+   G  ++E+          +NPKAI+   ++GR D  +++W+DGI +  +R+   ++  E  WI+ DGPVDAIWIEN+N+VLDDN+ L L +G+ I M     ++FEP +++ ASPATVSR GM++M    LG  P+++ W++Q  P
Sbjct:  966 LKRTIDEFSECCPLLELMTSKAMMARHWKRITEVTGHNLDVESENFKLRNIMEADPLKYKEEIEDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLMSNRYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPH--LLEQLDSCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQF-HEKIYDRILAVSSREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYF------NEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDRCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKL-KVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQPHREMR---------MNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSP 1915          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1092.8 bits (2825), Expect = 0.000e+0
Identity = 710/2179 (32.58%), Postives = 1176/2179 (53.97%), Query Frame = 3
Query: 6081 KKGTIFDHIFMKKQFGCWTTWQSLIEK----PDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFD-RKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHF--NSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEI---KLYNEITDEEALFQTMQFYLDEYN-LMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLD--EVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCIL--KGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLD---SPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQL---EALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKE-ISGESKSSQTIIEDLASDILSKLPQ---IFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRC-AIDKLDFDFRIMECHEYSK--------PADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILP-------TLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQL 12494
            ++ T+FD+    +  G W  W + +E+    PD+     T +  +IL+P VD VR  F +  I K G K ++ +G  GT K+ ++K+FM    P    L   L FS+ T+    Q +  S +D+R    Y PP  K + + IDDI+MP   ++G Q   EI+RQL++ K +++  K      I DV   +AM  P   R  +  RL R F+I       + ++  IF  I + HF    GF   ++R    +V  T  ++Q      LPTPAK HY+FNLRD SR+ QG +L  +   +N+     +  L+ LW HE  RV  DR    +D + F + + K+VE    E           ++K+  +  + +  F DFL+   DP E  ++G   +E +    K+Y  I   E+L   +  +L +YN  +    MD+V F+ A+ H+ ++ R++R P G++LLVG+GGSG+QS  +LA+FI  ++IFQI +TR+  +      ++ L R  G +G   +F++ D++IKE  FLE +N +L+SG++ NLF   +  EI+  +  +++++  +   T  N+Y+ F+ RVR NLH+VL FSP+G+ F +R   FP+LI+ CT++WF  WP+DAL  V++  L   +++    V+ ++V     F   V++    ++    R  +VTP SYL  I+ +  +  +K+ E+     R + GL+KL+ +   ++ +  EL+  + +L   +++ + ++K +  +    E V+  V++ +       +   + K   E  L  A P +  A  AL T+K +DI+ V+ +  PP  +   M+ V +L  + + P  + +     +   W  +  L+    FL  LK + KDTI E  +  ++  Y N P ++  + +  SS   GL  W +A+  +  I K V P K  LAV E+        L+  Q EL   +++L  ++  ++    EK  L  + +  + K++ A  LI+GL GEK RW +   + A +   ++GDVLL    ++Y GPF   +R   +  WQ E K  SIP  +    +   +L D   V EW + GLP D  S+ N +IVT   R+ LLIDPQ Q   WIK  E+ +N+L++  L+ K +   LE  L  G P L+E+VGEELD VL++VL K   K  +   +++GD  V+  + F+ Y+TT+L NP Y PE S + ++++F +T  GLEDQ+LG V   EK E+EK R  L+ +   N+R++KE+ED +L  L++++G++++DE  I +L ++K  +E+++ K + A  T+ +IN  R  Y+PVA  GSIL+F I++++ ++ MYQ SL+ F+ L+  S+  S  SS+   R+K++  + T  VY    R L+E+ K LF+ LL + I      V    +  L+ GG SLD    PQK    +W+ + SW  +  LS L  F   L     + + WKS  D + P  E  P  ++  L    RL++IRC CP++ I     YI   +G +Y E    D+E +++ES+  TP+I  LS G DP   +    +   +     + VS+GQGQ   A   + +++ +  W +LQNCHL  +++ EL     + +++   IN +FRLW+T+     FP+ +LQ S+K TNEPP+GL+A L R+Y      ++D    S   Q ++ +L+ + F H+ VQERR +G +GWNIPYEFN +D   +++ +Q  ++D +  QL     + Y+ GE  YGGRVTD+ D+RL ++    V+  + +    F   +   Y +P  +S ++ YL +I+  P    PEVFGLH NA++  + ++   + ++IL   PK+  SG  ++ +  +  +A D+L KLP     F+++ +    P+   + MN  L QE+ R  ++I ++R +L+DLK A+ G I+M   L +    M   ++P+ W + S+ S   LG + ++L+ R + FQ W+  G+P+ FW++GF+  Q FLT + Q  AR N+  A+D      R++ C+E +K        P  +G +++GLYLE   W   +C L ES  KVL++++PVI +           K  +     Y CP+YK   R  +        N + ++ L ++Q  +HW+ RG+A LC +
Sbjct:  580 REETMFDYYVTAE--GHWVHWSTRVEEYIYPPDV-----TPKYSSILVPNVDNVRTDFLIDTISKQG-KAVLLIGEQGTAKTVIMKSFMSKYDPEIQ-LGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQG-MLCTNHSSRNII----FQVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGE-----------EHKKVVDCGVERY-FVDFLR---DPPE--ATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSGLLEGLIAYLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEVQMLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNP-VEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQ-PYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITE--LLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEA-KNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKP--AEWILDMSWLNLVELSKLWQFSEILDQVHHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIE---TRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDEL----MDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGI---NQDLLDVSNTNQ-WKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRL-LNTFSKVWFNKNMFERDFNFYKG--YGIPKCSS-VDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEVKRLQKMGPL---KPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKESWAS-STLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALD------RMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNGSSEKKKKIVKDPRLYSCPIYKKPTRTDI--------NCIASVGLKTTQPPEHWVLRGVALLCDV 2686          

HSP 2 Score: 407.142 bits (1045), Expect = 4.804e-113
Identity = 216/473 (45.67%), Postives = 305/473 (64.48%), Query Frame = 3
Query: 4203 TPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLF-EGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLR-TMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMAL---GDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLP 5606
            T L   CY TL  A+ + +GGAP GPAGTGKTET KD+ + + K  VVFNCSD +D++ +G+ FKGLAQSG+W CFDEFNRIEL VLSV AQQI  +    +D+ + F+F +G  + ++    IF+TMNPGYAGR ELP+NLK+ FR+V+MMVPD  +I  + L S GF++   LA K   +Y+LC EQLS Q HYD+G+R + SVL   G  KR     TE  +V + + D+NL K +  D  LF  +I DLFPG+E     Y +L   + ++++ T  +   PW L K+IQ+YE   VRHG+M +G S  GKT   + L  A+   G  ++E+ +         NPKAI+   ++GR D  +++W+DGI +  +R+   ++  E  WI+ DGPVDAIWIEN+N+VLDDN+ L L +G+ I M     ++FEP +++ ASPATVSR GM++M    LG  P+++ W++Q  P
Sbjct:   13 TYLMTWCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKL-KVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQPHREMRM---------NPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSP 475          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 920.998 bits (2379), Expect = 0.000e+0
Identity = 667/2171 (30.72%), Postives = 1106/2171 (50.94%), Query Frame = 3
Query: 6081 KKGTIFDHIFMKKQFGCWTTW-QSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFD-RKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHF--NSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKA-PMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVAN-KSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCIL--KGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGI-AKGQNKVDELVWRFL-LTGGISLD---SPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQK-WKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPA-VISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQL---EALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEIS-GESKSSQTIIEDLASDILSKLPQIF-----QIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRC-AIDKLDFDFRIMECHEYSK--------PADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQL 12494
            ++ T+FD+    + +  W+T  +  I  PD+     T +  +IL+P VD VR  F +  I K G K ++ +G  GT K+ ++K+FM    P    L   L FS+ T+    Q +  S +D+R    Y PP  K + + IDDI+MP   ++G Q   EI+RQL++ K +++  K      I DV   +AM  P   R  +  RL R F+I       + ++  IF  I + HF    GF   ++R    +V  T  ++Q      LPTPAK HY+FNLRD SR+ QG L   + V+      +S + L+ LW HE  RV  DR    +D + F + + K+VE    E           ++K+  +  + +  F DFL+   DP E       S     K+Y  I   E+L   +  +L +YN   +   MD+V F+ A+ H+ ++ R++R P G++LLVG+GGSG+QS  +LA+FI  ++IFQI +T  Y+ ++  +D++ L R  G +G   +F++ D++IKE  FLE +N +L+SG++ NLF   +  EI+  +  +++++  +   T  N+Y+ F+ RVR NLH+VL FSP+G+ F +R   FP+LI+ CT++WF  WP+DAL    +  S  +++    V+ ++V     F   V++    ++   G +  +   S  E +      L  K+ E+  + E+  + L+++        L++VE+Q  + +                                 A  +V +  A   K   E  L  A P +  A  AL T+K +DI+ V+ +  PP  +   M+ V +L  + + P  + +     +   W  +  L+    FL  LK + KDTI E  +  ++  Y N P ++  + +  SS   GL  W +A+  +  I K V P K  LAV E+        L+  Q EL   +++L  ++  ++    EK  L  + +  + K++ A  LI+GL GEK RW +   + A +   ++ DVLL    ++Y GPF   +R   +  WQ E K  SIP             G+ + + E                          LLID     ++W          L++  L+ K +   LE  L  G P L+E+VGEELD VL++VL K   K  +   +++GD  V+  + F+ Y+TT+L NP Y PE S + ++++F +T  GLEDQ+LG                                    +++ T K ++++DE  I +L ++K  +E+++ K + A  T+ +IN  R  Y+P A  GSIL+F I++++ ++ MYQ SL+ F+ L+  S+ +S+ S+  E R+K++  + T  VY    R L+E+ K LF+ LL + I  +G+N   +    FL L  G SLD    PQK    +W+ + SW  +  LS L  F   L   + + +K WKS  D + P  E  P  ++  L    RL++IRC CP++ I      YI   +G +Y E    D+E +++ES+  TP+I  LS G DP   +    +   +     + VS+GQGQ   A   + +++ +  W +LQNCHL  +++ EL     + +++   IN +FRLW+T+     FP+ +LQ S+K TNEPP+GL+A L R+Y      ++D    S   Q ++ +L+ + F H+ VQERR +G +GWNIPYEFN +D   +++ +Q  ++D +  QL     + Y+ GE  YGGRVTD+ D+RL ++    V+  + +    F   +   Y +P  +S ++ YL +I+  P    PEVFGLH NA++  + ++   + ++IL   PK+ S G  ++ +  +  +A D+L KLP  +     Q+ E   K   L  + MN  L QE+ R  ++I ++R +L+DLK A+ G I+M   L +    M   ++P+ W +    +   LG + ++L+ R + FQ W+  G+P+ FW++GF+  Q FLT + Q  AR N+  A+D      R++ C+E +K        P  +G +++GLYLE   W   +C L ES  KVL++++PVI +    ++++     Y CP+YK   R  +        N + ++ L ++Q  +HW+ RG+A LC +
Sbjct: 2185 REETMFDYYVTAEHWVHWSTRVEEYIYPPDV-----TPKYSSILVPNVDNVRTDFLIDTISKQG-KAVLLIGEQGTAKTVIMKSFMSKYDPEIQ-LGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIF-VIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVI------NSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGE-----------EHKKVVDCGVERY-FVDFLR---DPPEATEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLT-LYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVESHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFMNTG-LQKLKEAS--ESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDK---------------------------------AQAIVDSITAD--KAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNP-VEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQ-PYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLV-DVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIP------------FGNNLDITE--------------------------LLIDA-STVSEW---------NLQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLG------------------------------------RVILTEKRSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRP-ATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLASSKSSNTSE-RIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHK---EFLTLIKGASLDLKTCPQKPA--EWILDMSWLNLVELSKLWQFSEILDQQISHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIET---RYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELM----DTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGI----NQDLLDVSNTNQ-WKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRL-LNTFSKVWFNKNMFERDFNFYKG--YGIPKCSS-VDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEIQVRERLQKMGPL--KPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKQESWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALD------RMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYA--ENNVKDPRLYSCPIYKKPTRTDI--------NCIASVGLKTTQPPEHWVLRGVALLCDV 4158          

HSP 2 Score: 503.056 bits (1294), Expect = 7.616e-142
Identity = 339/969 (34.98%), Postives = 513/969 (52.94%), Query Frame = 3
Query: 2751 IKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNIL---CTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQI---QKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEE-TVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKA-LTCYNQ-ISRCQWVQDWPGQVVLAASAVHWTEQATNAI-KSHTLEEFLKKNDQQISSIVELVRD---ENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLF-EGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLR-TMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKAL--SMALGDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLP 5606
            +K  +++F    P+++ + +  +  RHW  ++                               ++   A KE  +E+    +  +W    F+F  +K  G  +L    T + I  L +  +V  S M N  +  PF+++I  W + L    D +  W+ VQ  W+YLE +F   DI +Q+P E   F  +D+ W  IM +      V+     D  +  L     LLEQ+   QK L  YLEKKRL FPRFFF+S+  LLEIL +  D   +Q HL   F+ I  ++F E+   I  + S E E ++      P+ AEG VE W+  +    + SL  V+++A L   N+      ++  +  QV L    + WT  +  A+  +H     + K +Q   +++  + D   ++L ++ R   E  I + VH RD+   L    + +  DF W+ Q R+Y+      N  +D + I +      Y  E+LG T RLVITPLTD                           ET KD+ + + K  VVFNCSD +D++ +G+ FK LAQSG+W CFDEFNRIEL VLSV AQQI  +    +D+ + F+F +G  + ++    IF+TMNPGYAGR ELP+NLK+ FR+V+MMVPD  +I  + L S GF++   LA K   +Y+LC EQLS Q HYD+G+R + SVL   G  KR     TE  +V + + D+NL K +  D  LF  +I DLFPG+E     Y +L   + ++++ T  +   PW L K+IQ+YE   VRHG+M +G S  GKT   + L  +M  G  ++E+          +NPKAI+   ++GR D  +++W+DGI +  +R+   ++  E  WI+ DGPVDAIWIEN+N+VLDDN+ L L +G+ I M     ++FEP +++ ASPATVSR GM++M    LG  P+++ W++Q  P
Sbjct: 1193 LKRTIDEFSECCPLLELMTSKAMMARHWKRITE------------------------------DICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLMSN--YNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPH--LLEQLDSCQKSLT-YLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKYDRILAVSSREKETMELDR---PITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYF------NEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTD---------------------------ETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFK-LAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKL-KVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTCGQPHREMR---------MNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKK-EHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSP 2078          
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 883.248 bits (2281), Expect = 0.000e+0
Identity = 629/2163 (29.08%), Postives = 1054/2163 (48.73%), Query Frame = 3
Query: 6075 VPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPL-IIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITD---EEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECV-ELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVR---------EWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEP--FKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYED-----VQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSEC----FPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNW-IDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPAD--EGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLA 12479
            +P   T++D  F + Q   W  W SL+ +   +  +K  +I    +PTVDT R  + L +++K  R P++ VG  GT K+A+I+  + ++  +      ++ FS++T+S  +Q +  + +++R +  Y PP  K L+VF DDI+MP+ + +G Q PV +LR L+D    +DRK       I+D+   +AM      R  V  R L  F++  I     E++  I+  I+  H    F+  ++ + + I   T  +F +++    PTP+K HY F+ R+ SR+  G  L K      LT E    + +R+W +E  R FHDRL    D  L    IKK+VE  F+     +  D               ++FGD+  A++             E E ++Y +I D    +A+FQ                    LF  A+EH+ R+ R+LR   GH+LL+G  GS  Q+  KLA F  D E+F+I + R Y+  ++R+D++ L    G +   T FLF D  I E  FLE IN +L S  +P LF ++++  II+++     Q+       ++  Y  F+ +   NLH+VL  S  GDA  +R RNFP L++   I+W+  W   AL  VA   L+   I +     ++      H S+ D SK+      R NY T  S+L+ I ++  LL +        K  + +  + LE S N++   + ++                                           +K  D K +       LA+      A +E +D  K   IS  K    PP  V++V E + +L+G K            E  W TAKK++ +  FL  L   D D+I  +++  I+  ++ N      ++++IS A  G+  +V +   Y  I K V PKK+++   E  +    A+L+  +++L  ++ + + L+E +++   EK    +  +L + ++  A+KL+ GL  E+  W K + +L  + + ++GD L+ A  ++Y G F   +R   V + W  + K   IP            L  P ++           W   GLP D  SV N ++ T  +R+ L IDPQ QA  WIK  E + N  +V  L+D  +L+ LE  +++G P LL++V E++D ++ +VL +          I LGD  V Y  +F+ ++ T L NP Y P    K  ++N+  T  GLEDQ+L + T   +   +++   L+ E + N+  LK + D +L  L TS GN+L++ + I+ L  +K  + +   K   A     E   +R GY+PVA  G++LFF +SD+A ++ MYQYSL+ +++L+  S++ S    +++ RL+N+ +  T     N+   LF K KLLFS  + + I + +  V +    FL+   +S D  +     +W+ +++W ++  L+ L P  F     D   N   WKS  D + P    FP  + E LS  ++L+++RCL  +++  A+  Y+   +G+  V PP  +    ++ S + +PI+F++S G DP +DL +FAE    S T   ++++GQGQ  +    + +++   +W+ILQNCHL   WL +L K  E++    +  N NFR+W+T+     FP+ +LQ S K+  EPP+ ++ N+  +Y+   IS +    +S +   F  L++ L FFHAVVQER  YG  GW++P  FNDSD   S+  L  ++    +     +  E+L YL GE  YGGR  D+ DRR I+ +    Y  + L S      F   +   Y +P            I++ P    PEV GL +  E+    Q   +++  + V  P+   G        I  +A DI  +LP++F I  +  +         + VL+QEL RFNKL+  +++S+V+L  A+ G + M    +++  +     VP++W + +  +LK L  ++S L  R + + NW +  G+P   W+SG +  +S+L  V+Q   R+    +D+  F   +          D  +  ++ GL+LE   W +E+  L  S  KVL   LP++ ++P  K+ +   N+   PVY T+ RR            VF   L ++    HW+  G+ 
Sbjct: 2186 IPYLPTLYDFHFDETQEK-WVPWSSLVPEYIHNPAMKFADI----LPTVDTTRTHWILEQMVKIKR-PVLLVGECGTSKTAIIQNLLKNTSTDSSISL-TINFSSKTTSLDLQRNLEANIEKRTKDTYGPPIGKKLLVFFDDINMPKVDDFGTQQPVALLRLLLDQGGLYDRKQKLSFKTIKDLGYIAAMRKTGGGRNEVDPRFLSLFSVFNIPPPATESLHLIYASIIKGH-TRPFKAAIQEVCQTITECTLKLFTTIITDLPPTPSKFHYTFSQRELSRIYCGLTLTKPD-FSCLTVE----QFVRVWRNECLRNFHDRLTDETDKALVHGHIKKLVEEYFETDSEAVLAD--------------PILFGDYRAARE-------------ECEQRVYEDIGDYDVSKAIFQ--------------------LFEDAVEHLTRVHRILRSDRGHALLIGADGSWTQALTKLAAFTADCEVFEIILRRGYNELNFRNDLKTLYLKLGIENRRTVFLFTDAHIVEEGFLEQINNMLISM-VPTLFADDEKESIIKQINSEALQEGAGSSKESVWQY--FLRKSANNLHIVLCLSATGDALKTRCRNFP-LMSNTVIDWYLPWSAQALHAVAQCVLENPTIPKAHFGAVIDHICMVHASLCDFSKQLLLKHQRCNYATSKSFLDFISSYSTLLEE--------KNEHVLQCKCLEGSLNRLREAREQIDELN---------------------------------------LKLADQKVV-------LAKKTATCTAFLEEID--KNQTISFAK----PPKQVQVVCECILVLRGKK------------ELNWLTAKKMMSEAGFLHSLMQMDCDSISNSHISTIK--FLKNLQTSVEEMQSISKAGSGILKFVESFMSYWDIAKEVQPKKDQVKRLEKEFLQSKAELECIKNDLNNMQKEASSLKEKYEDANLEKELQLDEAKLMERRLTAADKLVLGLTSER-EWTKDLEELKQQHECLLGDCLIAAAFLSYAGAFNWDFRNNMVYDKWTQDVKQKGIP------------LSQPFKIENFLTNQLEISWGSEGLPPDEQSVQNGILTTKGSRFPLCIDPQQQALNWIKNKEKDNNLKQVSSLNDPDFLKQLELSIKYGYPFLLQDVNEDIDPIIINVLERNVVVSEGRTVIVLGDKEVNYDPNFKLFLHTTLANPQYSPSVFEKALVINYS-TLRGLEDQLLSVTTGFLEKVFQQQHLLLVEEISENKTLLKSLGDSLLMELGTSTGNMLDNTELIQTLEKTKTEASETIKKLSVAQSKTVEFANLREGYRPVAKRGAVLFFALSDMALVNRMYQYSLTSYLSLFELSLQESLAHPNLQQRLENIINTLTY----NVHNYLFGKHKLLFSMNMTVKIEQTEGGVPQKELDFLIK-NLSGDGTKVQKPHEWIPDQAWQDITKLAELFPEQFSSLPSDIEQNSTNWKSWWDLRAPEQAPFPLQYSESLSAFQKLLLLRCLRADRLHRAMADYVTVTMGN-CVHPPLINFTTIYERSTAFSPIVFIMSSGSDPTTDLIKFAE---KSGTKFTLIAVGQGQEQVVLKLLEKAVSIGSWLILQNCHLLVKWLKDLEKALEKI----TNPNINFRMWITTNAIDDFPIGILQKSQKVVAEPPEDIKLNMKATYSK--ISQQTL--SSCQHPAFCSLVYVLAFFHAVVQERSKYGKTGWSVPCNFNDSDFSASLEVLSTYLTKCHEQGDSFIPWESLQYLIGEVVYGGRAIDSFDRR-ILKVYMDEYFGDFLFSPFQHFHFFRNKDVGYKIP--PPGRKHVYTEIEKMPLITTPEVAGLPSTVEIGYYTQAVEEMWTHLRVLQPETQVGRGIGGDEHISHIAQDIQKQLPELFDINLVGEELGTDLSPT-SVVLLQELRRFNKLVLCMQQSVVELLRALTGEVGMSKESDDLAHAFCNDLVPAMWKRLAPETLKSLDDWMSHLRRRYEQYSNWQVREGEPKVMWLSGLHVPESYLAAVVQAACRKKGWPLDQSTFHTEVTRYRTEDDIDDRLKQCYLSGLFLEGADWDMENGCLARSKPKVLVVELPILKVIPVQKNSLRLRNTLRTPVYTTSLRRN-----ASGAGLVFEADLFTTMHTSHWVLSGVC 4170          

HSP 2 Score: 848.195 bits (2190), Expect = 0.000e+0
Identity = 600/1831 (32.77%), Postives = 941/1831 (51.39%), Query Frame = 3
Query: 2742 AATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVG--FDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTP---YKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKF----TEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKS------HTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMA--LGDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGA-IXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPL-IIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITD---EEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSK 8168
            A  + + L++F+++L ++  L N  L+  HW+ +  + G  FD+  +  T L  + ++ L K+  D+ E+ + A KE S+E         W+   F+  P     +  V +L  VD+I V L++ ++K   M  S F GPF   I  W+K L    + +  WL+VQ  W+ LE IF   DI  Q+P E  + + + +K+  IM    N+  +         L  L      LE+IQK L ++L+ KR  FPRFF +S++ELL +L    DP  +Q H+ K ++ I  L+     + +TV+  M+S E E ++F   + PLEA   VE WI+ V   MK + R + K+A+  Y       W++ +   +VLAA+ V WT +  NAIK+      + L+++ ++  +QI  +V  +     +S  R+ +   +V DVHARD+V   +   +    DF W SQ+R+YW  E      +D+L +R   T + YGYEY+G   RL ITPLT R Y TL  A+ + LGGA  GPAG GKTET KDLAKA+   CVV +C++ +D  ++GK   GLA+ G W CFDEFNRI   VLSV++ QIQ I+ A+    +MF FEG ++ LD    I+ITMNP Y  R ELP+++KV FR V ++ PD   I EI L+S GF++A+ LA K+  +Y+    QLS Q HYD+G+ + KSVL  AG++KR    L+E+ V+++++ D+NLPK +  D+P+F G+ISD+FPG++   + +      + E L+      +P  +DK++QIYE++L +   MIVGQ+  GK+     L  A  LG   K            +NPKA S+  LYG FD  + +W+DGI +K FRE   S   + ++I+FDG VD+ W+ENMN+VLDDNK L L +G+ I++ +   ++FE  DL+ ASPATVSRC +++++P  L   P  + W++  L              LF   +P  +D +    ++ V    + +V+ +  +   LL+                                       K      L  +F  +L  S GA +++              C  T    +    P  +        P   T++D  F + Q   W  W SL+ +   +  +K  +I    +PTVDT R  + L +++K  R P++ VG  GT K+A+I+  + ++  +      ++ FS++T+S  +Q +  + +++R +  Y PP  K L+VF DDI+MP+ + +G Q PV +LR L+D    +DRK       I+D+   +AM      R  V  R L  F++  I     E++  I+  I+  H    F+  ++ + + I   T  +F +++    PTP+K HY F+ R+ SR+  G  L K      LT E    + +R+W +E  R FHDRL    D  L    IKK+VE  F+     +  D               ++FGD+  A+             +E E ++Y +I D    +A+FQ                    LF  A+EH+ R+ R+LR   GH+LL+G  GS  Q+  KLA F  D E+F+I + R Y+  ++R+D++ L    G +   T FLF D  I E  FLE IN +L S  +P LF ++++  II+++     Q+       ++  Y  F+ +   NLH+VL  S  GDA  +R RNFP L++   I+W+  W   AL  VA   L+   I +     ++      H S+ D SK+      R NY T  S+L+ I ++  LL +K   ++  K
Sbjct: 1150 AFFLDSHLKEFRVSLSLLLDLKNTALRD-HWNKLMERTGKSFDMNLQRFT-LETLFSLELHKYANDIDEIVTSALKELSIEMT-------WKRTKFNMQPQLKVNQERVFLLGAVDNILVNLDNDVMKLQCMAGSRFGGPFLDAIQQWEKNLTLFSETIEIWLQVQHKWMNLENIFCGEDICSQLPEEAKKLKKITKKFTEIMKSTENEPNIKKCCTVPGRLSSLWVLRNDLERIQKNLANHLDSKRNEFPRFFLISDDELLNVLGSV-DPACIQEHVIKMYDNIESLRLGVDSSGQTVVGAMVSNEGEVMEFRKPV-PLEAR--VEDWIMAVLQEMKRTSRLITKEAVYHY-----VDWIRSYQCMMVLAANRVWWTWEVENAIKNVNKGDKYALKKYAEQIHRQIDELVTCLGRPTKES-DRLKISNVLVTDVHARDIVDNFVGRSIKEVHDFEWESQLRFYWVKE------HDSLFVRQCNTSLSYGYEYMGLNGRLAITPLTSRIYLTLTQALSMYLGGALAGPAGAGKTETVKDLAKALGLFCVVTHCTEDMDTITLGKIISGLAKCGFWGCFDEFNRIGASVLSVVSSQIQAIRNALTSHFKMFQFEGQQISLDDHMGIYITMNPSYERRPELPESVKVFFRPVVVVTPDVQQICEIMLFSQGFLQAKELAKKMTVLYKTAGIQLSKQPHYDFGLHSQKSVLKMAGKMKRDSLELSEDVVLMRALRDINLPKLVSEDVPVFLGLISDIFPGLDSSRVGFPSFRETVEEILQKSNYTILPDQVDKVVQIYEIMLTQQATMIVGQTCGGKSVVINTLCQAQTLGLCTK---------LYPLNPKATSVDELYGSFDPETRDWTDGIFSKLFREINQSTDKKERYILFDGDVDSQWLENMNSVLDDNKLLTLANGDRIRLQSHCALLFEVGDLQHASPATVSRCAVVFIDPKHLSYTPYWQRWMKNRLNR------------LFEKYVPSCID-VTLNSETIVPRTDVNMVSQLCLMLDVLLES--------------------------------------KNSSAEVLECYFLEALYCSLGATLVESGRLKFDKLVKSLSCLSTVDDEKAAAGPGEI--------PYLPTLYDFHFDETQEK-WVPWSSLVPEYIHNPAMKFADI----LPTVDTTRTHWILEQMVKIKR-PVLLVGECGTSKTAIIQNLLKNTSTDSSISL-TINFSSKTTSLDLQRNLEANIEKRTKDTYGPPIGKKLLVFFDDINMPKVDDFGTQQPVALLRLLLDQGGLYDRKQKLSFKTIKDLGYIAAMRKTGGGRNEVDPRFLSLFSVFNIPPPATESLHLIYASIIKGH-TRPFKAAIQEVCQTITECTLKLFTTIITDLPPTPSKFHYTFSQRELSRIYCGLTLTKP-DFSCLTVE----QFVRVWRNECLRNFHDRLTDETDKALVHGHIKKLVEEYFETDSEAVLAD--------------PILFGDYRAAR-------------EECEQRVYEDIGDYDVSKAIFQ--------------------LFEDAVEHLTRVHRILRSDRGHALLIGADGSWTQALTKLAAFTADCEVFEIILRRGYNELNFRNDLKTLYLKLGIENRRTVFLFTDAHIVEEGFLEQINNMLISM-VPTLFADDEKESIIKQINSEALQEGAGSSKESVWQY--FLRKSANNLHIVLCLSATGDALKTRCRNFP-LMSNTVIDWYLPWSAQALHAVAQCVLENPTIPKAHFGAVIDHICMVHASLCDFSKQLLLKHQRCNYATSKSFLDFISSYSTLLEEKNEHVLQCK 2823          
BLAST of dynein heavy chain 3, axonemal vs. Planmine SMEST
Match: SMESG000013737.1 (SMESG000013737.1)

HSP 1 Score: 6590.37 bits (17097), Expect = 0.000e+0
Identity = 3379/3386 (99.79%), Postives = 3384/3386 (99.94%), Query Frame = 3
Query: 1650 MLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFN 11807
            MLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRR+TKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEIN WDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRFFFLSNEELLEILSETKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLR+VMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVIAQQIQTIQRAIRDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQLKRKLRLLTEERVVLKSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSDDADDEDIEELAGED+EDILNKITNENEILKEERTNFLIAHFFLSLIWSFGAILDKDSKLKFDDFFRDLCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLEIIEKMQQIVQQQNIQIEITAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLIETSKETEKLIKIIETETVEVEKVRKVVKEEEAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEK RWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVSSESTFSLSSVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKK+ESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGEELDSVLESVLLKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFI+DYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFN
Sbjct:    1 MLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRVTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINQWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRFFFLSNEELLEILSETKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLRDVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKSHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVIAQQIQTIQRAIRDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQLKRKLRLLTEERVVLKSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSDDADDEDIEELAGEDEEDILNKITNENEILKEERTNFLIAHFFLSLIWSFGAILDKDSKLKFDDFFRDLCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLEIIEKMQQIVQQQNIQIEITAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLIETSKETEKLIKIIETETVEVEKVRKVVKEEEAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSGKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKSRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVSSESTFSLSSVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKMESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGEELDSVLESVLLKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFIDDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFN 3386          
BLAST of dynein heavy chain 3, axonemal vs. Planmine SMEST
Match: SMESG000012956.1 (SMESG000012956.1)

HSP 1 Score: 3401.3 bits (8818), Expect = 0.000e+0
Identity = 1843/3958 (46.56%), Postives = 2593/3958 (65.51%), Query Frame = 3
Query:  762 NKIKFMASQNLTEKYPDVTNQFLIDTKQNFQTSVKKAILDYILLNKLEQKRLGLMMPNKISVPVLREEM-----PWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENI-CESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTE----------DHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEF---NQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKS--HTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKE-LNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKC-KSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPR---------PKNLKCARNLMVPKKGTIFDHIFMKKQ----FGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSL-TFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHF-NSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFG--DFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDR--LXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSG--KLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERL-SPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            N +K +   +L  ++P++      + K+++  SVKKAI+D++L    E++       +   +P  R+E+     PW    + + ++ QK  Y T+  + ++L  +   +  LRL+ +E    + T + L D    C ++ +   + L   W+ D + I      + + ++P   ++    +ERFFNC +TL ++ L+ +  +S+ ++   ++   D+          + MA  +   +LR+ L   +       F PS +     L  + D ++  +S  +R+E+ L+    G  +  + L+ +   E +  +K  +R+ +   S  P ++ + +  +R L+N+  +          +  H F    K L DY   ++K++  S  +  L       +F L C+ + + L  R++ +    L+ +    R  NR +  +Y+ I R+       T Q++EL ++V       ++ L+ KL+K+   ++FL++Y    T D+ LN + F  ++R+  I D +  N+ +++E     L+  +++F+E L   + Q++EF      N++N  ++  Q LD    KL   I   +  N+EE      V T Y   QE+  +  P+ KL+++AV F+  Y  WM G + +V+ ++V+A+  + ++T ++L K F +     P + A  +K K+E+FK ++P+IQ L  PGL+ RHW  +S+ VG+ +       LS ++ M L+  +     +S  A KEF+LEKA  +M+N+W  + F    Y+ETG  IL +VDDIQ++L+DHIVKT TMR SPFI PFE+EI  W+  L  ++D L+ WLKVQA WLYLEPIF S DI  Q+P EG +F  VD+ W+ IM +V  D +V+ VI+ + +L+ L+ S  LLE I KGLN YLEKKRLYFPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGI+ L FTE   IT M S+E+E V     I   +A G VEKW+L++E  M  S+R  + + L  Y    R +WV+ W GQ VLA S  +WT    +AIK     L+ +LK N+ QI  IV LVR + L    R TL+A IVLDVHARDV+  L+  +V++E+DF W+ Q+RYYW          +N++ +M+ + + YGYEYLGNT RLVITPLTDRCYRTL GA+ L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGLA  GAW+CFDEFNRI+LEVLSV+AQQI TIQRAI  Q +  +FEGTEL+LD +C +FITMNPGYAGRSELPDNLK LFR+VAMMVPDYALIAEISLYS GFV AR LA KIVA YRLCSEQLSSQ HYDYGMRAVKSVLTAAG LK K     E+ ++L+SIIDVNLPKFL  D+PLF+GI SDLFPGV +P+ DY  L + + E    M LE   +F++KI QIYEM++VRHG MIVG+ F GKT A+K L+ ALGD+ ++ L  EN V + I+NPKAI++G LYG+FD VSHEWSDG+LA ++R  A+S + +RKW+IFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQ++   N+IFEP DLE ASPATVSRCGM+YMEP  LG  P+   W++  LP  + D  +     +F   I   +  I +   K       + +V ++L L    +D   +  K S                        ++ +IL      +L   FF +  WS GA  +++ +  FD   R   E+ +    +  R         P  L+  + L  P KGTI+D+ F+ ++    FG W  W  L++  D   + K  + + I++PT DTV+  + +  +L +  KP +FVG TGTGKS  I  F+L+ + NKD    +L  FSAQTS++Q Q+   SKLDRRR+G++ PP  K ++VF+DD++MP +E YGAQPP+E+LRQ +DH  W+D KD T + + D+    AM  P   R  +T R LRH N I I+EF DETM  IF  I++WH     F    K     ++ AT D+++S M + LPTPAKSHY+FNLRDFSRVIQG LL     L N  +E ++ K  RLW HE +RV++DRL++ +D + FF  I++V      E F +LF   DF  D K  T  ++R L++ DF  AK    E               Y E+TD E L +T++ YLDEYN MSK PM+LVLFRFAIEH++RI R+L+QP  H+LLVG+GGSGRQS  +LA  + D+++FQ+E++++Y+ ++WR+D++R++R + +      FLF D+QIK+  FLEDIN LLN+G++PNL+  +++  +    +     + +  Q + + + +YN F++RVR  LH+VL  SPIGDAF +RLR FPSL+NCCTI+WFQ WPEDAL  VA + L++VE+ Q +++  + +C+ FH S   LS+K+   + R NYVTPTSYLELI TF NLL+KK+ E+   K RY VGLEKL+ + + IS+MQ EL+ +QP+L+E SKE +K + I+E ++ E  K  K+VK EEA    +A+ A++IK++C+++LAEA+P++ +A++AL+TL   DI+IV+ M +PP GV+LVMEAVC+LKG+KP++  DPSG  K +ED+W  +K+LLG++KFL+ LK++DKD IP   M+ IR +Y+ N  F P +I   S+ACEGLC WV A+E YD++ KVV+PKK  L  A + Y T M+ L  K+  L EV+ KL  L E  ++ ++ K DLEN ++L   K+ RAE+LI GLGGEK RW +   DL +RF N+ GD+LL +G+VAYLG FT  +R E  + W ++    SIP S + +      LGDPV +R W IYGLP D FS++N +I++++ RW L+IDPQGQANKWIK +E ++N L+VIKL+D  ++R+LENC+QFGTP LLEN+GEELD +LE +LLKQTFKQ     I+LGD ++EYS DFRFYITT+LRNPHYLPE SVKVTL+NFMITP GL+DQ+LGIV ++E+PELE+ + +LI +SA+N+++LKE+ED+IL +LSTS+GNILEDE AI++L+SSK LS +I+ KQ    +TE +I+  R GY P+A H +ILFF+I+DLA++DPMYQYSL+WFINL+  SI+NSE S +++ RL+NL S+FT ++Y N+CRSLFEKDKLLFSF+LC  I K  + + E  WRFLLTGG+ LD+P +NP   WL  KSW+E+  L +L  F G  + F+     WK I DS  PH ++ P +W ERL     ++ V+RCL P+K++ A+ +++   +G +Y+EPP FDL  SF +S+  +P++F+LSPG DPM+ L +FA+ +       + +SLGQGQGPIA   I   +K   W++LQNCHLA SW+  L K  EE  L     +P+FRLWLTSYPSS FPV +LQN VKMTNEPPKGLR N+ RSY + PISD +FF  SK    ++KLLF LCFFHA+VQERR +G IGWNI YEFN++DL+IS++QL MFI+ Y+ VQ +AL YLTGECNYGGRVTD+ DRR ++++L   Y  ++     +   +SG Y  P    D   Y+ +IK  P N  P VFG+H NA++ K+ QET  LF+SIL+T  +  SG  KS+  I++++++D+L++LP  F  E +  KYP  YE+ MNTVL+QE++RFN L+  IR SL +++ A++GL++M + LEEV  SM+  K+P +W + SYPSLKPLGSY++D +AR+KF  +W DNG P  FW+SGFYFTQ+FLTGV QNYAR+    ID L FD+ I++   Y +  ++GA++ GL+L+  RW  +   + ESH KVL D +PVI + P  KS I  + SY  P+YKT+ RRG LSTTGHSTN+V  + LP+ +  +HWI RG+A LCQL+D
Sbjct:  162 NNMKNLLDNDLKAEHPELLEDLEDEIKEDYLLSVKKAIVDFVLKEPREKET------DDTPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQG--NKKKLVPS--VQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSDL----------ANMA-EHPGFVLRLILEDTVIK-----FEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIY-LNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRL------GMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDENKKNMEQKKEEFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDT---KLEAAIGRIEDFNKEEEAFGWDVTT-YPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPI--PKKIATKVKTKVEEFKEHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQ-LSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWV--------ENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLK-VLPPAITDIHKKMWADIFERFIDAGIACIKKGGGKELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQM----------------------DQRDIL-----TWLEGVFFFAYTWSIGATTNEEGRKAFDKLCR---ELMNGGMMEETRIKLALVETVPPPLQDYQGLY-PHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKD--SISKDAKFNEIIVPTTDTVKYTYLMNLLLTHD-KPCLFVGPTGTGKSCYIIDFLLNQM-NKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLL----SLPNTIEEPAHMK--RLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKV-TEDDIRSLIYCDFSDAKSSNKE---------------YIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMRQIDRQRDKIRQTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDKVAKVVAPKKIALEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLIT--TLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNME-KKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGEELDPLLEPLLLKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSANNKKKLKELEDEILNVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSA-WLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEE--LNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAP-PDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 4006          
BLAST of dynein heavy chain 3, axonemal vs. Planmine SMEST
Match: SMESG000012956.1 (SMESG000012956.1)

HSP 1 Score: 3398.22 bits (8810), Expect = 0.000e+0
Identity = 1843/3972 (46.40%), Postives = 2596/3972 (65.36%), Query Frame = 3
Query:  762 NKIKFMASQNLTEKYPDVTNQFLIDTKQNFQTSVKKAILDYILLNKLEQKRLGLMMPNKISVPVLREEM-----PWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENI-CESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEILVSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLT--SSHP------------LIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTE----------DHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEF---NQRNQLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKS--HTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKE-LNIENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKC-KSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLIAHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPR---------PKNLKCARNLMVPKKGTIFDHIFMKKQ----FGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSL-TFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHF-NSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFG--DFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDR--LXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPSG--KLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERL-SPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHINWENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            N +K +   +L  ++P++      + K+++  SVKKAI+D++L    E++       +   +P  R+E+     PW    + + ++ QK  Y T+  + ++L  +   +  LRL+ +E    + T + L D    C ++ +   + L   W+ D + I      + + ++P   ++    +ERFFNC +TL ++ L+ +  +S+ ++   ++    ++    +        +++  SI  +    DL   + HP            + F PS +     L  + D ++  +S  +R+E+ L+    G  +  + L+ +   E +  +K  +R+ +   S  P ++ + +  +R L+N+  +          +  H F    K L DY   ++K++  S  +  L       +F L C+ + + L  R++ +    L+ +    R  NR +  +Y+ I R+       T Q++EL ++V       ++ L+ KL+K+   ++FL++Y    T D+ LN + F  ++R+  I D +  N+ +++E     L+  +++F+E L   + Q++EF      N++N  ++  Q LD    KL   I   +  N+EE      V T Y   QE+  +  P+ KL+++AV F+  Y  WM G + +V+ ++V+A+  + ++T ++L K F +     P + A  +K K+E+FK ++P+IQ L  PGL+ RHW  +S+ VG+ +       LS ++ M L+  +     +S  A KEF+LEKA  +M+N+W  + F    Y+ETG  IL +VDDIQ++L+DHIVKT TMR SPFI PFE+EI  W+  L  ++D L+ WLKVQA WLYLEPIF S DI  Q+P EG +F  VD+ W+ IM +V  D +V+ VI+ + +L+ L+ S  LLE I KGLN YLEKKRLYFPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGI+ L FTE   IT M S+E+E V     I   +A G VEKW+L++E  M  S+R  + + L  Y    R +WV+ W GQ VLA S  +WT    +AIK     L+ +LK N+ QI  IV LVR + L    R TL+A IVLDVHARDV+  L+  +V++E+DF W+ Q+RYYW          +N++ +M+ + + YGYEYLGNT RLVITPLTDRCYRTL GA+ L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGLA  GAW+CFDEFNRI+LEVLSV+AQQI TIQRAI  Q +  +FEGTEL+LD +C +FITMNPGYAGRSELPDNLK LFR+VAMMVPDYALIAEISLYS GFV AR LA KIVA YRLCSEQLSSQ HYDYGMRAVKSVLTAAG LK K     E+ ++L+SIIDVNLPKFL  D+PLF+GI SDLFPGV +P+ DY  L + + E    M LE   +F++KI QIYEM++VRHG MIVG+ F GKT A+K L+ ALGD+ ++ L  EN V + I+NPKAI++G LYG+FD VSHEWSDG+LA ++R  A+S + +RKW+IFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQ++   N+IFEP DLE ASPATVSRCGM+YMEP  LG  P+   W++  LP  + D  +     +F   I   +  I +   K       + +V ++L L    +D   +  K S                        ++ +IL      +L   FF +  WS GA  +++ +  FD   R   E+ +    +  R         P  L+  + L  P KGTI+D+ F+ ++    FG W  W  L++  D   + K  + + I++PT DTV+  + +  +L +  KP +FVG TGTGKS  I  F+L+ + NKD    +L  FSAQTS++Q Q+   SKLDRRR+G++ PP  K ++VF+DD++MP +E YGAQPP+E+LRQ +DH  W+D KD T + + D+    AM  P   R  +T R LRH N I I+EF DETM  IF  I++WH     F    K     ++ AT D+++S M + LPTPAKSHY+FNLRDFSRVIQG LL     L N  +E ++ K  RLW HE +RV++DRL++ +D + FF  I++V      E F +LF   DF  D K  T  ++R L++ DF  AK    E               Y E+TD E L +T++ YLDEYN MSK PM+LVLFRFAIEH++RI R+L+QP  H+LLVG+GGSGRQS  +LA  + D+++FQ+E++++Y+ ++WR+D++R++R + +      FLF D+QIK+  FLEDIN LLN+G++PNL+  +++  +    +     + +  Q + + + +YN F++RVR  LH+VL  SPIGDAF +RLR FPSL+NCCTI+WFQ WPEDAL  VA + L++VE+ Q +++  + +C+ FH S   LS+K+   + R NYVTPTSYLELI TF NLL+KK+ E+   K RY VGLEKL+ + + IS+MQ EL+ +QP+L+E SKE +K + I+E ++ E  K  K+VK EEA    +A+ A++IK++C+++LAEA+P++ +A++AL+TL   DI+IV+ M +PP GV+LVMEAVC+LKG+KP++  DPSG  K +ED+W  +K+LLG++KFL+ LK++DKD IP   M+ IR +Y+ N  F P +I   S+ACEGLC WV A+E YD++ KVV+PKK  L  A + Y T M+ L  K+  L EV+ KL  L E  ++ ++ K DLEN ++L   K+ RAE+LI GLGGEK RW +   DL +RF N+ GD+LL +G+VAYLG FT  +R E  + W ++    SIP S + +      LGDPV +R W IYGLP D FS++N +I++++ RW L+IDPQGQANKWIK +E ++N L+VIKL+D  ++R+LENC+QFGTP LLEN+GEELD +LE +LLKQTFKQ     I+LGD ++EYS DFRFYITT+LRNPHYLPE SVKVTL+NFMITP GL+DQ+LGIV ++E+PELE+ + +LI +SA+N+++LKE+ED+IL +LSTS+GNILEDE AI++L+SSK LS +I+ KQ    +TE +I+  R GY P+A H +ILFF+I+DLA++DPMYQYSL+WFINL+  SI+NSE S +++ RL+NL S+FT ++Y N+CRSLFEKDKLLFSF+LC  I K  + + E  WRFLLTGG+ LD+P +NP   WL  KSW+E+  L +L  F G  + F+     WK I DS  PH ++ P +W ERL     ++ V+RCL P+K++ A+ +++   +G +Y+EPP FDL  SF +S+  +P++F+LSPG DPM+ L +FA+ +       + +SLGQGQGPIA   I   +K   W++LQNCHLA SW+  L K  EE  L     +P+FRLWLTSYPSS FPV +LQN VKMTNEPPKGLR N+ RSY + PISD +FF  SK    ++KLLF LCFFHA+VQERR +G IGWNI YEFN++DL+IS++QL MFI+ Y+ VQ +AL YLTGECNYGGRVTD+ DRR ++++L   Y  ++     +   +SG Y  P    D   Y+ +IK  P N  P VFG+H NA++ K+ QET  LF+SIL+T  +  SG  KS+  I++++++D+L++LP  F  E +  KYP  YE+ MNTVL+QE++RFN L+  IR SL +++ A++GL++M + LEEV  SM+  K+P +W + SYPSLKPLGSY++D +AR+KF  +W DNG P  FW+SGFYFTQ+FLTGV QNYAR+    ID L FD+ I++   Y +  ++GA++ GL+L+  RW  +   + ESH KVL D +PVI + P  KS I  + SY  P+YKT+ RRG LSTTGHSTN+V  + LP+ +  +HWI RG+A LCQL+D
Sbjct:  162 NNMKNLLDNDLKAEHPELLEDLEDEIKEDYLLSVKKAIVDFVLKEPREKET------DDTPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQG--NKKKLVPS--VQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSH-------VMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIY-LNPIILPEIIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRL------GMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDENKKNMEQKKEEFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNEINKYLKKSQVLDT---KLEAAIGRIEDFNKEEEAFGWDVTT-YPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPI--PKKIATKVKTKVEEFKEHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQ-LSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWV--------ENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLK-VLPPAITDIHKKMWADIFERFIDAGIACIKKGGGKELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQM----------------------DQRDIL-----TWLEGVFFFAYTWSIGATTNEEGRKAFDKLCR---ELMNGGMMEETRIKLALVETVPPPLQDYQGLY-PHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKD--SISKDAKFNEIIVPTTDTVKYTYLMNLLLTHD-KPCLFVGPTGTGKSCYIIDFLLNQM-NKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLL----SLPNTIEEPAHMK--RLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKV-TEDDIRSLIYCDFSDAKSSNKE---------------YIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMRQIDRQRDKIRQTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDKVAKVVAPKKIALEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLIT--TLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNME-KKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGEELDPLLEPLLLKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSANNKKKLKELEDEILNVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSA-WLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEE--LNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAP-PDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 4029          
BLAST of dynein heavy chain 3, axonemal vs. Planmine SMEST
Match: SMESG000065732.1 (SMESG000065732.1)

HSP 1 Score: 3315.78 bits (8596), Expect = 0.000e+0
Identity = 1814/3958 (45.83%), Postives = 2532/3958 (63.97%), Query Frame = 3
Query:  819 NQFLIDTKQNFQTSVKKAILDYIL----LNKLEQKRLGLMMPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEIL--VSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKY-SQIY-TNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENE--QELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMR-------------------------------------CAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKS--HTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIE-NSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLD-DEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLI---AHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNI---LIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLS--KVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTE-MRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPS--GKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKAS-KRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHIN-WENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            ++ LI+ KQNF  S+K++++   L    +  LE   L       I +   +E   WH   ++++E L K     +  + KLLS     + E  +  +  +     +    L    +   +K    +   W      I     S+  IE  +  S          F+NC   L SN ++ ++  ++  +V+  +        EG               IL+++LN D   S+ + F P++D + + +  II+ I  S+ +   ++ +    +   P   FI ++L     +   KE+LR       E P +Y   IY   + YL+N   E +  +F+N +    +Y   +EK + ++ +   LP     HL  L+CE +   L+  + +L  I LN +    R  N  I  ++++I +      ET+ +L +L  Y+E+ R   +I L  K+  +   + +LL+      +D+ LN+  FTW  +I PI D +       + +    L + +++ +  L   K ++ EFN+  +++  +  +  Q++  +  KL E  +E   IN EE L     ++ + +++EI    +PF +L++  + + K   KW++G   ++ A+++EAE   +++  +++ K F++   K  M                                      C+ T+  ++ +FK  +P+I  LC PG+K+RHWD MS+    DITP   T L+ +LAMGLD ++E+  ++S+ AS+EF+LE    +M+ +W+ + FS T Y+E+G++IL +VDDIQ LL+D IVKT TMR SPFI PFE+EI  W++ L    + ++ WLKVQA WLYLEPIF S DI +Q+P EG  F+ VD  W+ IM     D  VM    F  +LE L+ S  LLE+I KGLN YLEKKRL+FPRFFFLSN+E+LEILSETKDPLRVQPHLKKCFEGI+KL+F  +  I  M S+E+E++K +  I   EA G VE+W+LQV+  M  S+R+V+  +   Y   +R +WV +W GQVVL  S ++WT +   A++     L  + +K ++QIS IV+LVR + L +  RITL A + +DVHARDVV  +    V SE+DFNW+SQ+RYYW          +N ++R+    V Y YEYLGN+ RLVITPLTDRCYRTL+GA  LNL GAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY +MGKFFKGLA SGAWACFDEFNRIELEVLSV+AQQI  I RAI+  +E F+FEGTELRL+++C + ITMNPGYAGRSELPDNLKVLFR VAMMVPDYA+I EISLYS GF++AR+LA KIV  YRLCSEQLSSQ HYDYGMRAVK+VL+AAG LK K     E  ++L+SI+DVNLPKFL  DIPLF GIISDLFPGV  P  DY    + + E      L+ V +F +KIIQ YEM++VRHG M+VG+ F GKT     L+ A+  LN+E N E   VI+  INPK+I++G L+G+FD VSHEW+DGI A TFRE AS+++ +RKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQM+   ++IFE  DL QASPATVSRCGMIY++P  +G  P+   W+    PE L  D     + +LF W +   L F+ + CK  +  GS+ LV N+L L   ++                               K   E E + E R N  I   + +  ++ WS G +LD DS+ KFD FFR   E+    N+ +P PK +     +M+P+ G ++D+ +  K  G W  W       DL++ +   E  NI   L+PT+DT R +F +   +++ R+ +MFVG TGTGKS   +  +++ LP   ++   + FSAQTS++Q Q    SKLDRRR+G++ PP  K  V+F+DD++MP KE YGAQPP+E+LRQ  DH  W+D KD T ++++D+ +  AM  P   R  VT R LRHFN++++  F D+TM  IF  +M  +   G E T   L+  + +V AT +++++ +++ LPTPAKSHYVFNLRDFSRVI G  L+K        Q +      RLWVHE  RVF+DRLI   D +  ++L+K+ ++  FKE F VLF   +T    P   E +R LMFGD++     P             E ++Y E+ +    +  ++  +DEYN   K  M LV+FR+ +EH++RICR+L  P G++LLVG+GGSGRQS  +LA  + +  +FQ E+++ Y   +WR+D++ L++  G +G  T FL  D QIK+  FLEDI+ LLN+G++PNLF  E++ E+IE ++Q  Q  N   + + + ++  F+ R R+ LH+V+ FSPIG AF +RLR FP+LINCCTI+WFQ WPEDAL+ VA K+L+ V+++ D+R   V + +HFH SV +LS++F++ +GR NYVTPTSYLELI +F  LLN KQ E +  K+RY  GL+KL F+  Q+S MQ++L+  QPQL++  K  E L+  I  E++  E  R  VK EE     KA+ +K++ D+C ++LAEA+P + AA+ ALDTL+  DI+IVK MQNPP GVKLVME +CI++ +KPE+  DP+  GK M DYW  +KKLLGD+ FL +L+ YDKD I    M KIR ++I NP FDP+K+   SSA EGLC W+ A+E YDR+ KVV+PKK KLA AES  +  M +L   Q +L  VE KL  L++  ++ + EK  L+  +EL   K+ERA+KLI GLGGEK RW +   +L   +DN+IGDVLL AG++AYLGPFT  YR +C+  W   CKS  IP S + + +    LG+PV+++ W I+GLP DSFS+DN+VIV +  RW L+IDPQ QANKWIK +E E   L VIKL+D  ++R LEN +QFG P LLENVGEELD  LE +LLKQ FKQ+ V+ +RLG+ ++EYS++FR YITT+LRNPHYLPE +VKV+L+NFMIT  GLEDQ+LGIV AKEKPELE  R +LII SA+NRR LKE ED+IL  LS S+GNILE+E AI+IL SSK +S+ I  KQE A +T+ +I+  R  Y P+A H +ILFF+I+DL ++DPMYQYSLSWF+NLYI+SI +S  S  ++ RL+ L+ HFT ++Y N+CRSLFEKDKLLFSFLLC  I   +  ++   + FLLTGG+ L++   NP   WLS+KSW+E+  L++L+ FKG+ + F  N++ W++  DSK P   K P  W  +L   + L+V+RC+ P+K++PA+ +Y+   LG +++EPP FDL  SF++S    P+IFVLSPG DP   L +FAE K    +    +SLGQGQGPIA   I E+ +   W++LQNCHLA SW+  + KICEE+  + +  N  FRLWLTSYPS  FPV VLQN VKMTNEPP GLR NL +S+    IS+ +FF     +   FEKLLF LCFFHA+VQERR +G +GWNIPY FNDSDL+IS RQLQMF+N+YE V  +A+ YLTGECNYGGRVTD+ DRR +M++L   Y++ +++   +  + SGTY+VP    +   Y+  IK  P    PEVFG+H N ++ +E Q++  L +S+L+TL +  S    SS+  + ++A+DIL K+P  F +E+  + YPV Y E MNTVL+QE+ RFNKL   IR+SL +L  A++GL++M   LE +  S+++GK+P++WS+YSYPSLKPLGSYI+DLI R+ F Q W + G+P TFWVSGFYFTQ+FLTGV+QN+AR+    ID L FDF +++    +   ++GA+I GL+L+  RW+ E   L E   KVLY+ +PVI + P  +  I+  EN Y CPVYKT+ R+GVLSTTGHSTN+V  + LP+ + V HW+ RG A LCQL+D
Sbjct:  125 DEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQE---WHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHHEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKES----------FYNCTTILLSNQIKNLLGRTVEAWVDIFE--------EGNAKFLP---------ILKMYLNFD---SNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDAI----INSNPQPVFIPALLA-NHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLIAELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIP-KSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAERDREKKKKTRTDTDEPLPPPEEDDTPKPPAALEICSKTLN-QIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVDDIQQLLDDQIVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGK-LNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYW--------EEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGNDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLAS-KPEVLKKDNGLEMMDILFEWCVDECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIM-------------------------------KPHLEKEDVAENR-NLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFR---ELIIGKNESFPIPKEIN-RFEVMLPETGLVYDYFYEHKVRGYWHHWN------DLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEH-RQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYM-KGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKK------EQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIP-------------EDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRADLAEAIPALEAALSALDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSTLCKSYKIPCSVKFSLTA--CLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETG-LNVIKLTDNDFMRTLENAIQFGYPVLLENVGEELDPSLEPLLLKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILKKQETAEETQKKIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPASSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENT--NTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVP-PKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTSSGGGSSENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 3963          
BLAST of dynein heavy chain 3, axonemal vs. Planmine SMEST
Match: SMESG000065732.1 (SMESG000065732.1)

HSP 1 Score: 3294.98 bits (8542), Expect = 0.000e+0
Identity = 1818/4005 (45.39%), Postives = 2535/4005 (63.30%), Query Frame = 3
Query:  819 NQFLIDTKQNFQTSVKKAILDYIL----LNKLEQKRLGLMMPNKISVPVLREEMPWHSQCLQSKEYLQKFGYFTHSTLVKLLSNFTKKYWELRLISIENICESTPLSLNDLVEICEQYAQKQSQYLQNSWMKDCEEIL--VSSIDSIESIMPRSPMERIREMERFFNCVATLQSNILRFIVRNSITEFVEFIQQYRDVVCYEGYYDLFSGMAVSNVNSILRIHLNADLTSSHPLIFVPSFDRICDQLCQIIDNIIGSVSQFSRLENVLFIKVEGTPSLPFILSMLNYEEFVISNKEKLRDYVKLNSEAPIKY-SQIY-TNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRLTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENE--QELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMR-------------------------------------CAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINHWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRXXXXXXXXXXXXXXXTKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLREVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKS--HTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVXXXXXXXXXXXXXDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQXXXXXXXXXXXXXXXXSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIE-NSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFL-DDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSXXXXXXXXXXXXXXXXXXXXNKITNENEILKEERTNFLI---AHFFLSLIWSFGAIXXXXXXXXXXXXXXXXCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNI---LIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLS--KVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTE-MRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLXXXXXXXXXXXXXXXXXXXTAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPS--GKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKCRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVXXXXXXXXXXVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKLESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGXXXXXXXXXXXXKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHS---------------------------------------SDIEI--------RLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKAS-KRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFINDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFNKLIEVIRKSLVDLKSAVRGLILMGNTLEEVYRSMVIGKVPSLWSQYSYPSLKPLGSYISDLIARIKFFQNWIDNGQPHTFWVSGFYFTQSFLTGVLQNYARRNRCAIDKLDFDFRIMECHEYSKPADEGAFIHGLYLECGRWSVEDCSLMESHSKVLYDLLPVINILPTLKSHIN-WENSYHCPVYKTAARRGVLSTTGHSTNYVFTIALPSSQLVQHWINRGLAALCQLND 12500
            ++ LI+ KQNF  S+K++++   L    +  LE   L       I +   +E   WH   ++++E L K     +  + KLLS     + E  +  +  +     +    L    +   +K    +   W      I     S+  IE  +  S          F+NC   L SN ++ ++  ++  +V+  +        EG               IL+++LN D   S+ + F P++D + + +  II+ I  S+ +   ++ +    +   P   FI ++L     +   KE+LR       E P +Y   IY   + YL+N   E +  +F+N +    +Y   +EK + ++ +   LP     HL  L+CE +   L+  + +L  I LN +    R  N  I  ++++I +      ET+ +L +L  Y+E+ R   +I L  K+  +   + +LL+      +D+ LN+  FTW  +I PI D +       + +    L + +++ +  L   K ++ EFN+  +++  +  +  Q++  +  KL E  +E   IN EE L     ++ + +++EI    +PF +L++  + + K   KW++G   ++ A+++EAE   +++  +++ K F++   K  M                                      C+ T+  ++ +FK  +P+I  LC PG+K+RHWD MS+    DITP   T L+ +LAMGLD ++E+  ++S+ AS+EF+LE    +M+ +W+ + FS T Y+E+G++IL +VDDIQ LL+D IVKT TMR SPFI PFE+EI  W++ L    + ++ WLKVQA WLYLEPIF S DI +Q+P EG  F+ VD  W+ IM     D  VM    F  +LE L+ S  LLE+I KGLN YLEKKRL+FPRFFFLSN+E+LEILSETKDPLRVQPHLKKCFEGI+KL+F  +  I  M S+E+E++K +  I   EA G VE+W+LQV+  M  S+R+V+  +   Y   +R +WV +W GQVVL  S ++WT +   A++     L  + +K ++QIS IV+LVR + L +  RITL A + +DVHARDVV  +    V SE+DFNW+SQ+RYYW          +N ++R+    V Y YEYLGN+ RLVITPLTDRCYRTL+GA  LNL GAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY +MGKFFKGLA SGAWACFDEFNRIELEVLSV+AQQI  I RAI+  +E F+FEGTELRL+++C + ITMNPGYAGRSELPDNLKVLFR VAMMVPDYA+I EISLYS GF++AR+LA KIV  YRLCSEQLSSQ HYDYGMRAVK+VL+AAG LK K     E  ++L+SI+DVNLPKFL  DIPLF GIISDLFPGV  P  DY    + + E      L+ V +F +KIIQ YEM++VRHG M+VG+ F GKT     L+ A+  LN+E N E   VI+  INPK+I++G L+G+FD VSHEW+DGI A TFRE AS+++ +RKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQM+   ++IFE  DL QASPATVSRCGMIY++P  +G  P+   W+    PE L  D     + +LF W +   L F+ + CK  +  GS+ LV N+L L   ++                               K   E E + E R N  I   + +  ++ WS G +LD DS+ KFD FFR   E+    N+ +P PK +     +M+P+ G ++D+ +  K  G W  W       DL++ +   E  NI   L+PT+DT R +F +   +++ R+ +MFVG TGTGKS   +  +++ LP   ++   + FSAQTS++Q Q    SKLDRRR+G++ PP  K  V+F+DD++MP KE YGAQPP+E+LRQ  DH  W+D KD T ++++D+ +  AM  P   R  VT R LRHFN++++  F D+TM  IF  +M  +   G E T   L+  + +V AT +++++ +++ LPTPAKSHYVFNLRDFSRVI G  L+K        Q +      RLWVHE  RVF+DRLI   D +  ++L+K+ ++  FKE F VLF   +T    P   E +R LMFGD++     P             E ++Y E+ +    +  ++  +DEYN   K  M LV+FR+ +EH++RICR+L  P G++LLVG+GGSGRQS  +LA  + +  +FQ E+++ Y   +WR+D++ L++  G +G  T FL  D QIK+  FLEDI+ LLN+G++PNLF  E++ E+IE ++Q  Q  N   + + + ++  F+ R R+ LH+V+ FSPIG AF +RLR FP+LINCCTI+WFQ WPEDAL+ VA K+L+ V+++ D+R   V + +HFH SV +LS++F++ +GR NYVTPTSYLELI +F  LLN KQ E +  K+RY  GL+KL F+  Q+S MQ++L+  QPQL++  K  E L+  I  E++  E  R  VK EE     KA+ +K++ D+C ++LAEA+P + AA+ ALDTL+  DI+IVK MQNPP GVKLVME +CI++ +KPE+  DP+  GK M DYW  +KKLLGD+ FL +L+ YDKD I    M KIR ++I NP FDP+K+   SSA EGLC W+ A+E YDR+ KVV+PKK KLA AES  +  M +L   Q +L  VE KL  L++  ++ + EK  L+  +EL   K+ERA+KLI GLGGEK RW +   +L   +DN+IGDVLL AG++AYLGPFT  YR +C+  W   CKS  IP      FSL++ LG+PV+++ W I+GLP DSFS+DN+VIV +  RW L+IDPQ QANKWIK +E E   L VIKL+D  ++R LEN +QFG P LLENVGEELD  LE +LLKQ FKQ+ V+ +RLG+ ++EYS++FR YITT+LRNPHYLPE +VKV+L+NFMIT  GLEDQ+LGIV AKEKPELE  R +LII SA+NRR LKE ED+IL  LS S+GNILE+E AI+IL SSK +S+ I  KQE A +T+ +I+  R  Y P+A H +ILFF+I+DL ++DPMYQYSLSWF+NLYI+SI +S  S                                       +D+ I        RL+ L+ HFT ++Y N+CRSLFEKDKLLFSFLLC  I   +  ++   + FLLTGG+ L++   NP   WLS+KSW+E+  L++L+ FKG+ + F  N++ W++  DSK P   K P  W  +L   + L+V+RC+ P+K++PA+ +Y+   LG +++EPP FDL  SF++S    P+IFVLSPG DP   L +FAE K    +    +SLGQGQGPIA   I E+ +   W++LQNCHLA SW+  + KICEE+  + +  N  FRLWLTSYPS  FPV VLQN VKMTNEPP GLR NL +S+    IS+ +FF     +   FEKLLF LCFFHA+VQERR +G +GWNIPY FNDSDL+IS RQLQMF+N+YE V  +A+ YLTGECNYGGRVTD+ DRR +M++L   Y++ +++   +  + SGTY+VP    +   Y+  IK  P    PEVFG+H N ++ +E Q++  L +S+L+TL +  S    SS+  + ++A+DIL K+P  F +E+  + YPV Y E MNTVL+QE+ RFNKL   IR+SL +L  A++GL++M   LE +  S+++GK+P++WS+YSYPSLKPLGSYI+DLI R+ F Q W + G+P TFWVSGFYFTQ+FLTGV+QN+AR+    ID L FDF +++    +   ++GA+I GL+L+  RW+ E   L E   KVLY+ +PVI + P  +  I+  EN Y CPVYKT+ R+GVLSTTGHSTN+V  + LP+ + V HW+ RG A LCQL+D
Sbjct:  125 DEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQE---WHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHHEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKES----------FYNCTTILLSNQIKNLLGRTVEAWVDIFE--------EGNAKFLP---------ILKMYLNFD---SNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDAI----INSNPQPVFIPALLA-NHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLIAELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIP-KSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAERDREKKKKTRTDTDEPLPPPEEDDTPKPPAALEICSKTLN-QIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVDDIQQLLDDQIVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGK-LNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYW--------EEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGNDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLAS-KPEVLKKDNGLEMMDILFEWCVDECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIM-------------------------------KPHLEKEDVAENR-NLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFR---ELIIGKNESFPIPKEIN-RFEVMLPETGLVYDYFYEHKVRGYWHHWN------DLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEH-RQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYM-KGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKK------EQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIP-------------EDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRADLAEAIPALEAALSALDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSTLCKSYKIPC--SVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETG-LNVIKLTDNDFMRTLENAIQFGYPVLLENVGEELDPSLEPLLLKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILKKQETAEETQKKIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKILERRSRYLKDHFQYSIYENVCRSLFARDKLLFSFKLCADLMINKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPASSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENT--NTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVP-PKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTSSGGGSSENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 4010          
The following BLAST results are available for this feature:
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH30.000e+050.25dynein axonemal heavy chain 3 [Source:HGNC Symbol;... [more]
DNAH70.000e+046.87dynein axonemal heavy chain 7 [Source:HGNC Symbol;... [more]
DNAH120.000e+046.49dynein axonemal heavy chain 12 [Source:HGNC Symbol... [more]
DNAH10.000e+040.95dynein axonemal heavy chain 1 [Source:HGNC Symbol;... [more]
DNAH60.000e+039.97dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhc-18.062e-17524.43Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-12.139e-17424.48Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-12.139e-17424.48Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
che-33.097e-14131.95Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
dhc-36.446e-6040.90Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhc36C0.000e+043.75gene:FBgn0013810 transcript:FBtr0304742[more]
Dhc62B0.000e+041.95gene:FBgn0013811 transcript:FBtr0303106[more]
kl-20.000e+033.49gene:FBgn0001313 transcript:FBtr0346722[more]
Dnah30.000e+045.23gene:FBgn0035581 transcript:FBtr0289982[more]
CG94920.000e+033.34gene:FBgn0037726 transcript:FBtr0309029[more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah30.000e+050.78dynein axonemal heavy chain 3 [Source:ZFIN;Acc:ZDB... [more]
dnah70.000e+047.08dynein, axonemal, heavy chain 7 [Source:ZFIN;Acc:Z... [more]
dnah120.000e+046.01dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
dnah120.000e+046.46dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
CR450723.10.000e+046.22dynein, axonemal, heavy chain 12 [Source:NCBI gene... [more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttc21a0.000e+052.28tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
ttc21a0.000e+052.10tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
ttc21a0.000e+056.74tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
ttc21a8.181e-655.70tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
ttc21a0.000e+055.70tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah30.000e+050.69dynein, axonemal, heavy chain 3 [Source:MGI Symbol... [more]
Dnah30.000e+050.20dynein, axonemal, heavy chain 3 [Source:MGI Symbol... [more]
Dnah7c0.000e+047.07dynein, axonemal, heavy chain 7C [Source:MGI Symbo... [more]
Dnah7b0.000e+047.12dynein, axonemal, heavy chain 7B [Source:MGI Symbo... [more]
Dnah7b0.000e+047.12dynein, axonemal, heavy chain 7B [Source:MGI Symbo... [more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BW94|DYH3_MOUSE0.000e+050.20Dynein heavy chain 3, axonemal OS=Mus musculus OX=... [more]
sp|Q8TD57|DYH3_HUMAN0.000e+050.25Dynein heavy chain 3, axonemal OS=Homo sapiens OX=... [more]
sp|Q8WXX0|DYH7_HUMAN0.000e+046.87Dynein heavy chain 7, axonemal OS=Homo sapiens OX=... [more]
sp|Q63170|DYH7_RAT0.000e+046.57Dynein heavy chain 7, axonemal OS=Rattus norvegicu... [more]
sp|E9Q8T7|DYH1_MOUSE0.000e+040.44Dynein heavy chain 1, axonemal OS=Mus musculus OX=... [more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R2MQX71.101e-757.18dynein heavy chain 3, axonemal OS=Lingula unguis O... [more]
V3ZCU10.000e+058.04Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
W4ZLH00.000e+055.99Uncharacterized protein OS=Strongylocentrotus purp... [more]
A0A1I8J3K80.000e+056.32Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0L8FUX50.000e+055.38Uncharacterized protein OS=Octopus bimaculoides OX... [more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah120.000e+046.24dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
dnah20.000e+035.38dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
si:dkeyp-86b9.10.000e+033.78dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
DNAH110.000e+032.41dynein axonemal heavy chain 11 [Source:HGNC Symbol... [more]
ENSAMXT00000016172.20.000e+032.75pep primary_assembly:Astyanax_mexicanus-2.0:4:1379... [more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001140.10.000e+043.69pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 ge... [more]
ENSPMAT00000003955.10.000e+041.62pep scaffold:Pmarinus_7.0:GL495754:4342:49943:-1 g... [more]
DNAH60.000e+039.81dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
ENSPMAT00000009595.10.000e+031.58pep scaffold:Pmarinus_7.0:GL478108:144315:184457:1... [more]
ENSPMAT00000003938.10.000e+049.84pep scaffold:Pmarinus_7.0:GL495754:984:26133:-1 ge... [more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYN12.754e-10227.75Cytoplasmic heavy chain dynein; microtubule motor ... [more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5