dynein heavy chain 3, axonemal

Namedynein heavy chain 3, axonemal
Smed IDSMED30004042
Length (bp)12741
Neoblast Clusters

Zeng et. al., 2018

▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population





Single cell RNA-seq of pluripotent neoblasts and its early progenies

We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)

Explore this single cell expression dataset with our NB Cluster Shiny App


Neoblast Population


t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.

Expression of dynein heavy chain 3, axonemal (SMED30004042) t-SNE clustered cells

Violin plots show distribution of expression levels for dynein heavy chain 3, axonemal (SMED30004042) in cells (dots) of each of the 12 neoblast clusters.


back to top


Sub-lethal Irradiated Surviving X1 and X2 Cell Population


t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of dynein heavy chain 3, axonemal (SMED30004042) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for dynein heavy chain 3, axonemal (SMED30004042) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.


back to top


Embryonic Expression

Davies et. al., 2017

Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods


back to top
Anatomical Expression

PAGE et. al., 2020


has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE

PAGE Curations: 26

Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30004042h1SMcG0021376 SmedASXL_019608SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30004042h1SMcG0021376 SmedASXL_023853SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30004042h1SMcG0021376 SmedASXL_000536SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30004042h1SMcG0021376 SmedASXL_017312SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30004042h1SMcG0021376 SmedASXL_000585SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30004042h1SMcG0021376 SmedASXL_000554SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30004042h1SMcG0021376 SmedASXL_019238SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30004042h1SMcG0021376 Contig12573newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004042h1SMcG0021376 Contig12573uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30004042h1SMcG0021376 dd_Smed_v4_9009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004042h1SMcG0021376 dd_Smed_v4_9009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004042h1SMcG0021376 dd_Smed_v4_9009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004042h1SMcG0021376 dd_Smed_v4_9009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30004042h1SMcG0021376 dd_Smed_v4_9009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30004042h1SMcG0021376 dd_Smed_v4_9009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004042h1SMcG0021376 dd_Smed_v4_9009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30004042h1SMcG0021376 dd_Smed_v4_9009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30004042h1SMcG0021376 dd_Smed_v4_23484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004042h1SMcG0021376 dd_Smed_v4_23484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004042h1SMcG0021376 dd_Smed_v4_23484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30004042h1SMcG0021376 dd_Smed_v4_23484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30004042h1SMcG0021376 dd_Smed_v4_23484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30004042h1SMcG0021376 dd_Smed_v6_9009_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30004042h1SMcG0021376 dd_Smed_v6_23484_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30004042h1SMcG0021376 dd_Smed_v6_9009_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004042h1SMcG0021376 dd_Smed_v4_9009_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Human
Match: DNAH3 (dynein axonemal heavy chain 3 [Source:HGNC Symbol;Acc:HGNC:2949])

HSP 1 Score: 3705.22 bits (9607), Expect = 0.000e+0
Identity = 1986/3952 (50.25%), Postives = 2691/3952 (68.09%), Query Frame = 3
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Human
Match: DNAH7 (dynein axonemal heavy chain 7 [Source:HGNC Symbol;Acc:HGNC:18661])

HSP 1 Score: 3403.61 bits (8824), Expect = 0.000e+0
Identity = 1835/3915 (46.87%), Postives = 2548/3915 (65.08%), Query Frame = 3
            + ++++  SV+K+I+D++L +  E+   K+   +  ++  + +L +  PW    L +  Y++      + T++ +L  +   + +LRL+ I+    C+   L L+    I  ++     + L   W  + + I      + +  +P    +   ++E FFNC A L +  L+ +   S+ +F + I Q  D V            A  +   I+R+ L+ D        F P      D    + D +I +VS   R+E  L+ K E + S P  L  +   E V ++KEK+++ +   S AP ++ ++Y  + +L+ +  E     F+  +        E+ K + L +E    S+ T + + +F + CE + + L+ R+  +    L  M    +  N  +C +++ I  +       T++L+E++ Y++K+   ++I L+ +L  +   + FL+ Y      D+ LNN+ F W  R+  I +     + ++ E+    L+   ++FVE L     Q +EF     L D     ++   +  KL+   ++ +Q N EE      + + Y Q ++I     P+ +L+++AV F   Y  W  GP  +V+ ++VEA+  + W+  Y+L K F    Y   M     +++K+E FK ++P+IQ +CNPGL+ RHW+AMS  VG+ + P  D+ +S  L M L+ +++    +S  ASKE+SLEKA  +M  +W  + F    Y+ETG  IL +VD+IQ+LL+DHI+KT TMR SPFI P+E ++  W+  L  L++ L+ WLKVQA WLYLEPIF S DI  Q+P EG +F  VD+ WR IM  V  D  V+ V+  D +LE L+ S  LLE I KGLN+YLEKKRL+FPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGI+K++FTE   IT M S+E E V+    I   +A G VEKW++++E  M +S+ +V   A   Y +  R  WV+DWPGQ VL  S + WT++   AI      LE++LK  ++QI  IV LVR + L    R+TL A +VLDVHARDV++ L+   +S + DF W+SQ+RYYW          ++L  +M+   + YGYEYLGN+ RLVITPLTDRCYRTL GA+ L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGL   GAWACFDEFNRI+LEVLSV+AQQI TIQR I    ++ +FEGTEL+LD +C +FITMNPGYAGRSELPDNLK LFRTVAMMVPDYA+IAEI LYS GFV AR L+ KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     EE ++L+SIIDVNLPKFL  D+PLF+GI SDLFPGV+ P  DY DL   + +   +M L+   +F +KI+Q+YEM++VRHG MIVG+ F GKT A++ L+ AL D+  K L  EN V   ++NPK++++G LYG+FD+VSHEWSDG+LA +FR  ASS + +RKW+IFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+ + N+IFEP DLE ASPATVSRCGMIYMEP  LG  PL+  W+   LP  +   Q+  +  LF+ ++P S++FI +  K         LV +++ L    +DD  +                          K+   N+    E  + L   F  SLIWS GA    D +LKF+   R   E+ +SP     R          +    A  +  P+KGTI+D+ F+ +  G W  W + L E P +    K    + I++PT+DT+R    L  +L   +KP +FVG TGTGKS  I  F+L+ L  + +    + FSAQT++ Q Q+   SKLD+RR+G++ PP  K +VVF+DD++MP +E YGAQPP+E+LRQ +DH  W+D KD + + + D+ I  AM  P   R  VT R +RHFNII I+EF D++M  IF  I+ WH    ++       L+  IV+ T  +++  M + LPTPAKSHY+FNLRDFSRVIQG      V L      ++   + RLWVHE  RV++DRL+ + D       I++++     E FH LF     DN      + +R LMF DF   K++                  Y EI D + L   ++ +L+EYN +SK PM+LVLFRFAIEHI+RI R+L+QP  H+LLVG+GGSGRQS  +LA  + D+ +FQ+E+++ Y  ++W +D++ ++R   +  ++  FLF D QIKE  FLED++ LLN+G+IPNLF  + +  +    +     + +  Q + + I ++N FI+  R  LH+VL  SPIGDAF +RLR FP+L+NCCTI+WFQ WPEDAL+ VA++ L+E+E+ +++R+  + MC+ FH S  DLSK F+  + R NYVTPTSYLELI TF  LL KK+ E++  K+RY VGLEKL+ + +Q++ MQ+EL+A  PQL   SKE ++++ +IE E+VEV K  K+VK +E     +A  +K+IKD+C+++LA A+P++ +A+ ALDTL   DI++VK+M++PP GVKLVMEA+CILKG+K +K  DP  SGK +ED+W  AK+LLGD++FL  L  YDKD IP AYM  IR  YI NP F P KI+N S+A EGLC WV A++ YD++ K+V+PKK KLA AE   +  M  L+ KQ  L EV+ KLA+LQ+  +  +Q+K DLEN ++L   K+ERAE+LI GLGGEK RW     +L   + N+ GD+L+ +G+VAYLG FT  YRQ   + W   CK   IP S + +      LG+ V +R W I GLP DSFS+DN +I+ +  RW L+IDPQ QANKWIK +E + N L VIKLS+  Y+R LENC+QFGTP LLENVGEELD +LE +LLKQTFKQ     IRLGD  +EY+ DFRFYITT+LRNPHYLPE SVKVTL+NFMITP G++DQ+LGIV A+E+P+LE+ +  LI++ A N+RQLKEIED+IL++LS+S+GNILEDE AI+ILSSSK L+ +IS KQE A +TE +I+  R GY+P+A H SILFF+++DLA+++PMYQYSL+WFINL+I SIENSE S  +  RL+ L  HFT ++Y N+CRSLFEKDKLLFSF L I +   +  +++  WRFLLTGGI LD+P  N +  WL +KSW+E+  L +L  FK   ++F+     WK + DS  PH E FP +WE++ +  +R+++IRCL P+KVIP +  +I+  LG  ++EPP FDL  +F +S+   P+IFVLSPG DPM+ L +FA+ +    + L  +SLGQGQGPIA   + +++K   W++LQNCHLATSW+P L K+CEE  L     +P+FR+WLTSYPS  FPV+VLQN VKMTNE PKGLRAN++RSY   PISD +FF + K+P+ F+KLL+ LCFFHA+VQERR +G +GWNIPYEFN++DL+IS++QL MF+N YE++  EAL Y+TGECNYGGRVTD+ DRR + S+L   ++ EL+ +  +    SG Y VP  + D  SY+ + K  P   APE+FG++ NA++ K+Q ET  LF++IL+T  +     +KSS  ++ ++ASDIL KLP  F IE    +YP  Y + MNTVL+QE+ RFNKL++ IR S V+++ A++GL +M   LEEV  S++  K+P +W   SYPSLKPLGSY++D +AR+KF Q W + G P  FW+SGF+FTQ+FLTG  QNYAR+    ID L FD+ +ME  EY  P ++G FIHGL+L+   W+ +   L ESH K+LYD +PV+ + P  ++ I    SY  P+YKT+ RRGVLSTTGHSTN+V  + LPS Q  +HWI RG+A LCQLN
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Human
Match: DNAH12 (dynein axonemal heavy chain 12 [Source:HGNC Symbol;Acc:HGNC:2943])

HSP 1 Score: 3363.16 bits (8719), Expect = 0.000e+0
Identity = 1806/3885 (46.49%), Postives = 2527/3885 (65.05%), Query Frame = 3
            PWHS  +Q++  +    +  H T+  LL      + +  L+    I    P+    L        +   + + N+W       L +  +++E + P        +++ F++CV+TL SN L+ ++R ++                EG+  LF       +  I +I L  D      + F P+F  + D +  +++ I  +      L+NV  I   + GT S P  L     E  +    + L+  V  N E   K+ + Y   + +LL+ T  ++   F   D    +Y   +EK  SL+ E   LP ++   +  LDCE +   L +++K    I LN + +K R  N  IC+++++I     K  ETT ++++L  YVEK RT  +  L  +++++ R + + L+  + P +D+ LN T   W  +I PI D +   +   + +  N+L   +++ +  +     +++EF +  +L    +   ++ ++ +++ E  E  + IN+EE L    + T Y +L ++    EP+ K +   + + +   +WM+G  L+++ E +EA+ +   +  ++  K F                            P+    +   +T+  +++ FK  +P +  LCNPG++ RHW  +S  VG+D+TP   T L  +L + L  +LE    +S+ ASKEFSLEKA   M   W++I F  + Y++TGV IL +VD+IQ +L+D I+KT TMR SPFI PFE EI  W+  L R+++ ++ WLKVQA WLYLEPIF S DI +Q+P EG QF+ VD  WR IM     D KV+       LLE LQ+   LLE+I KGLN YLEKKRL+FPRFFFLSN+E+LEILSETKDPLRVQPHLKKCFEGI+KL+F     I  M S+E E V+    I    A G VEKW++QVE  M  S+ +V+  A   Y + +R  WV++WPGQVVL  S + WT +    I   T  L+++ K+   Q++ IVELVR + L    R TL A + +DVHARDVV  ++   VS + DF W++Q+RYYW         N+N  +R++   V Y YEYLGN+ RLVITPLTDRCYRTL+GA  LNLGGAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY +MGKFFKGLA SGAWACFDEFNRIELEVLSV+AQQI  IQRAI+ +L +F+FEGTEL+L+ +C + ITMNPGYAGRSELPDNLKVLFRTVAMMVP+YALIAEISLYS GF+ AR L+ KIV  YRLCSEQLSSQ HYDYGMRAVK+VL AAG LK K     E+ ++L+SI DVN PKFL  DIPLF+GI SDLFPG++ P  DY +      E      L+PV +FL+KIIQ YEM++VRHG M+VG+ F  KT     L+  L  +N+     E  VI+  +NPK+I++G L+G+FD VSHEW+DGI+A TFRE A SE+ +RKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQM+ + ++IFE  DL QASPATVSRCGMIY+EP QLG +PL+  W+        + E +  ++ LF WLIPPSL+   +KCK  +   +  +V ++ +L+  LL +V                                EN+   +    +++A F  SLIWS G   D D +  FD F R +    D  N   P P ++   +C  +    +KG ++D+++  K  G W  W  LI+  +L +  K  +I +I++PT+DT+R  F +   +    KP++FVG TGTGKS  +K  +++ L    +    +  SA+TS++QVQ+   ++LD+RR+G++ PP  K  ++FIDD++MP  EKYGAQPP+E+LRQ  D   W+D KD + + + D+ + +AM  P   R  VT R +RHFNI +I+ F DETM  IF  I+ ++  +  F      +   IV+ T +I++  + + LPTP KSHY FNLRDFSRVI+GCLL++   + N       + +IRL+VHE  RVF+DRLI+ +D    F+L K V++  FKE FH +F      N   T  ++R LMFGD++    +P+          EG+ ++Y EI +       +   LDEYN   K  M+LV+FR+ +EH++RICR+L+Q  G++LLVG+GGSGRQS  +LAT +    IFQ E++++Y +++WR+D++ L+RN G KG +T FL  D QIKE  FLEDI+ +LN+G++PN+F  +++ E++E ++ + Q  N   E++ + ++  F+ R + NLH+V+ FSPIGDAF +RLR FPSLINCCTI+WFQ WPEDAL+ VA K L+ +E+ +  +++IV +C+HFH S+ DLS++F   +GR NYVT TSYLELI +F  LL +K+  ++ +K+RY  GL+KL F+E+Q+  MQ+EL   QP+L E   E   ++++IE E+V+VE  R+ VK +E     KAE+A+++K++CES+LAEA+P + AA+ ALDTLK  DI+IVK+M+NPP GVKLVM AVC++K +KPEK +DPSG   K++ DYW  +KKLLGD+ FL  LK YDKD IP   M+KIR +Y+ NP FDP K+   SSA EGLC W+ A+EVYDR+ KVV+PKK +L+ A+      M  L  K+ EL EVE  L  LQ  F  K +EK  LE+ +EL   K+ERA +LI GLGGEK RW +   DL I ++N+ GDVL+ AG++AYLG FT G+RQ C + W   CK   IP S E   S    LGDPV++R W I GLP D+FS+DN VIV +  RW L+IDPQGQANKWIK  E E N+L VIKLSD  Y+R LENC+QFGTP LLENVGEELD  LE +LL+QTFKQ  ++ IRLG+ ++EYS DF+FYITT+LRNPHY+PE + KV+L+NFMITP GLEDQ+LGIV AKE+PELE+ R  LI++SA+N++QLK+IE +IL+ LS+S+GNILEDE AI++L S+K++S +I+ KQ+ A KTE +I   R GY+P+A H S+LFF+I+DLA++DPMYQYSL+WF+NLYI+SI +S  S  +E RL+ LN HFT  +Y NICRSLFEKDKLLFSFLLC  +   + +++     FLLTGG+SL S +KNP P WL +KSW E+   S    F+G  + F  +I +W+ I DSK PH  KFP   ++ L+ L++++++RCL P+K+ PA+ +Y+   LG ++VEPP FDL  S+ +S+   P+IFVLSPG DPM+ L +FA  K++S    + +SLGQGQGPIA   I  +++   W+ LQNCHLA SW+P L KICE+        N +FRLWLTSYPSS FPV +LQN VKMTNEPP GLR NLL+SY T P+SD +FFK  +  ++ +EKLLF +CFFHA+VQER+ +G +GWNIPY FN+SDL+ISIRQLQ+FIN+Y+ +  EA++YLTGECNYGGRVTD+ DRRL++++L   Y+  ++ +  +  + SG Y  P        Y+  IK+ P    PE+FGLH N +++K+ Q+T  LFES+L+T    + +G S S+  I+ ++  DIL+KLP  F IE    KYPV YEE MNTVL+QE+ RFN LI  IR +L DL+ A++G+++M + LE +  S+++GKVP +W++ SYPSLKPLGSYI+D +AR+ F Q+W ++G+P  FW+SGF+FTQ+FLTG +QNYAR+    ID L ++F ++         ++G +IHGLYL+  RW  E   L E + K+L+DL+P+I I PT KS I   ++Y CP+YKT+ R+G LSTTGHSTN+V  + L + Q  +HWI RG+A LCQL+D
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Human
Match: DNAH1 (dynein axonemal heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:2940])

HSP 1 Score: 2751.08 bits (7130), Expect = 0.000e+0
Identity = 1580/3858 (40.95%), Postives = 2319/3858 (60.11%), Query Frame = 3
            E++ Q QSQ       +L++SW+   +  + SS+  +        E+      M ++R   +    V  +  + LRF+V++S+  F +FI      V  C +      DL +       N +  + L  D +  H   +    ++    L  + D  I +     +LE ++   I + G P    +L  +   E ++   E+LR  +    S+A I        +R  L     D +        Q LL  E     L  L ++    +SLP+ + +  F ++ + + Q L  + K L    L+ +         SIC ++ SI R++ ++  +  +L EL+E+++ +    L+ L+ ++ K       + +Y ++  D+ L N ++  +ND+ I    P        L +    E E    K++   Q  F E L GL+  +  F+   +++ A E   E+ ++ ++L +C +     N  E + S  + T Y +L  ++   +P+  LW +A  + +  + WMN P+  +DAE++E      +KT ++  K F   +       A  I+A++E+FK  +P+IQ L NPG++ RHW+ +SN++  ++ P+ +   +  L M L  H+E + +V+  A KE+++E+A  +M+ +W  I+F+  PYK T   IL + D+   LL+DHIV T  M  SP+  PFE  IN W+  L   ++ L  WL  Q +WLYLEPIF S DI +Q+P+E  +++ ++  W+ IM     + +V+NV     +L+ L+    +L+ +QKGL++YLE KR  FPRF+FLS++ELLEILS+TKDP  VQPHL+KCFE I++L F E+  IT M SAE EEV+  + I+P      VE W+ +VE +MK S+ ++++KA+  Y  + R QWV +WPGQV +A    +WT +   A+++  L  +   +  QQ+S +V LVR + L  + R  L A IV++VHA+DVV+KL+   V S +DF WISQ+RYYW        +N++L IR V  E  YGYEYLGN+ RLVITPLTDRCY TL GA+ L  GGAP GPAGTGKTET+KDL KA+A Q VVFNCSD LD+ +MGKFFKGLA +GAWACFDEFNRI++EVLSV+AQQI TIQ+A + ++E F+FEG E+ L  SC +FITMNPGYAGR+ELPDNLK LFR VAMMVPDYA+I EISLYS GF EA  LA KI   ++L SEQLSSQ HYD+GMRAVK+V++AAG LKR+   + EE + L++I DVN+PKFL  D+ LF GI+SDLFP +++   DY  L   + E  R   L+ V  FL K IQ+YE  +VRHGLM+VG +  GK+  ++ L+ A+  L  + +I      +V + ++NPK+I++G LYG FD ++HEW+DGI +   R  A +    +KW +FDGPVDAIWIENMNTVLDDNKKLCL SGEII++T    M+FE +DL  ASPATVSRCGM+Y+EP  LG  P I+ W+++  P     E+    + LF   +  S+ F+    K  +   +  L  ++L+L                                + L KI +E    K  R   LI  +F+ SLIWS GA  D   +  F  + R   E     N++            L+ P++G +FD+                        W  W   ++      ++  T   NI++PT+DTV+    L  +L N +KP++ +G TGTGK+  I   +L +L   D++ H LTFSA+TS++Q QD   SKLD+RR+G++ PP  +  + FIDD++MP  E YGAQPP+E+LRQ +DH  W+DRK       + D+    AM  P   R  VT RL+RHFN ++  E D+ + K IF  I+ +W      E + +            ++ +V AT  ++ ++ +  LPTPAKSHY FNLRD S+V QG L+     +++  Q      L+RLW HE  RVF DRL++ ED   F +L+K+ +E     ++ V F               + +++GDF+    D               +K Y  IT E  + Q ++ Y+++YN ++ A + LVLF  A+ HI RI R LRQ  G++LL+G+GGSGR S  +LA+ + ++E FQIE+++ Y +S+WRDD+++++   G + +  TFLF D QIK   FLEDIN +LNSGDIPNL+  +++             Q   ++ T  N+   +  RVR N+H+VL  SPIG+ F +RLR FPSL+NCCTI+WF  WP +ALK VA   L+E+   E  Q+  + ++ +C + HQSVS    ++   + R NYVTP SYLEL+  F  L+ +K++E+ T+K R   GL+KL  +   ++ MQ +L++  P L E +K+T   ++ I+ +T   E+ R  V+ EE     KA+ A++I DD + +L EA+P ++AA+ +L  L +ND++ V+AMQ PP GVKLV+EAVCI+KG+KP+K   +  G  ++DYW   K LL D   FL+ L  +DKD I +  ++ I+  YI+N  F P  I  +S AC  +C WVRA+  Y  + K V PK++ L  A+         L   +  L EVE  +A +Q  ++    +K +LE   E  + ++ RA KLI GL  EK RW + + +L    +N+ GDVL+ AG VAYLGPFT  YR    + W  + +S ++P    S  +L   LG+PV++R WQI GLP D+ SV+N VI   + RW+  IDPQ QANKWIK +E + N L+V KLSD+ +LR +EN ++FG PCLLENVGEELD  LE VLLKQT+KQ     ++LGD V+ Y +DFR YITT+L NPHY PE S K+TL+NF ++P+GLEDQ+LG V A+E+P+LE+ + QLII +A  R++LK+IEDQIL  LS+S+GN ++D + I++L +SK+ + +I  K   A +TE +I+  R  Y PVA    ILFF +SDLA++DPMYQYSL WF+N+++  I NSE + +++ R+ N+N + T ++Y N+CRSLFEK KL+F+FLLC+ I   + K+++  WR+LL+GG S+    +NP PDWLS+++W ++  LSNL  F  +  DFV ++ +++ I DS  PH E  PG W++ L   ++L+V+RCL  +KV  A+  ++   L   ++EP   +L + FK+S+S TP+IFVLSPG DP +DLY+FAE    S   L  +SLGQGQGP AE+ +  S++   W+  QNCHLA SW+P L ++ E   +   +++ +FRLWLTS PS+ FPV++LQN  KMT EPP+G+RANLL+SY++     EDF  +  +   F+ LL SLC FH    ERR +G +G+NIPYEF D DL+I I QL+MF+++Y+D+  + L Y  GE NYGGRVTD+ DRR IM++L   Y+ ++L  E    + SG Y     T DL+ YL++IK  P N  PE+FGLH NA +   Q ET  L  +I+   PK  S  S+  + I+ED+  +IL K+P+   ++ +  KYPVLYEE MNTVL+QE+IR+N+L++VI ++L DL  A++GL++M + LE +  S+    VP LWS  +YPSLKPL S++ DL+ R+ F Q WI +G P  FW+SGF+F Q+FLTG LQN+AR+   +ID + FDF++M     E ++    G +IHGL+LE  RW  E   L ES  K LY  + VI +LPT       ++ Y CP+YKT  R G LSTTGHSTNYV  + +P+ Q  +HWI RG+A +C L+
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Human
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 2363.57 bits (6124), Expect = 0.000e+0
Identity = 1361/3405 (39.97%), Postives = 2013/3405 (59.12%), Query Frame = 3
            LW S   + KL  +W+      +D E +  +     K   +L K         P      +K K+EK K  LP+I  L NP LK RHW A+   V    +   I   L  +  + +    +++ ++S +AS E +LE    ++++ W+   F   P++++  V IL   DDIQVLL+D  +  +T+ +S ++GP ++ ++ W K L      L  WL  Q  WLYLE IF + DI+RQ+P E   F  VD+ W+ IM KV      +       LLE  Q++ ALL+QIQK L  YLE KR+ FPRF+FLSN+ELLEIL++T++P  VQPHL+KCF+ ISKL+F                 E V T     MLS E E V        L+A G VE+W+ +VE AM  SLR + K A+  Y    R  WV    P QV+L  S + W    T  +++        L+ F K N ++++++  +V+  +L  L R  L A I +DVHARD+V +L+ S+V + + F+W  Q+RYYW  +L      DN V RM  ++  YGYEYLG   RLVITPLTDRCY  LMGA++L+LGGAP GPAGTGKTET+KDLAKA+A QCVVFNCSDGLDYK MG+FF GLAQSGAW CFDEFNRI++EVLSVIAQQ+ TI+ A   +L  F+FEG E++L  +C  FITMNPGYAGR+ELPDNLK LFR  AMMVP+YALIAE+ LYS GF  ++ LA K+  +Y+LCSEQLS Q HYD+GMRAVKSVL  AG LKR+   L E+ V+++++ D NLPKFL  D  LF GIISDLFPGV+ P  DY  L   +++ +    L+P    + K+IQ YE +LVRHG+M+VG +  GKT  ++ L+  LG+L K L IENS    V   ++NPK+I++G LYG  + ++ EW DG++A + R   +  S++ KWII DGPVDA+WIENMNTVLDDNK LCL + E I++T + +M+FE +DL  ASPATVSRCGM++++P +L   P +K W++  + + L +E +  +  LF   +   L FI +KC   +    +  V  +  L  SL+     +GK                            N  +++ + N ++   F    +WS G   +               +  D+P+ + P   +L                 I M         W+ +I     +   +      +L+PT DTVR  + + ++L   +  ++F G TG GKS + K  +     +  ++   L FSAQTSS + Q+   SKL+R+R+ +   P +K +V+F+DD++MP  ++YG+QPP+E+LRQ  D   ++DR       I+DV I SA A P   R  VT R +RHF+++ +    + ++K IFQ I++  F S F   +K+ +  IV A+ +I+  +    LPTPAKSHYVFNLRD S+ +QG L      ++   Q      + RL+ HE  RVFHDRLI++ED   +F +I  + EM  K      FG  + D +   N   + ++FGDF+K   D  +             ++Y+++ D E     +Q YLD+YNL +   + LV F+ AIEH++RI RM+RQ  G++LLVG+GG+G+QS  +LA  IC ++  QIE++R Y+   + +D+R+L +  G +     FLF D QI    FLEDIN +LNSG++PNLFE +D LE +    +   ++    E     ++  FI +VR+ LH+VL  SP+G+AF SR R FPSL+NCCTI+WF  WP +AL  V+     +V+   ++++EK+ +MC + H SVS +++++Y  + R  Y TPTSYLELI  ++++L++K+ +II++++R   GL KL  +   +  M+++L A +P L+  S++ E L++ +  +    ++VR  V+E+EA   VKAE+ ++I DD + +L EA+P ++AA +ALD+L + DIS ++    PPD V  VMEA+ IL   KP+             WP+AK+LLGD  FL  L  YDK+ I    + K++ +YINNP F P K++ +S AC+ +C+WVRA+++Y R++KVV PK++KL  A++     MA L+ KQ  L +VE ++  LQ+ +     EK  L   + LTK ++ RA KL A L  E+ RW + I        N+ G+V + A  VAY G FT  YRQ  +E W  +C+S+ IP+    +     +LGDP  +R+W   GLP D  S +N ++VT   RW L+IDPQ QAN+WI+  ES ++ L++IKL+D  +LR+LEN ++ G P LLE + E LD  LE +LLKQ F       IRLGD  ++Y ++FRFY+TT++ NPHYLPE  +KVT++NF +T +GLEDQ+L  V   EKP LE++R +LI+   +++ QLK IE++IL++L TS+GNIL++E+ I+ L  SK+ S  I  + E A  TE  IN  R  Y+PVA  GS+++F I+ L+ +DPMYQYSL +F  L+  +IE S  + +++ RL  L        Y N+ R LFE+ KL++SF+LC+ + + Q  + +  W F L G  G+  + P K   P WL   +W   F   +LE     F G  ++ +              +N QKW+    SK  H +K             W   LS   +L++I+C   EKV+ A+  +++  LG +++E P  DL   +++    TP++F+LS G DPM    RFA     S   ++ +SLGQGQGPIAE  + +++KS NW+ LQNCHLA SW+  + ++ +      S I   FRL+L+S PS+ FPV VLQNSVK+TNEPPKGLRAN+ R++T  TP     FF+ +   + + +++F +CFFHA++QER+ +G +GWNI YEFNDSD + ++  L+++  + + +  +AL Y+TGE  YGGRVTD+ D+R + ++L   +  E  L E +  +ESG Y  P+  S L  + ++I+  P    PE+FG+H NA L  + +ET+ L  +IL   P+    GE KS+  I+++L + + +++P+  ++    E + +K        + TVL QE+ RFN L+++I  SL  L  A+ G ++M   +E+VY S +  +VP+LWS  +YPSLKPLGS++ DLI R  F   W+  GQP ++W+SGF+F Q FLTG LQN+AR+    ID+L F + ++  +                       E   P D G  +HG++++  RW  ++  + ++    +  +LPV++  P      N++ S   YHCP+YKT AR G LSTTGHSTN+V T+ LPS +   +WI +G A LCQL++
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 610.527 bits (1573), Expect = 8.062e-175
Identity = 518/2120 (24.43%), Postives = 990/2120 (46.70%), Query Frame = 3
            G W  W S +  P ++         ++++PT+DTVR    L   L    KP++  G  G+GK+  + A +      ++    ++ FS+ T+ + +  +F    + RR   G+   P   +  LV+F D+I++P  +KYG Q  +  LRQL++   ++   D++ + +E +    A   P+   R  +TSR LRH  I+ +D     +++ I+       FN         ++ L+  + +A  D++ +   HF     + HYV++ R+ +R ++G  + +++  L++L+ E    +L+RLW HE  R+F DRL++ E+     E   K+V+ T  E++   FG+      R      R L++  +L     P        V++E E++ Y          +   FY +E ++       LVLF   ++H+ RI R+ RQ  GH LL+G  G+G+ + ++   ++    +FQ+++   Y+ +D+ +D+R ++R  G +  +  F+  +  + +T FLE +N LL +G++P LFE  D    +    +   Q+   I  +   +Y  F ++V +NLH+V T +P G     R    P+L N C +NWF  W E+AL  V ++      LD  + +  VR               + +V      H++V   ++   +   R+   TP  +L+ IK F++L ++K+ ++   K   ++GL K+  +E Q+  +Q  L+    +L E  +     +K +  +  + E+ +K  ++ +     + +     K   E++LA+  P +  A  A+  +K++ +  VK+M +PP  VKL +EA+CIL G      TD         W   ++++    F+  +  +D + +    ++++  +YI NP ++  K+   S AC  +  W RA  +Y  +L  V P + +L   E     +  + KV    + E+E  + K +E +     +  +++ ++   + K+ R+ +L++ L  E+ RW    +  + + D+++GD LL +  +AY G +    R E    W N   +  +    +          D  R+ +WQ+  LPVD    +NA+++   NR+ L+IDP GQA ++I K  + +N ++     D+ + + LE+ L+FG   L+++V E  D +L  VL ++  +      I +GD  ++ S  F+ ++ TR     + P+   +VT VNF +T + L  Q L  V   E+P+++K+R  L+        +L+ +E  +L  L+ SKG IL+D   IE L   K  + +++ K    +K   E++ V   Y+ ++   S ++ T+  L  +  +Y YSL + + ++ H ++  E SS  D   RL+ + +   + V++ + R +   DK+L + LL     +           F L  G    ++ +    + +P   D+L+ ++   +     +  F+        N     S + +  P     P  W++   +LSPL      L+V+  L P++++ +    +   F  H   +    D L +   E     P++   + G D    +   A   N     L  +++G  +G   A+S +  + KS  W++L+N HLA SWL +L K      L   + +  FRL+LT+      P ++L+ S  +  EP  GL+ANLLRS ++ P       + +K P    +L   +C+ HA+VQER  Y  +GW+  YEF+D+DL+++   L   ++         + E +    L  L  +C YGG++ +  D+ L+  +L +++  +    +    P  +    L     S  +  +  ++       P   GL  NAE     +    +  ++L    +E++      + +       + +LA   L  LP+    E + M+  V   ++ +     +E+   ++L++ IR+ L ++ +  R      N    +  S+  G+VP+ W +Y+ P    +  +++DL  R+K        DN +  TFW+ G +  ++++T   Q  A+ N  ++++L+    I            G  I G     G   +E C L++S   ++

HSP 2 Score: 545.043 bits (1403), Expect = 6.638e-155
Identity = 356/983 (36.22%), Postives = 551/983 (56.05%), Query Frame = 3
            P++C        +K  L  + K+N+ ++  L +  LK+RHW  M  ++      R++  LSD L +G      + +H   + ++   A  E +LE+    M+  WQ        Y +    ++   DD+   L++H    S M+ SP+   FE     WD+ L+++    + W+ VQ  W+YLE +F GSA+I   +P E  +F  +      +M KV    ++++V+        L+    +L +IQK L +YLE++R  FPRF+F+ +E+LLEI+  +KD  R+Q HLKK F GI+ +   EE   IT   S E E+V     +   +    +  W+  +E  MK +L   +  +LT +++++          +W+  +P QV+   + + W ++    +      E +   +Q +   +EL+ D  LK    + R  +EA I   VH RD   KL+S ++ + +DF W+  MR+Y+  + K        V++M  ++  YG+EYLG   RLV TPLTDRCY T+  A+   LGG+P GPAGTGKTE+ K L   + +  +VFNC +  D+++MG+   GL Q GAW CFDEFNR+E  +LS ++QQIQTIQ A+R   +M +   G  L ++ +  IFITMNPGY+GRS LPDNLK LFR++AM  PD  LIA++ L+S GF  A TLA KIV ++ LC EQLS Q HYD+G+RA+K VL +AG +            L  + E++++++S+ +  +PK +  DI L   ++SD+FPG+           Q L+ +  E L     ++ E    +LDK++Q+Y++  + HGLM+VG S  GKT A+K L   L  L +  N+E   +  +I+ KA+S   LYG  D  + EW+DG+     R   ++   E+D R+WIIFDG VD  W+EN+N+VLDDNK L L +GE + +     +IFE  DL+ A+ ATVSRCGM++
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 609.757 bits (1571), Expect = 2.139e-174
Identity = 519/2120 (24.48%), Postives = 992/2120 (46.79%), Query Frame = 3
            G W  W S +  P ++         ++++PT+DTVR    L   L    KP++  G  G+GK+  + A +      ++    ++ FS+ T+ + +  +F    + RR   G+   P   +  LV+F D+I++P  +KYG Q  +  LRQL++   ++   D++ + +E +    A   P+   R  +TSR LRH  I+ +D     +++ I+       FN         ++ L+  + +A  D++ +   HF     + HYV++ R+ +R ++G  + +++  L++L+ E    +L+RLW HE  R+F DRL++ E+     E   K+V+ T  E++   FG+      R      R L++  +L     P        V++E E++ Y          +   FY +E ++       LVLF   ++H+ RI R+ RQ  GH LL+G  G+G+ + ++   ++    +FQ+++   Y+ +D+ +D+R ++R  G +  +  F+  +  + +T FLE +N LL +G++P LFE  D    +    +   Q+   I  +   +Y  F ++V +NLH+V T +P G     R    P+L N C +NWF  W E+AL  V ++      LD  + +  VR               + +V      H++V   ++   +   R+   TP  +L+ IK F++L ++K+ ++   K   ++GL K+  +E Q+  +Q  L+    +L E  +     +K +  +  + E+ +K  ++ +     + +     K   E++LA+  P +  A  A+  +K++ +  VK+M +PP  VKL +EA+CIL G      TD         W   ++++    F+  +  +D + +    ++++  +YI NP ++  K+   S AC  +  W RA  +Y  +L  V P + +L   E     +  + KV    + E+E  + K +E +     +  +++ ++   + K+ R+ +L++ L  E+ RW    +  + + D+++GD LL +  +AY G +    R E    W N   +  +    +          D  R+ +WQ+  LPVD    +NA+++   NR+ L+IDP GQA ++I K  + +N ++     D+ + + LE+ L+FG   L+++V E  D +L  VL ++  +      I +GD  ++ S  F+ ++ TR     + P+   +VT VNF +T + L  Q L  V   E+P+++K+R  L+        +L+ +E  +L  L+ SKG IL+D   IE L   K  + +++ K    +K   E++ V   Y+ ++   S ++ T+  L  +  +Y YSL + + ++ H ++  E SS  D   RL+ + +   + V++ + R +   DK+L + LL     +           F L  G    ++ +    + +P   D+L+ ++   +     +  F+        N     S + +  P     P  W++   +LSPL      L+V+  L P++++ +    +   F  H   +    D L +   E     P++   + G D    +   A   N     L  +++G  +G   A+S +  + KS  W++L+N HLA SWL +L K      L   + +  FRL+LT+      P ++L+ S  +  EP  GL+ANLLRS ++ P       + +K P    +L   +C+ HA+VQER  Y  +GW+  YEF+D+DL+++   L   ++       +V+ E L + T      +C YGG++ +  D+ L+  +L +++  +    +    P  +    L     S  +  +  ++       P   GL  NAE     +    +  ++L    +E++      + +       + +LA   L  LP+    E + M+  V   ++ +     +E+   ++L++ IR+ L ++ +  R      N    +  S+  G+VP+ W +Y+ P    +  +++DL  R+K        DN +  TFW+ G +  ++++T   Q  A+ N  ++++L+    I            G  I G     G   +E C L++S   ++

HSP 2 Score: 545.428 bits (1404), Expect = 7.422e-155
Identity = 356/983 (36.22%), Postives = 551/983 (56.05%), Query Frame = 3
            P++C        +K  L  + K+N+ ++  L +  LK+RHW  M  ++      R++  LSD L +G      + +H   + ++   A  E +LE+    M+  WQ        Y +    ++   DD+   L++H    S M+ SP+   FE     WD+ L+++    + W+ VQ  W+YLE +F GSA+I   +P E  +F  +      +M KV    ++++V+        L+    +L +IQK L +YLE++R  FPRF+F+ +E+LLEI+  +KD  R+Q HLKK F GI+ +   EE   IT   S E E+V     +   +    +  W+  +E  MK +L   +  +LT +++++          +W+  +P QV+   + + W ++    +      E +   +Q +   +EL+ D  LK    + R  +EA I   VH RD   KL+S ++ + +DF W+  MR+Y+  + K        V++M  ++  YG+EYLG   RLV TPLTDRCY T+  A+   LGG+P GPAGTGKTE+ K L   + +  +VFNC +  D+++MG+   GL Q GAW CFDEFNR+E  +LS ++QQIQTIQ A+R   +M +   G  L ++ +  IFITMNPGY+GRS LPDNLK LFR++AM  PD  LIA++ L+S GF  A TLA KIV ++ LC EQLS Q HYD+G+RA+K VL +AG +            L  + E++++++S+ +  +PK +  DI L   ++SD+FPG+           Q L+ +  E L     ++ E    +LDK++Q+Y++  + HGLM+VG S  GKT A+K L   L  L +  N+E   +  +I+ KA+S   LYG  D  + EW+DG+     R   ++   E+D R+WIIFDG VD  W+EN+N+VLDDNK L L +GE + +     +IFE  DL+ A+ ATVSRCGM++
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 609.757 bits (1571), Expect = 2.139e-174
Identity = 519/2120 (24.48%), Postives = 992/2120 (46.79%), Query Frame = 3
            G W  W S +  P ++         ++++PT+DTVR    L   L    KP++  G  G+GK+  + A +      ++    ++ FS+ T+ + +  +F    + RR   G+   P   +  LV+F D+I++P  +KYG Q  +  LRQL++   ++   D++ + +E +    A   P+   R  +TSR LRH  I+ +D     +++ I+       FN         ++ L+  + +A  D++ +   HF     + HYV++ R+ +R ++G  + +++  L++L+ E    +L+RLW HE  R+F DRL++ E+     E   K+V+ T  E++   FG+      R      R L++  +L     P        V++E E++ Y          +   FY +E ++       LVLF   ++H+ RI R+ RQ  GH LL+G  G+G+ + ++   ++    +FQ+++   Y+ +D+ +D+R ++R  G +  +  F+  +  + +T FLE +N LL +G++P LFE  D    +    +   Q+   I  +   +Y  F ++V +NLH+V T +P G     R    P+L N C +NWF  W E+AL  V ++      LD  + +  VR               + +V      H++V   ++   +   R+   TP  +L+ IK F++L ++K+ ++   K   ++GL K+  +E Q+  +Q  L+    +L E  +     +K +  +  + E+ +K  ++ +     + +     K   E++LA+  P +  A  A+  +K++ +  VK+M +PP  VKL +EA+CIL G      TD         W   ++++    F+  +  +D + +    ++++  +YI NP ++  K+   S AC  +  W RA  +Y  +L  V P + +L   E     +  + KV    + E+E  + K +E +     +  +++ ++   + K+ R+ +L++ L  E+ RW    +  + + D+++GD LL +  +AY G +    R E    W N   +  +    +          D  R+ +WQ+  LPVD    +NA+++   NR+ L+IDP GQA ++I K  + +N ++     D+ + + LE+ L+FG   L+++V E  D +L  VL ++  +      I +GD  ++ S  F+ ++ TR     + P+   +VT VNF +T + L  Q L  V   E+P+++K+R  L+        +L+ +E  +L  L+ SKG IL+D   IE L   K  + +++ K    +K   E++ V   Y+ ++   S ++ T+  L  +  +Y YSL + + ++ H ++  E SS  D   RL+ + +   + V++ + R +   DK+L + LL     +           F L  G    ++ +    + +P   D+L+ ++   +     +  F+        N     S + +  P     P  W++   +LSPL      L+V+  L P++++ +    +   F  H   +    D L +   E     P++   + G D    +   A   N     L  +++G  +G   A+S +  + KS  W++L+N HLA SWL +L K      L   + +  FRL+LT+      P ++L+ S  +  EP  GL+ANLLRS ++ P       + +K P    +L   +C+ HA+VQER  Y  +GW+  YEF+D+DL+++   L   ++       +V+ E L + T      +C YGG++ +  D+ L+  +L +++  +    +    P  +    L     S  +  +  ++       P   GL  NAE     +    +  ++L    +E++      + +       + +LA   L  LP+    E + M+  V   ++ +     +E+   ++L++ IR+ L ++ +  R      N    +  S+  G+VP+ W +Y+ P    +  +++DL  R+K        DN +  TFW+ G +  ++++T   Q  A+ N  ++++L+    I            G  I G     G   +E C L++S   ++

HSP 2 Score: 545.428 bits (1404), Expect = 7.422e-155
Identity = 356/983 (36.22%), Postives = 551/983 (56.05%), Query Frame = 3
            P++C        +K  L  + K+N+ ++  L +  LK+RHW  M  ++      R++  LSD L +G      + +H   + ++   A  E +LE+    M+  WQ        Y +    ++   DD+   L++H    S M+ SP+   FE     WD+ L+++    + W+ VQ  W+YLE +F GSA+I   +P E  +F  +      +M KV    ++++V+        L+    +L +IQK L +YLE++R  FPRF+F+ +E+LLEI+  +KD  R+Q HLKK F GI+ +   EE   IT   S E E+V     +   +    +  W+  +E  MK +L   +  +LT +++++          +W+  +P QV+   + + W ++    +      E +   +Q +   +EL+ D  LK    + R  +EA I   VH RD   KL+S ++ + +DF W+  MR+Y+  + K        V++M  ++  YG+EYLG   RLV TPLTDRCY T+  A+   LGG+P GPAGTGKTE+ K L   + +  +VFNC +  D+++MG+   GL Q GAW CFDEFNR+E  +LS ++QQIQTIQ A+R   +M +   G  L ++ +  IFITMNPGY+GRS LPDNLK LFR++AM  PD  LIA++ L+S GF  A TLA KIV ++ LC EQLS Q HYD+G+RA+K VL +AG +            L  + E++++++S+ +  +PK +  DI L   ++SD+FPG+           Q L+ +  E L     ++ E    +LDK++Q+Y++  + HGLM+VG S  GKT A+K L   L  L +  N+E   +  +I+ KA+S   LYG  D  + EW+DG+     R   ++   E+D R+WIIFDG VD  W+EN+N+VLDDNK L L +GE + +     +IFE  DL+ A+ ATVSRCGM++
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 500.36 bits (1287), Expect = 3.097e-141
Identity = 370/1158 (31.95%), Postives = 611/1158 (52.76%), Query Frame = 3
            ++N   TW DR   +LD     +  + E   + +E   K   +    LKA+ ++F  RN   DA++ ++E  +M + +    E++ Q  Q    LS G +    +  +        D + +      +  D W+   I E+   E++  +Q  W      T +F         + KG       +  +   +E FK     ++      L   HW  M   +G    PR  T      +D+L++  +  ++ + L +++S+A  E ++  A   +     +  F+   YK + G N+         + ++ D Q LL+       ++++SP+   F  +   W+  L  L   L    ++Q  W+YLEPIFG    R  +P E  +F  VD ++R I+N V+ D++++++    +L + L+     L + QK LN +LE+KR  FPRF+F+ +++LLEIL ++ +P  +Q H+KK F+GI++++F  T ET+I+ M+S+E E V    A  I P      VE W+ ++   M+ +L+++  +A+           +  +P QV+  A  V ++    N +  S  L  F  +  +++ +   +  D+ +  L    L++ I+  +H  DVV +LL+++  S + + W  Q+R+Y        L N  +V+R V++E  Y YEY GN ++LV TPLTD+CY TL  A+ + LGG P GPAGTGKTE+ K LA  + +Q +VFNC +G+D  SMG+ F G+ + GAW CFDEFNR++  VLS ++ QIQTIQ AI+ +     F G  ++++ +  IF+T+NP   GY GR ++PDNLK LFR V M  PD  LI+   LYS GFV+A  LA KIV++++L  + LS Q HYD+G+RA+K VL   G L+R      E  +V+++++   L K    D   F+ +I D+F  V K +  +++L   L    + M ++     ++K+ Q+YE +  R G+++VG +  GK+  +K L  +L    K L +         NPKA++   L G  D  + EWSDGI+    RE  + ++    WI+ DG +D  W+E +N+VLDDN+ L + SGE IQ  +  N +FE + L+ ASPATVSR GMIY+    +    ++  W+

HSP 2 Score: 433.721 bits (1114), Expect = 5.083e-121
Identity = 503/2108 (23.86%), Postives = 947/2108 (44.92%), Query Frame = 3
             + T DT R    +   L++G R+  +  G TG GK  ++K    +   ++     SL  SAQ+SS      +Q +     +   R +++P     +++F+  I++P  +KYG    + +L+QL+ ++ +FD   N   + IE++    +M  I   +  ++++RL      ++++  D   +  I++     +     E   +R S++I +   DI+  V ++F PT +   ++F+ RD          L + V+  L  E    KL  +   E  R+F DRL +  D   F E+++ V+ ++       FKEK +V  G      +  T   +  +   DF       N++L+        EI  +N  +T + A F                              A I R+L  P GH  L G  G GR+ + +L   + + ++F   +T  +S   + ++++  +            +  DHQ+++  FL+ IN LL SG++P LF  ++   +   +  + +  N      A+  +     R+R  +H+VL      + F   +   P+++  C + +   +  ++L          VEI      KI +  Q    + + L+  F +V+  +     + P  Y + ++ F  LL  K++ +    ER   G+ KL  + ++++ MQ +       L E   E ++ +K I       E  +  +++ +A      V+ E+ K+  D+    L E  P+++ A  A+ ++K   +S +++++ PP+ V+ +++AV +  G+            ++  W   +K L      D + ++D + I     +K+  L    +  F+    K  S+A   L  WV+A   Y +IL+ ++P + +        +    Q++     L  V+  + +L+  F+   +E T ++ +++  +  I  A  L+  L GE  RW   I         M    L+ +  + YLG  +   R+    L ++ CK  ++P + +     S           W+  GLP D  S++N  I+ ++    L+ID  GQ + ++ K      K E  K +    +  +E  ++FG   +++++  E DS L  +L K    Q   + I  G   ++++ DF+ Y  TR       P   V++ +VNF  T + L  Q+L +    EKPELE+R   L+ ++   + +L+ +E  +LQ L++S+GN+LE+   ++ L+ SK  +E I+     + +   E+   ++ Y P++   S LFF+ S+L   +PMY YS++  ++L+  +I++ E  S    R++ L       V+ +I R +F +D+L+F+            +  E  W  L TG +  +S   + +   W+S         L +L   +  L     N Q      W     SKT   E  FP + E +++  ++++ I+ + PE++   ++ +++  L    + PPAF+L+  F+ES+S  PI+F+L+ G DP  +L  FA   N+       +S+GQGQ   A   I ES     W+ L N HL    +P + K      L  +  + NFRLWLT+   + FP  +LQ S+K+T EPP G+R NLLR+YT    S ++              +F L + HA++QERR +   GW   YEF  SD++++   + QL     D+E V+   L ++     YGGR+ ++ D +++ S L  ++  E +          G  L  L T+++  Y+ HI +  P+   P +FGL  N + + +  E ++   SI         G++K++ +   D  S I+S   KL Q   + +  +   +   + ++ VL  E I    LI+ + +S+  +  +++   L    +++  +S+V  + P  W S ++ PS     L   +      ++ F+   +      P  F  S  ++   FL  + Q  +R+ +  +D+L              PA +   + GL L+   +   D  L E+  S   Y   P++ +  T +S   I  E     PVY ++ R  ++ +
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Celegans
Match: dhc-3 (Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G5EDV4])

HSP 1 Score: 231.876 bits (590), Expect = 6.446e-60
Identity = 137/335 (40.90%), Postives = 215/335 (64.18%), Query Frame = 3
            T    L+++ T   L  KK+ E+  +  +Y  G+EK++ +E Q++ MQ EL   QPQL+ TS ET  L+  IE ET++VE  R+VV   E      A  A+S+K + E+ LA A+P + +A+EAL+T+ Q+D+S +K M+ PP  V+L MEAVCIL G+KP K T+  G+++ DYW + +KLL D+ FL  ++S+ +DT+ +  ++ IR +Y++   FDP  +K  S A EGLC WV A+++Y++I K+V PK+E+L  AE + +  + QL+VK+  L +V  KL  L + F    Q+K +LE+ I   +V++ERAE+L+  L GEK +W   I+

HSP 2 Score: 134.035 bits (336), Expect = 2.192e-30
Identity = 153/653 (23.43%), Postives = 299/653 (45.79%), Query Frame = 3
            +++K I Q  LL   G+ +  +    I  + E F KL  S + F  L  ++  +   I +VD   +  ET+ L      L  K     E++   + A   I+  L +F+  LP++ A+    +K RHW  +       +    +  +S++L M   +  +   +V ++A KE  LE +  +M++ W  +  +F  ++  G  +L T  ++ V ++ H+ ++ T+ +SP        I HW  TL  L   ++ + +    W  +E +F + DI  Q+P E   F+ +  +W  I N++T +  +   M++++  NL  +L   E L  +++ G + YL KKR  FPR F LS+E +L ++ ++++P   + ++   F  ++   + T+  +I+  +S + E +     +    ++  VEKW+ +++  +K +LR  ++  +   N ++S  + + + P QV      + +T Q  N++K ++L           S +   +RD     L +     F+ +  H    +  +V KL++ +V   DD+ W SQ+RYYW  E        N+ IR+ T    Y YE  G    ++   L D   +  +        G   G         ++ +A A+ K   + +    +D K +
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Fly
Match: Dhc36C (gene:FBgn0013810 transcript:FBtr0304742)

HSP 1 Score: 3122.41 bits (8094), Expect = 0.000e+0
Identity = 1729/3952 (43.75%), Postives = 2495/3952 (63.13%), Query Frame = 3
            L  K+    N+ + + + ++  ++KKA++D++L    L++L ++ +G          V      W  +  +++  L K  +  H ++  +L  ++ KY +  LI  + + +  +P SL   V +C  +       L+ SW  +    L+ +  S    +P   + R   ++RFFNCVA L +  L  I   S+ E+ +FI       C  G+ +   G  +S +           L     + F PSF ++  +L ++ID+I+ S+    R+E+ L+       K+  TP++P        E  V   K ++   ++     P    Q +  F  L+N +  +    F+ +D     Y   + + K   D  A  +   + M  +    +     L    +QL++  L  M    +     +  +YD+I ++     + T++L++L+ YV       +  ++ +L+     +L+L+++T+    +I  N+ +F W  ++  I +     + ++       L+K  + F   L     Q++ ++    +      ++    + ++L + +E   QIN+EE      + + Y   ++     +P+  L+ +   F   +D WM+  +   D +E++ +  + ++   +L K    HP     M+    +KA++E F+ ++PII  L NPG+K RHW+ +S  +GF I    +  L  ++   LD+++     +S  A+KE +LE+A  +M N+W+ + FS +PY+++G   L  VDDIQ+LL+D I+KT TM++SP+I PFE++I  W+  L  L++ L+ WL+VQA W+YLEPIF S DI++Q+P EG +F  VD+ W+ +M +V+ D KVM V++ D + + L+ + +LLE IQKGLN YLEKKRLYFPRFFFLSN+ELLEILSETKDP RVQ HLKKCFEGI+ L FTEE  +T M S+E EEV     I   +A G VEKW+L++E  MK S+   + +A   Y ++ R  WV  WPGQ V + S  +WT + T   +S      L ++L+K   QI+ IV+LVR + L +  RITL A +VLDVHARDV+A++++++V    DF W+ Q+RYYW         ++NL  RM+   +PYGYEYLGNT RLV+TPLTDRCYRTL  A+ L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGLA  GAW+CFDEFNRI+LEVLSV+AQQI TIQR I       +FEGT L LD +C +FITMNPGYAGRSELPDNLK LFR+VAMMVPDYALI+EI LYS GF+ A+ L+ KIVA YRLCSEQLS+Q HYDYGMRAVKSVL AAG LK + R   E+ +VL+SI DVNLPKFL  DIPLF GI SDLFPG   P  DY      T++  ER      +  P+ L+K+ Q+YEMI+VRHGLM+VG  F GKT  ++ L+ AL  + K    EN  I+ +INPKAI++G LYG+FD VSHEWSDGILA  +R  A S+S +RKW+IFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQ++N  N++FEP DLE ASPATVSRCGMIY+EP  LG +PL+  W +  LP       +  + +L +   P  L  + +  K         L+ +++  +   +DD R+                           + N +++    +T  +   F  S IWS G  LD DS+ KF+  FR L E T   S    Y  P++L     A+  +  +PK+G++FD+ ++K+  G W  WQ  +       + +   ++ I+I T ++VR    L  + ++G KPIM VG TGTGKS  +  +ML  +   D  F+    ++FSAQTS++Q QD   SKLD+RR+G++ PP +   V+F+DD+SMP KE YGAQPP+E+LR ++DH  W+DRK+  P+ + D+ +  AM  PS     VT R  R FN+I+ID+F+++ +  IF  I+ WH ++ GF          IV AT  I+     + LPTPAKSHY+FNLRDFSRVIQG LL      +++      N + RLWVHE  RV+ DRL+   D    FE I   V+  F      LFG     +K    ++ R+L++ DF   K D                K Y E+ D E L + ++ YL EYN MSK PM+LVLFRFAIEH++RICR+++QP  H+LL+G+GGSGRQS  +LA+ ICD+E+FQ+E+TR Y   ++ +DI+ ++R  G   +   FLF D QIK+  FLEDI+ LLNSG++PNLF NE+++E+ EKM QI +Q++  ++   + + ++N F+   +  LH+VL  SPIGDA  +R+R FPS++NCCTI+WFQ WPEDAL  V+ + L   ++    R   + MC  FH S  +LS KF+  + R NYVTPTSYLELI+TF  LL++K+  I  ++ RY  G+ +L+ +  Q+++MQ +L A +P+L E S+   + +  +  ++   E+ R++VK +E+    +A  A+ IKD+C++ L EA+P++ +A+ AL+TL   DI++VK M++PP GV++VMEAVCILK +KP+K  +PSG   +EDYW  +K++L D+KFLD L ++DKD IP   M+K+  + ++N  FDP KIK+ S+ACEGLC WV A+  YD + K+V+PKK  LA AE+ Y   M  L  K   L +VE+ LA +Q+    + ++   L    E    K++RA++LI+GLGGE+ RW +    L   F ++ GDVL+ +G+V+YLGPFTI +R + +  W  +C  ++  V+  + F L+ VLG+PV +R W I GLP D+FS+++A+++ +  RW L+IDPQGQANKWIK  E + NKL VI+L+   Y RV+EN +QFG P LLEN+GEELD VLESVL K  FKQ     I+LGD V+EY+  FRFY+TT+LRNPHYLPE +VKVTL+NFMIT  GL+DQ+LGI  A+E+P+LE  +  LI++ A N+R LKE EDQIL++LS+++ NILEDE A++ILSS+K L+  IS KQ     TE +I+  R  Y P+A H +ILFFTI +LA++DPMYQYSL WF+NLY+ SI+N+E   DI  RL +L +HFT ++Y NICRSLFE+DKLLFS +L I + K  N++D   W FLLTGG+ L++P KNP   WL  ++W+E+  L+NL  FKG  +DF  N  +WK   DSK+P   K  P  W+ R+S  ++L+++R   P+K++PAV++++ G LG  +V+PP FDL  SF +S    P+IF+L+PG DP + L +FAE +      L  +SLGQGQGPIA   I E +K  NW++LQNCHLA S++P L KICE LL      +P+FRLWLTSYP+  FPV VLQN +KMTNEPPKGLR+N+LRS  + PISD +++++  +P++F++L++SLCFFHAV+QERR +G IGWNIPYEFN++DL+IS+ QL+MF+N YE V  +AL YLTGECNYGGRVTD+ DRR + ++L   Y   ++ L   + L E+G Y VP V  +++ YLN  +  P  +AP +FG H NA++ K+Q+ET+ L    L+T             ++ + + ++ ++A+DIL KLP++F  +   +KYP LY + MNTVL+QE++RFN L+  IR SL+ L+  ++GL++M   +E VY+S++I K+P++W+  SYPSLKPLGSY++D + R++F Q+W D+G P TFW+SGF+FTQ+FLTG  QNYAR+   +ID L FD+ ++   E      S P D G F++G++LE  RW      L ES  + L+D +P+I + P  +  +   ++Y CP+YKTA RRGVLSTTGHSTN+V  + L   P++  V HWI RG A LCQL+
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Fly
Match: Dhc62B (gene:FBgn0013811 transcript:FBtr0303106)

HSP 1 Score: 2717.57 bits (7043), Expect = 0.000e+0
Identity = 1490/3552 (41.95%), Postives = 2176/3552 (61.26%), Query Frame = 3
            IC +++ I  R  +  ++T +L+E  EY+  ++  ++  L  +++   +    ++  T +      L   T  W   I  I D   YN +++ +        +++   E +  L + I E   +  + D +    +       L   I++ K        IN+EE L    + T Y +L  I T   PF +L K  + + +    W +GP   ++ + VE  T    K        YR+     +  +P  ++KG            P+R   ++   ++ F   + I+  +CNP L++RHW  MS   GFD+TP   T L  +L  GLD  L+    +S  A+KE  L  A   M  +W+  VF + PYKETGV IL ++DDIQ LL+DHI+KT  MR S F+ P E E+  W + + R+ + L+ W KVQA +LYL PIF S DI  Q+P EG  F IV++ +   M  V     VM       LLE LQ +  LLE I  G+++YLEKKRLYFPRFFFL+N+E+LEILSETKDPLRV PHL KCFEGI+ L+F     +  M+S++ E ++F   +    A G VEKW++ VE  M  ++R   + +   Y ++ R +WV +WP   VLA S V+W  +    ++         +  F ++  ++++ IV LVR   + +L RIT+++ IV+DVHA+DV   L+ ++VSSE DF W++QMRYYW         +D   +R++   VP+  EYLGN+ RLVITPLTDRCYRTL+GA +L+L GAPEGPAGTGKTET+KDLAKA+A QC VFNCSDGLDYK+MGKFFKGLA  GAWACFDEFNRIELEVLSV+AQQI  I +A+R     F+FEGTEL L+ +C + ITMNPGYAGRSELPDNLKVLFR+VAMMVPDYA+I EISLYS GFV+AR LA KIV  YRLCSEQLSSQ+HYDYGMRAVK+VL+A G +K++     E+ ++L+S+IDVNLPKFL  D+PLF+GIISD+FPG++ P IDY     +  R+ +E +    LEP P FL K+IQ YEMI+VRHG M+VG+   GK+   + L+  L  L     ++ N    V   I+NPK+I++  LYG FD +S+EW+DG++AK FR+ A + + +RKW+IFDGPVDA+WIENMNTVLDDNKKLCL SGE+I M+N+ +M+FE  DL QASPATVSRCGMIYMEP  LG     K W+++  P + D+E    V  L  WL+PP   F+ R C  ++K G    +     L+   + +                              I    E  ++    +  A    +LIW  G +LD  S+ KFD F + L + TD P    P P        +  P +G + D++F+ KQ G W  W  L ++ D++E  KT     +++PTVDT R    L ++    +K ++ VG TGTGK+  ++ ++++ L  + F    +TF+   S++Q QD   SKL + +RG+Y PP+    V+F+DD++MP KE YGAQPP+E+LRQ  D+   +D KD++ + I +VLI +A  +P  SR  V +R L HFN+ +I+ F D++M  IF  + ++    +G    +  ++  IV AT  I++SV +    TP+KSHY+FNLRD SRV+ GC L++  SV  K +         +R+W HE  RVF+DRL+   D    F+ + + ++  FK+K   +F  +     D    T      ++FG +      P+E             + Y E+   E         LD+YN   +  MD+ LF FA++H+ RICR++      +L++G+GGSGRQS  KLAT +     FQ E+T+ Y  +DW DDI+ +++  G     TTFL  ++QIK   FL+DI+ LLN G++PN+F  +++ E++E ++   Q  N  I+++A+ +++ F++R ++ LH++L+FSPIGDA  +R+R +PSL+NCCTI+W+  WPE+AL+M+A  SL +V +  +D++  I+  CQ+FH + +  ++ F ++ GR  Y T  S++ELI++F  L+ +KQ E + +K RY  GL+ L  +   IS+MQ +L A QP+L+  ++ + K++  I  ET+      + VK +E    V+AE A+ +K DCE +LA+A+PV+  A+ AL+TLK  DI++VK+M+NPP  +KLVM AVC++KG+ PE+  DP SGK+++DYW  +K+LLG++ FL  LK +DKD IP   +++I  ++I N  FDP  +   SSA +GLC W+ A+ +YD + KVV+PKK KLA AE  Y   M  L  K+     +E K+A L         E    E + E  + K+ RAE LI GLGGEK RW K   DL   +D++ GDVL+  GI+AYL    + YR ECV+ W  +   + IP SS  + +   VLG  V ++ WQ+ GLP D FS +NA+I  +++R+SL IDPQ QAN W+K +E  +N+L  +K +   Y++V+   L++GTP ++ENV EEL+  L+ +L++QTF Q  +++I LG+ VV  + +FR Y+T  LRNPH+LPE   KVT++NF +T   L DQ+L IV AKE+P+L++ R  L  E+A+N+  L++ E+ IL+ LS   G+ILE+E AI+IL+ SK LS+ I  KQEAA +T  +I   R  YKPVA H SIL+++I+DL ++DPMYQ+SL+W+INLY++SIE +  S D+  R+K L   FTR +Y N+CRS+FEKDKLL+SF+L   I  G  +V+   +  L+T      +   NP P W++E  W  +  L  L+  +G +  F  ++  W++I D  +P  +  P  W+++ +  E+++V++ L P+ V  AV  +I   +G +YV PP FD+  S+ +S ++TP++F+LSPG DP+  L  FAE      T  + +SLGQGQGPIA + I  + +   W+ LQNCHLA SW+P L  + E   +      PNFR+WLT+YP+  FPV +LQN VKMTNEPP GL+ NL+RSY + PI+D +F+   +K+ + F +LL+ +CFFHAVVQERR YG +GWNI Y FN+SDL+IS+ QL M +N Y+ V  +A++YLT ECNYGGRVTDN DRRLI+++L    + + +    +       Y++P  T   ++  YL+  +  P  A PEV+GLH N+ + ++ Q T  L +S+++ L  E +G +    S + +I D    I  ++P    IE    KYPV Y E MNTV++QE+ RF KL + IR +  DL   ++G+I+M   LE V  +M   ++P+ W   SYP LKPLGSY+ DL  R+ +  +W  +G+P TFW+SGF+FTQ+FLTG +QN+AR+ +  ID L FD+ +++    + P D+G + +GLYLE  RW   + +L+E   KVL   +PVI   P     +   + Y CP+YKTA R+G LSTTGHSTNYV  + L +     HW+ R +A +CQ +D
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Fly
Match: kl-2 (gene:FBgn0001313 transcript:FBtr0346722)

HSP 1 Score: 1927.14 bits (4991), Expect = 0.000e+0
Identity = 1283/3831 (33.49%), Postives = 2041/3831 (53.28%), Query Frame = 3
            SNILR    ++IT+     F EF     D+ + + G+ ++F  M       S+ NS+      +H + D+ ++  L+        C  L   ID I   +S +  R+ N+L    E  P +   + +    ++   +K  L D     +  N EA I + +        + N   +L +TTE    + + A +   D +EA +E   +++D+ + +     ++  +++   I   +LD  ++ + + +  + + S    R+I        R++     T  + +  +++ E++   E+ + Q            L  Y +   ++I +        W+  +          L +  E   N  E+++K  V+     K  +KEF              N R  L       + L  +A K+ +C   ++ + ++  + +   Q   + L+++         +W+    +   ++ W  G   +++  E+E    +L+K    L K F    ++      AT K  ++ F+  LP+I AL NP +++RHW+ + +   V FD   + +  L  ++ +      ED+ ++S+ A+ E  +E +   +   W++  F    Y + G+  +  V+D   LLE+H+V+ S M+ + F+ PF + +++W+KTL  + + L   L VQ  WLYLE IF   DIR+Q+P E  +F  + E++RTI +K+       K  N+     LL      +  LE IQ+ L  YLE KR  FPRF+F+SN++LLEIL  +K P  VQ HLKK F+ + KL      K       +GM S + E V+F   I+    +G  E+W+ QVE  M   ++E++K       ++  +R +W+  WPGQ+VL  + + WT + T ++   ++ +         KK  + +S + E+ R ++L   +R+ +   I L++H RDV+ ++  S       F W SQ+R+YW  E ++       VIR   TE  YGYEY GN+ RLVITPLTDRCY TL  A+ L+ GG+P+GPAGTGKTET KDL KA+    +V NCS+GLDYKS+GK F GLAQSG W CFDEFNRI +EVLSV+AQQI +I  A+  +    +FEG  ++L  +  +FITMNPGYAGR+ELPDNLK +FR ++MMVPD  +IAE  L+S GF   R LA K+  +Y L  +QLS Q+HYD+G+R++ ++L  AG+ +R+L   TEE +V  ++ D+N+ +    D+PLF+GI+SD+FPGV  P IDY +    + E  R   L+P+   + K+I+++E    RH +MI+G +   K+  ++ L      +N +  +   +V    +NPKA+++  LYG ++  + EW DG+L+   R     E   +KW++FDGPVDA+WIENMN+V+DDNK L L++ E I M  + +++FE  DL  ASPATVSRCGM+Y +    G  P +  W+Q+  + EF D      +++ F++++P  LDF   +CK  V+   L  V ++ +L           G K                    +N I   N  L EE T      F   L+WS                    C   D  +++  R  +         P K T+FD+     ++ F  W     ++W+   E P           + I++PT DTVR  + ++++L     P+M VG  GTGK++   + M     NK F   ++  SAQT++  +Q+S  ++ ++R +  + P   K ++ F+DD +MP K+ YG+QPP+E++RQ ID+K+WF+RK    + +++ L+ +AM  P   R  ++SR    F ++ +     ET+  IF  ++     S +   ++ +   I   T +++ S+++  LPTP KSHY+FNLRD S+V QG  LL+S   K L  ++  N  +RLWVHE +RVF DRL+   D   F   I  ++   F+  FH L       +K P         FGDF   +                    + E    + L   M+  L+EYN       M+LV FR AIEHI RI R++ QP GH L +GIGGSGRQ   KLA FI +  +FQIE+T+ Y   D+R+D++ L + TG K   T F+F   QI E  FLE  N +L++G+I NLF++++      K +     +   + +T   +Y+ FI  VR  LH+ L FSPIG+ F S +R +P+L++  T NWF+ WP++AL  VA+  L        V  K+D   RE +VI  +              H SV+ +S+  Y  + R NYVT  +YL+L+  F  LL KK++E+ T+  R   GL K+  ++ ++SLM  EL+A   Q+   ++E E  I +IE +  E  + ++ V       +++ ++     +     ++L   MP+++AA++ALD L + DIS VK+   PP  ++ VMEAV IL G +P              W  AKK+L +  FL+ LK++D+D I +  +++I + Y  NP  +P K+  +S AC+ L  W+ A+E Y ++ ++V+PK+EKL  A    + + A L   + +L E++  + +L    + K     +L    E  + ++ERA  L+  L GE+ RW + ++ L + F+ + GD LL    ++YLG F   YR+E +  W    K + IP + E   +   V  D V +REW I GLP D  S +N VIVT  +RW L+IDPQ QAN WIK +E ERN+L  +      YLR LE  L+ G P LL+NVGE LD  +  +L +    QS    ++  D  + Y+  FRFYITT++ NPHY PE S K T+VNF +   GLE Q+LGI+  KEKP LE+++ +L++  A N+R L +++++IL++L+ S+G++L+D++    L  S+  S  +      A  TE EI+  R  YKP +   SILFF + D++ +DPMY +SL+ +I L+  SIE S  +  +  R++N+N + + AVY+N CR LFE+ KLLFS  +   I     K+ E  + F+L GGI LD      NP P W+SE++W+ +  L  +  F G +  F  + + W     +  P  E   G+W ++L+  +++ V+R L P+++   +  +I+  LG  YV+PP  DL+ +F ES S TP+IFVLSPGVDP   L   +E   ++   +  +SLGQGQ PIA   I + +K  NW+ L NCHL+ SW+P L K+     ++  +++  FRLWL+S P   FP+++LQ S+KMT EPP+G+++N+ R Y      +E   +    P  ++KLLF+LCFFH V+ ER+ +  +GWN+ Y FNDSD ++S   L +++N+YED    AL YL    NYGG +TD+ DRRL+++ +   +  + L +  F L+    Y +P    D+ SYL+ I+ FP    P+ FG H+NA++A    ET  LFE++L + +    +  +++ +T + DLA +IL   P     E+   K   +    +  VL+QE+ R+NKL+  +   L DL+  ++GL++M + LE++Y ++  G+VP  W + +Y SLKPL ++  DLI R+  F +W    +P   FW++ + F   F+T VLQ  AR  +  ID+L +DF +    E +  A       G +I  L+LE G W  ++  L +     L   LPVI+  P           Y CP Y    R G         ++V  + L S ++   +WI RG A L  L
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Fly
Match: Dnah3 (gene:FBgn0035581 transcript:FBtr0289982)

HSP 1 Score: 1872.06 bits (4848), Expect = 0.000e+0
Identity = 1004/2220 (45.23%), Postives = 1425/2220 (64.19%), Query Frame = 3
            N+ +P+PK     R  M P+K    D+ F + +   W TWQ S           +  +I  +++PT +T      Q F +++        ++ VG TGTGKSA+I + +L ++P    L + + FSA+TS+  VQD+  SKLDRRR+G++ P   K   VF DD++MP K+ YG+Q P+E+LR  +DH +W D  D T + + D+ +  AM     S   +  RL RH  ++A+D F+D T+  IF  I DWHF+ G+   +  LS+ +  A   +++  +  FLPTPAKSHY F+LRD +RV QG +++    + +        KL RLW HETYRVF+DRL+  +D D    +     +   +      FG+     ++ T+ ++R L +G++++   +P               K Y+E    E L + M++YL EYN  S  PMDLV+FRFAIEH++R+ R+L+ P G+ L+VG+GGSGR+S+A+LA +I D  +  ++++++Y+++DWRDD+++++ +       T FLF D Q  +  ++EDIN +LN+GD+PNL++ ED+  I+E M  + +Q    ++     +Y  +I+R+R+ LH+ L FSPIGD+F  R+R +PSLINCCTI+W+  WPE+AL  V                              DE E++++     RE+      +V    +FHQSV D S+K Y  + R NYVTP++YLEL+K F     +K  EI   ++RY+ GLEKL+F+  Q+  MQ  L   QP+L   S+ET++++  IE ET E EK ++VV  +EA     A  A++IKDDCE++LAEA+P M AA+EAL+TLK  DI IVK+M+NPP GVKL MEAVC+++G+KP++K DPSG ++EDYW  + ++L D+KFLD LK++DKD IP   +++IR +YI +  F P KIK  S ACEG+C WVRA++VYD++ ++V PKK  LA AE     QM +L  K+ EL  +  KL KL + F  K +EK  LE+ I+  + K+ RAEKL+ GLGGEK RW +   +L     N++GDVLL  G  AYLG FT  YR   ++ W   CK   IP  S  TFSL++ LG P+ +R W + GLP D+FSV+N +IVT+++R+SLLIDPQ QANKWIK +E + N L+VIK SD  Y++VLE  + FG P L+ENVGE+LDS L  +L K   K     +I+ GD ++EY+ +FR YITT LRNP Y PE  V VT++NFMIT  GL +Q+L IV A E+P+L++++ QLIIESA NR  L  IE +IL++LSTS+GN+LEDE AI ILSSSK+LSE I  KQ  A  TE EI+  R  Y PV+ H +ILFF IS+LA++DPMYQYSLSWF+NL++++I  +  S  +  RLKNLN +FT+++Y N+CRSLFEKDKL+ S ++C+GI   Q +V++    F LTGGI   +   NP+  WL +KSW  +   ++LE  K   +       +W +  D+  P   + P      ++ +  L+VI+ L P+K++PAV ++I   L   +VEPP FDL  SF +S    P++F+LS G DPM+ L+ FA+ +N+    LK +SLGQGQGP AE  I E+ +   W++LQNCH+A SW+ +L +IC +  L     N ++RLW TSYPS+VFPV+VLQNSVKMTNEPPKGLRAN+ RS+T+ P+  + FF      +    + + + +F+L FFHAVVQERR +G +GWNIPYEFN+SDLKIS+ QL+MFIN  + +      YLTGECNYGGRVTD++DRRLI+SLL  +Y+   +  + + L++SGTY VPL  + LNS + ++  FP +  PEV+GLH NA++ +  +ETN L   +L+T    ++  ++ SS    ED A      +L +LP+ F I+E+   YPV+Y   MNTVL QELIRFN+L+  IRKSLV++  AV G I M   LE  + SMVIGK+P+ W + SYPSLKPLGSY+SDL+AR+ FFQ WIDNG+P  +W+SGFYFTQSF+TGVLQNY+R+NR  ID +  +F + +  E   P   D GA+I G+++E  RW+ +   + ES SKVL+D LPVI + P LK+  +   S         Y CPVYKT+ RRGVLSTTGHSTN+V  + L  S+   HWINRG A LCQL+D

HSP 2 Score: 1163.29 bits (3008), Expect = 0.000e+0
Identity = 710/1690 (42.01%), Postives = 1011/1690 (59.82%), Query Frame = 3
            LID +++F+  VK++ L+Y+L + +E++RL L   P +  +  +   + W S  L+ K  + +    TH T+  L   +   Y +L ++ +  +     PL  + +    E+        L N W+  C +++     + + ++P S     R     F C+ +  S  L  ++  SI    + +  ++     E Y    + +     ++ + S++  H + +  +  P +   S   + D          Q+ Q ++N+  I  V+QF                         +++L +  E  P L F++S        +  F+  +        EK+   VK+N +    Y + +Y  +  L  K       +    +   +L   +  L+KL+++SD    L  F+P++LF+LD   +   L    +++    ++     +   NR+IC + + +  +  ++ E T ++V LQ Y+   R   +  ++ +++   + V+FLL +T L +D++ LN+ TF     +  +LD S   L   R+     L + + +F + LA  K  +  F  R       L +  E    +D +   +     E K IN EE LL   V + +  L EI+   EP +KLWK++  F K Y  WM      ++A+ V  + +++ K  Y+L++  ++ P  K   R A  ++ K+EKF++ LP++ ++C  GL++RHWD +S  +G  + P++   L DM+ + +   L  L E+++ A KE+ L      MQ DW++++F    Y+++  +IL ++DDIQ LL+DHI++T  M+ SPFI    S+ + W+  L  +++ +++W +VQ  W+YLEPIF S DI RQ+P+EG  F+ VD+ WR IM     D  VM   ++  +LE    +   LE + KGLN YLE+KRL+F RFFFLSN+ELLEILSETKDP+RVQPHL+KCFEGI  L F +   I  M+S E E V     I P  A GLVE W+ +VE  M DS++E M++A   Y  + R  WV  WPGQVV   S + WT +   AI++  L  +L+K++ QI+ +V+LVR  +L++ VRI +EA IVLDVH RDVV  L    +++  DF+WISQ+RYYW    K+N  N++ V + MV T+V YG EYLGN  RLV+TPLTDRCYRTLMGA+KL LGGAPEGPAGTGKTET KDLAKAVAK+CVVFNCSDGLDYK++GKFFKGLAQSGAWACFDEFNRIELEVLSV+AQQI TIQRAI  ++  F FE T L+LD +C+IFITMNPGYAGR+ELPDNLKVLFRTVAMMVPDYA+I EI+LYS GF  AR L+ KIV  Y+LCSEQLSSQ HYDYGMRAVKSVL A+  L+R    L E  +VL++I+DVNLPKFL  DI LF GI  DLFPGVE P+    D+ + L   L    L+  PW+L+KI+QIYEM+LVRHGLMIVG S  GKT A++ L+  L +++ +      E  V F IINPKAI++G LYGRFD VSHEW DG+LAKTFRE       ER W++FDGPVDA+WIEN+NTVLDDNKKLCLMSGEI+QMT   NM+FEP DLEQASPATVSRCGMIYMEP QLG   L K +I   + +  L D   T  + +  WL+P +L+F+  +CK
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309029)

HSP 1 Score: 1691.78 bits (4380), Expect = 0.000e+0
Identity = 1126/3377 (33.34%), Postives = 1781/3377 (52.74%), Query Frame = 3
            QT Y +L +I        KL+K           + + P  EVD EE+  E         +L K     P +         +K  ++ F    P+++ + N  +K RHW  +      D+T  I         L ++L   L KH ED+ ++   A KE  +E    ++ N+W      F  +   G  +L   T  +    LED ++   ++ ++ +  PF  +I  W   L    + L  WL VQ  W+YLE +F   DI +Q+P E  +F  +D+ W+ IM +      V+     D+LL+ L    +  LE  QK L+ YLE+KR+ FPRFFF+S+  LLEIL +  D   +Q HL   F+    +KF   E   +  ++S+E E ++    I    AEG VE W+ Q+    + SL  +++ A    N    +   +++  P Q+ L    + WT  A  A+      + + + + +   ++  + D+  ++L    R   E  I + VH RD+   L    + S +DF W+ Q R+Y+  +L      D   I +      Y  EYLG T RLVITPLTDRCY TL  A+ L++GGAP GPAGTGKTET KD+ K +AK  VVFNCSD +DY+ +G+ +KGLAQSG+W CFDEFNRIEL VLSV AQQ+  +  A +++ + FLF +G  + ++    IFITMNPGYAGR ELP+NLK+ FRTVAMMVPD  +I  + L S GF+E  TLA K   +Y+LC EQL+ Q HYD+G+R + SVL   G  KR+    TE  +V++ + D+NL K +  D PLF  ++SDLFP       +Y +L   ++++     L   P ++ K+IQ+YE   VRHG+M +G S  GKT     L  A+   GD ++E+ +         NPKAI+   ++GR D  +++W+DGI +  +R+    ++ E  W++ DGPVD+IWIEN+N+VLDDNK L L +G+ + M     +IFEP +++ ASPATVSR GM+YM    L + P+++ W++   P     F D   +T V++ +NW +              VK     L  N++Q    +L+ +  V KK D+       + + ++D      I  + +    E  + L   +  +L W  G  L    + + + F ++       P   YP+              + TIFD  F     G W +W++L+  P +   + T +  +IL+P VD VR  + +  I  N  + +M +G  GTGK+ ++K FM   +  + ++  S  FS+ TS  Q Q +  S +++R    + PP  + L+VFIDDI++PE  ++G Q   EI+RQ +D K F+   K      I DV   +AM +P   R  + SRL R F +   +  D++++  IF+ I + H+N+  GF   ++ L K ++  T  ++Q      LPTPAK HYVF+LRD SR+ QG +   S V+       S + L+ LW HE  RVF DR  + +D + F   +  +V    +E+     GD  +    P        +F DF++   +P          +EGE       K+Y  +   E L + +  +L ++N M +   MDLV F  A+ H+ +I R++R P G  +LVG+GGSG+QS  KLA+FI  ++ FQI +TR+Y+V+++ +D++ L R  G +G  TTFLF D  IKE  FLE +N +L+SG I NLF  +++ EI++++  +++++N +   T  ++ + F+ R   NLH+   FSP+G+ F SR++ FP+L++ CTI+W   WP+DAL  VA   L   E+E    V+E++V         V++ S+++++   R  +VTP SYL  I  + N+   KQ E+    E+   GLEKL+ +   + +++ +L   + +L+E SK  E ++  +    ++ E V+  V   +             K   E  L  A P +  A  AL+T+K   I+ V+ +  PP  +  +M+ V IL  + L P    D      +  W  + K++    FL  L++Y KDTI +  M  +   Y     ++    + +     GL  W +A+  +  + K V P K  L + E+  +  M  L   +++L E E  L  +++ +     EK  L +   +   K+  A  LI GL  EK RW     +  I+   ++GDVLL  G ++Y GP+   +R   ++ W    K  +IP ++        V  D   V EW + GLP D  SV NA+I T ++ + LL+DPQ Q   WIK  + +RN+L++  L+ K +   LE+ L  G P L+E+VG +LD V+++VL K   K  ++E + +GD   +    F  YITT+L NP + PE S K ++++F +T  GLEDQ+LG V   EK +LE  R  L      N+R +KE+E  +L  LS+S+G++++DE  IE+L  +K  +E+++ K + +  TE +I   R  ++ VA  GSIL+F I ++++++ MYQ SL  F+ ++ HSI  S  SS  E R+  +  + T  VY+   RSL+E+ K LF+ +L I I      +    +   + GG SLD     P P  W+ + +W  +  +S LE F   L+   +N + W+   + + P  E+ P  +   L    +L++IR  CP++ I     YI   LG EY E    DLE  + ES+  TP + +LS G DP + +   A+ K++    LK VS+GQGQ   A   I ES+    W++LQN HL+   LP   +I  ++L++   I+ +FR+W+T+ P + FP+ +LQ ++K TNEPP+G+RA+L RSY +      D+  A++ P     LL+++ F H +VQERR +G +GWNIPYEFN +D   S++ +Q  +++ +    V  + L Y+ GE  YGGRVTD+ D+RL+ +   SV+  E LLS  F   +   Y VP  T  L  ++++I   P    PEVFGLH+NA++  +      + ++IL   PKE   G  ++ ++I+  LA D+L KLP     +++ E   +  +L    MN  L QE+ R  ++I+ +   L DLK A+ G I+M   L+E   +M   ++P  W + S+ S   LG + ++L+ R   F+ WI   +P  FW++GF+  Q FLT + Q   R ++  A+D +    +I   +  + ++   EG ++HGL+LE          L+ES  KVLY+ +PVI I     +       Y CP+Y+   R  +         YV +I   +    +HW  RG+A LC +
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Zebrafish
Match: dnah3 (dynein axonemal heavy chain 3 [Source:ZFIN;Acc:ZDB-GENE-091112-7])

HSP 1 Score: 3727.56 bits (9665), Expect = 0.000e+0
Identity = 1983/3905 (50.78%), Postives = 2723/3905 (69.73%), Query Frame = 3
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Zebrafish
Match: dnah7 (dynein, axonemal, heavy chain 7 [Source:ZFIN;Acc:ZDB-GENE-070912-282])

HSP 1 Score: 3443.28 bits (8927), Expect = 0.000e+0
Identity = 1843/3915 (47.08%), Postives = 2564/3915 (65.49%), Query Frame = 3
            + ++++  S+KK I+D++L +  E K L         +P  R+EM     PW    LQ+++ ++   +  + T++++L  +   + +LRLI +E    E   + L+   ++  ++ ++ +  L N+W+ + ++I      +  +++P +    +  ++ F+NCVATL ++ L+ +   S+ ++   I Q    V  YE            +   +LR+ L+ +      + F P F      +  + + ++ S+S   R+E  L+ +  G P     L  +   E + + +EK+R  ++  S  P+K+  +Y  +  L+++  E+   QF+       +   E+ + + L+DE   S    + + +F L    + + L+ R++ L    +NHM    + FN  +C +YD+I  +  +    T +L+EL+ YV K+   E++ L+ KL+++   + FL++Y      DI LN+ TF  + R+  I D     + ++  +  + L+   ++ +E++   + Q++EF      ++LN  ++  Q L+    KL   +E+ + INQEE      V + Y Q + +     P+ +L+++A  F   + +W+ GP+  V+ ++VE +  +  +  Y+L K F   +   P++ A ++KA++E FK ++PI+Q LCNPGL++RHW+AMS  VGF + P   D  ++  L + L+ HL     +S  ASKE  LEKA  RM ++W  + F+  PY+ETG +IL ++D++Q+LL+DHIVKT TMR SPFI PFE+EI  W+  L  L++ ++ WLKVQ  WLYLEPIF S DI  Q+P EG +F  VD+ WR  M +V+ D  V+ V+  + +L+ ++ S  LLE I KGLN+YLEKKRLYFPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGI+ + FT+   IT M S+E E V+    I   +A G VEKW+L++E  M  S+ +V+ KA   Y    R  WV+ WPGQ VL  S V+WT+    AI      L+ +L++N+ QI  IV LVR + L    R+TL A +VLDVHARDV+A L+   V  E +F W+SQ+RYYW          + L  +M+   + YGYEYLGNT RLVITPLTDRCYRTL GA+ L+LGGAPEGPAGTGKTET+KDLAKA+AKQCVVFNCSDGLDY ++GKFFKGL  +GAWACFDEFNRI+LEVLSV+AQQI TIQR I    EM LFEGTEL+L+ +C +FITMNPGYAGRSELPDNLK LFRTVAMMVPDYALIAEI LYS GFV AR L+ KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     E+ ++L+SIIDVNLPKFL  D+PLF+GI SDLFPG++ P  DY  L   + E    M L+   +F +KI+QIYEM++VRHG M+VG+ F GKT A++ L+ AL D+  K L  EN V   +INPK+I++G LYG+FD VSHEWSDGILA ++R  A S+S +RKW+IFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+ + ++IFEP DLE ASPATVSRCGMIYMEP  LG  P++  W+   +P  L    +  +  LF+ ++P  L  I +  K      +  LV +++ L   ++D+    G +S                     K  ++ ++      ++L   F   L+WS GA    +   K         +  +++    ++   ++++  A+ L VP   +GT++++ F+K+  G W  W    E      + K  + + I++PT +TVR    L ++L   +KP +FVG TGTGKS  I  F+L+ L    +    + FSAQT++ Q Q+   SKLD+RR+G++ PP  K +VVF+DD++MP +E YGAQPPVE+LRQ +DH  W+D KD + + + D+ I  AM  P   R  VT R LRHFN + I+EFD++TM  IF  I+DWH    F        ++  I+ AT  ++Q    + LPTPAKSHY+FNLRDFSRVIQG  L +     +LT       + RLWVHE  RV++DRL+  +DC      +++V +    E FH LF    S  +   T  ++R LMF DF     DP           +GE + Y E+ D E L Q ++ +L+EYN +SKAPM+LVLFRFAIEH+ RI R+L+QP GH+LLVG+GGSGRQS  +LA  + + E+FQ+E++++Y VS+WRDD++ +++ +        FLF D QIK   FLED++ LLN+G++PNLF  +++  +    ++    + ++ Q + + + ++N F+ER R  LH+VL  SPIGD F SRLR FP+LINCCTI+WFQ WPEDAL+ VA++ L++VE+    RE  + MC+ FH S  DLS  F   + R NYVTPTSYLELI  F +LL +K+ E++  K RY VGL+KLE +  Q+S MQ EL+A QPQL   +KE E+++ +I+ E+ EV K  KVV+ +EA    +A  AK+IKD+C+++LA A+P++ AA+ ALDTL Q DI++VKAM+NPP GVKLVMEA+CILKG+KP++  DPSG  K +EDYW  AKKLLGD+KFL  L  Y+KD IP +YM  IR +YI NP F P KI+  S+A EGLC WV A++ YD++ KVV+PKKEKLA AE   +  M  L+ KQ  L EV+ KLAKLQE  +  + +K DLEN +E+   K+ERAE+LI GLGGEK RW +   +L   ++N+ GD+L+ A IVAYLG FT  +RQ   E W + CKS  IP S   +   S  LG+PV++R W I GLP DSFS+DNA+I+++  RW L+IDPQGQANKW+K +E + N L VIKLSD  ++R LENC+QFGTP LLENVGEELD +LE +LLKQTFKQ     IRLGD  +EY+ DFRFYITT+LRNPHYLPE SVKVTL+NFMITP G++DQ+LGIV A+E+P+LE+ +  LI++ A N+RQL+EIED+IL++LS S+GNILEDE A++ILSSSKVL+ +IS KQ  A  TE +I+  R GY P+A H +ILFF+I+DLA+++PMYQYSL+WFINL+I SI+NS+ S  +E RL+ L  HFT ++Y N+CRSLFEKDKLLFSF L + + K    VDE  WRFLLTGG+ LD+P  NP   WL + SW+E+  L  +E FKG  KD     + WK + DSK PH   FP +W+E+L   +R+++IRCL P+KV+P V  ++ G LG +++E P F+L  +F +S    P+IF+LSPG DPM+ L +F E +  +   L  +SLGQGQGPIA S I   +K   W++LQNCHLATSW+  L ++CEE  L     +P+FRLWLTSYPS  FPV VLQN VKMTNE PKGLR+N++RS+   PISD +FF +S +P VF+KLLFSLCFFHA+ QERR +G +GWNIPYEFN++DL+IS++QL MF++ YE++  +AL Y+TGECNYGGRVTD+ DRR + ++L   Y  E++    +    SG Y  P    D NSY+ + K  P N +PE+FG++ NA++ K+Q ET  LF+SIL+T  +   G + SS  ++ ++A+DIL+KLPQ F  +    KYP  Y + MNTVL+QE+ RFNKL++ IR S V+++ A++GL++M   LEEV  S++ G++P++W + SYPSLKPLG YISD + R+KF Q+W  +G P  FW+SGF+FTQ+FLTG  QNYARR    ID L FDF +ME  EY  P ++G +I GL+L+  RW      L ES  K+L+D +PVI + P  K  I     Y  PVYKT+ RRG LSTTGHSTNYV ++AL S    +HWI RG+A LCQLN
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Zebrafish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 3374.72 bits (8749), Expect = 0.000e+0
Identity = 1815/3945 (46.01%), Postives = 2559/3945 (64.87%), Query Frame = 3
            N+ L D  +    S  K ++ Y         R+  ++ N  S     ++    +  +QS+  +QK  +  H  +  +L      +  L LI + +   + P+    L        ++  + L  +W      +L S  D+++ + P+       +++ F+NC +TL SN L+ +V  S+T FV                 LF  +   N+N +    ++  +     + F P+F  +   + +I + I  ++ +   +++ L    EG  S+  I + L+ +   +  +  LR+ V++N E P K+ Q Y + + +L+N T +    + +  +    ++  ++E  ++LS E +SLP+ +   +  LDCE + Q L  ++  L  I +  + +     +  IC ++++I  R  K  ETT +++E+  Y+ +++T  +  L  ++ +A + + +L++  I   + + LN T   W   I PI D S   + + + +  N L   +++ +  L  +  +++EF + ++L+   +   ++  + ++L +  E    IN+EE L     +T Y +++ I    EP+ KL+   + + +   KWM+G  L+++ E +E E +   +  Y++ K F   + K  ++                           C++ +K ++++FK  +P++  LCNPG++ RHW+ MS   G D+TP   + L  +L   L  +LE    +S+ ASKEF LE+A   M   W  + F + PY++TGV+IL +VD+IQ +L+D IVKT TMR SPFI PFE+EI  W++ L  ++D ++ WLKVQ  WLYLEPIF S DI +Q+P EG  F+IV++ WR +M     D K++       L E LQ S  LLE I KGLN YLEKKRL+FPRFFFLSN+E+LEILSETKDP RVQPHLKKCFEGI+KL F     I  M S+E E V+F   I   EA G VEKW++QVE  M  S+R+V+ ++   Y +  R QWV++WPGQVVL AS ++WT +   AI+S  + L+++ ++   Q++ IVELVR + L    R TL A + +DVHARDV+ +L+   VSSE DF W++Q+RYYW        +NDN+ +R++  +V Y YEYLGN+ RLVITPLTDRCYRTL+GA  LNLGGAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY +MGKFFKGLA SGAWACFDEFNRIELEVLSV+AQQI  IQRAI  +LE F FEGTELRL+ +C + ITMNPGYAGRSELPDNLKVLFRTVAMMVP+YALIAEISLYS GF+ A+ L+ KIV  YRLCSEQLSSQ HYDYGMRAVK+VL AAG LK K     E+ ++L+SI DVN PKFL  DIPLF+GI SDLFPG+  P+ DY+              ++PV  FLDKIIQ YEM++VRHG M+VG+ F GKT     L+  L  +N+   N E  VI+  +NPK+I++G L+G+FD VSHEW+DGI+A TFRE ASSE+ ERKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQM+++ ++IFE  DL QASPATVSRCGMIYMEP QLG  PL+  W++  LP+ L  +  +T+ Q LF WL+PP+L  + ++C+  +   +   V ++ +L+  LL                               +  NE+   K  RT +++A F  +L+WS G                  C  TDS ++  K+ R      A N  +P           +KG ++D+ +  K  G W  W   I    L +  K T++ +I++PT+DTVR  + +   ++ GR P++ VG TGTGKS  +K  ++++L    FL   + FSA+TS++Q Q+   S+LD+RR+G+Y PP  K  ++F+DD++MP KE +GAQPPVE+LRQ  DH  W+D KD + + + D+ + SAM  P   R AVT R LRHFNI +I+ F DE+M  IF  I+ ++  +  F      +   IV AT +++Q  + + LPTPAKSHY FNLRDFSRV+QGCLLLK   L N         +IRL+VHE YRVF+DRL+  +D    F L   +V+  FK+ F  +F      NK      MR L+FGD++    D +E             +LY E+   E   + ++  LDEYN   K  M+LV+FR+ +EH++RI R+L+QP G++LLVG+GGSGRQS  +LATF+ +  +FQ E++++Y +++WR+D++RL++N G KG +T FL  D QIK+  FLED++ +LN+G++PN+F  +++ EI+E ++   Q  N  +E + + ++  F+ R ++NLH+V+ FSPIGDAF +RLR FPSLINCCTI+WFQ WPE+AL+ VANK L+ +++    R+++V +C+ FH S  DLS +F   +GR NYVTPTSYLELI  F  LL +++  ++++K RY+ GL+KL F+E+Q+S M+ EL   QP+L +   +  K++++IE E+VEVE   K+V+ +E    +KA +A+++K++CES+LAEA+P + AA+ ALDTLK  D++IVKAM+NPP GVKLVM AVC++K +KPE+  DPSG  + + DYW  +KKLLGD+ FL  LK YDKD IP   M KIR +Y+ NP FDP K+   SSA EGLC W+ A+EVYDR+ KVV+PKK  L VA+    T MA L  K+ EL EVE +LA LQ+  + K +EK  LE  ++L   K+ERAEKLI GLGGEK RW K  +DL   +DN+ GDVL+ AG++AYLG FT  +R +C ++W   CKS  IP  S   FSLS  LGDP+++R W I GLP DSFS+DN VIV+++ RW L+IDPQGQANKW+K  E + N L VIKL+D  Y+R LENC+QFGTP LLENVGEELD  LE +LLKQ FKQ  V+ IRLG+ V+EYS DFRFYITT+LRNPHYLPE + KV L+NFMITP GLEDQ+LGIV AKE+PELE+ R  LI++SA+N++QLKEIEDQIL+ L +S+GNILEDE AI+IL ++K++S +I+ KQ+ A KTE EI   R GY+ +A H SILFFTI+DLA++DPMYQYSL+WF+NLY++SI +S  S ++E RL+ L  +FT  +Y N+CRSLFEKDKLLFSFLLC  +   + +++   + FLLTGG+ L +   NP P+WL +KSW+E+   S+L    G  + F+ + + +  I DSK P     P  W ++L+ L+++++ RCL P+K+ PA+  ++   LG  +VEPP FDL  S+ +S+   P++FVLSPG DPM+ L +FA  KN+  +  K +SLGQGQGPIA   I  ++K   W+ LQNCHLA SW+  L KICE+  L     +PNFRLWLTSYPS  FPV +LQN VKMTNEPP GLR NLL+SY + PISD DFF    K+  V+EKLL+ +CFFHA+VQER+ +G +GWNIPY FN+SDL+ISIRQLQ+F+N+Y++V  EA+TYLTGECNYGGRVTD+ DRRL+M++L   Y+K+++    +  + SG Y  P   S    Y+  IK+ P    PEVFG+H N +++K+ Q+T  LF+S+L+T       G      + + D+A+DILSKLP  F IE   +K+PV YEE MNTVL+QE+ R+N L   IR SL +L  A++GL++M   LE V  S+++GKVP  W++ SYPSLKPLGSY++D +AR+KF Q+W D  +PH FW+SGF+FTQ+F+TG LQNYAR+    ID L F++ ++         ++G +IHGL+L+  RW  +   L E + KVL+D +P+I I PT K  ++  +S Y CP+YKT+ R+G LSTTGHSTN+V T+ LP+S+  QHWI RG+A LCQL+D
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Zebrafish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 3355.07 bits (8698), Expect = 0.000e+0
Identity = 1809/3894 (46.46%), Postives = 2536/3894 (65.13%), Query Frame = 3
            PWH   +QS+  +QK  +  H  +  +L      +  L LI + +   + P+    L        ++  + L  +W      +L S  D+++ + P+       +++ F+NC +TL SN L+ +V  S+T FV                 LF  +   N+N +    ++  +     + F P+F  +   + +I + I  ++ +   +++ L    EG  S+  I + L+ +   +  +  LR+ V++N E P K+ Q Y + + +L+N T +    + +  +    ++   LE  ++LS E +SLP+ +   +  LDCE + Q L  ++  L  I L   ++   +F R IC ++++I  R  K  ETT +++E+  Y+ +++T  +  L  ++  +   + +L++  I   + + LN T   W   I PI D S   + + + +  N L   +++ +  L  +  +++EF + ++L+   +   ++  + ++L +  E    IN+EE L     +T Y +++ I    EP+ KL+   + + +   KWM+G  L+++ E +E E +   +  Y++ K F   + K  ++                           C++ +K ++++FK  +P++  LCNPG++ RHW+ MS   G D+TP   + L  +L   L  +LE    +S+ ASKEF LE+A   M   W  + F + PY++TGV+IL +VD+IQ +L+D IVKT TMR SPFI PFE+EI  W++ L  ++D ++ WLKVQ  WLYLEPIF S DI +Q+P EG  F+IV++ WR +M     D K++       L E LQ S  LLE I KGLN YLEKKRL+FPRFFFLSN+E+LEILSETKDP RVQPHLKKCFEGI+KL F     I  M S+E E V+F   I   EA G VEKW++QVE  M  S+R+V+ ++   Y +  R QWV++WPGQVVL AS ++WT +   AI+S  + L+++ ++   Q++ IVELVR + L    R TL A + +DVHARDV+ +L+   VSSE DF W++Q+RYYW        +NDN+ +R++  +V Y YEYLGN+ RLVITPLTDRCYRTL+GA  LNLGGAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY +MGKFFKGLA SGAWACFDEFNRIELEVLSV+AQQI  IQRAI  +LE F FEGTELRL+ +C + ITMNPGYAGRSELPDNLKVLFRTVAMMVP+YALIAEISLYS GF+ A+ L+ KIV  YRLCSEQLSSQ HYDYGMRAVK+VL AAG LK K     E+ ++L+SI DVN PKFL  DIPLF+GI SDLFPG+  P+ DY+              ++PV  FLDKIIQ YEM++VRHG M+VG+ F GKT     L+  L  +N+   N E  VI+  +NPK+I++G L+G+FD VSHEW+DGI+A TFRE ASSE+ ERKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQM+++ ++IFE  DL QASPATVSRCGMIYMEP QLG  PL+  W++  LP+ L  +  +T+ Q LF WL+PP+L  + ++C+  +   +   V ++ +L+  LL                               +  NE+   K  RT +++A F  +L+WS G                  C  TDS ++  K+ R      A N  +P           +KG ++D+ +  K  G W  W   I    L +  K T++ +I++PT+DTVR  + +   ++ GR P++ VG TGTGKS  +K  ++++L    FL   + FSA+TS++Q Q+   S+LD+RR+G+Y PP  K  ++F+DD++MP KE +GAQPPVE+LRQ  DH  W+D KD + + + D+ + SAM  P   R AVT R LRHFNI +I+ F DE+M  IF  I+ ++  +  F      +   IV AT +++Q  + + LPTPAKSHY FNLRDFSRV+QGCLLLK   L N         +IRL+VHE YRVF+DRL+  +D    F L   +V+  FK+ F  +F      NK      MR L+FGD++    D +E             +LY E+   E   + ++  LDEYN   K  M+LV+FR+ +EH++RI R+L+QP G++LLVG+GGSGRQS  +LATF+ +  +FQ E++++Y +++WR+D++RL++N G KG +T FL  D QIK+  FLED++ +LN+G++PN+F  +++ EI+E ++   Q  N  +E + + ++  F+ R ++NLH+V+ FSPIGDAF +RLR FPSLINCCTI+WFQ WPE+AL+ VANK L+ +++    R+++V +C+ FH S  DLS +F   +GR NYVTPTSYLELI  F  LL +++  ++++K RY+ GL+KL F+E+Q+S M+ EL   QP+L +   +  K++++IE E+VEVE   K+V+ +E    +KA +A+++K++CES+LAEA+P + AA+ ALDTLK  D++IVKAM+NPP GVKLVM AVC++K +KPE+  DPSG  + + DYW  +KKLLGD+ FL  LK YDKD IP   M KIR +Y+ NP FDP K+   SSA EGLC W+ A+EVYDR+ KVV+PKK  L VA+    T MA L  K+ EL EVE +LA LQ+  + K +EK  LE  ++L   K+ERAEKLI GLGGEK RW K  +DL   +DN+ GDVL+ AG++AYLG FT  +R +C ++W   CKS  IP  S   FSLS  LGDP+++R W I GLP DSFS+DN VIV+++ RW L+IDPQGQANKW+K  E + N L VIKL+D  Y+R LENC+QFGTP LLENVGEELD  LE +LLKQ FKQ  V+ IRLG+ V+EYS DFRFYITT+LRNPHYLPE + KV L+NFMITP GLEDQ+LGIV AKE+PELE+ R  LI++SA+N++QLKEIEDQIL+ L +S+GNILEDE AI+IL ++K++S +I+ KQ+ A KTE EI   R GY+ +A H SILFFTI+DLA++DPMYQYSL+WF+NLY++SI +S  S ++E RL+ L  +FT  +Y N+CRSLFEKDKLLFSFLLC  +   + +++   + FLLTGG+ L +   NP P+WL +KSW+E+   S+L    G    F+        I DSK P     P  W ++L+ L+++++ RCL P+K+ PA+  ++   LG  +VEPP FDL  S+ +S+   P++FVLSPG DPM+ L +FA  KN+  +  K +SLGQGQGPIA   I  ++K   W+ LQNCHLA SW+  L KICE+  L     +PNFRLWLTSYPS  FPV +LQN VKMTNEPP GLR NLL+SY + PISD DFF    K+  V+EKLL+ +CFFHA+VQER+ +G +GWNIPY FN+SDL+ISIRQLQ+F+N+Y++V  EA+TYLTGECNYGGRVTD+ DRRL+M++L   Y+K+++    +  + SG Y  P   S    Y+  IK+ P    PEVFG+H N +++K+ Q+T  LF+S+L+T       G      + + D+A+DILSKLP  F IE   +K+PV YEE MNTVL+QE+ R+N     IR SL +L  A++GL++M   LE V  S+++GKVP  W++ SYPSLKPLGSY++D +AR+KF Q+W D  +PH FW+SGF+FTQ+F+TG LQNYAR+    ID L F++ ++         ++G +IHGL+L+  RW  +   L E + KVL+D +P+I I P+  + I+  + Y CP+YKT+ R+G LSTTGHSTN+V T+ LP+S+  QHWI RG+A LCQL+D
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Zebrafish
Match: CR450723.1 (dynein, axonemal, heavy chain 12 [Source:NCBI gene;Acc:799461])

HSP 1 Score: 3348.91 bits (8682), Expect = 0.000e+0
Identity = 1801/3897 (46.22%), Postives = 2526/3897 (64.82%), Query Frame = 3
            PWH   +QS+  +QK  +  H  +  +L      +  L LI + +   + P+    L        ++  + L  +W      +L S  D+++ + P+       +++ F+NC +TL SN L+ +V  S+T FV                 LF  +   N+N +    ++  +     + F P+F  +   + +I + I  ++ +   +++ L    EG  S+  I + L+ +   +  +  LR+ V++N E P K+ Q Y + + +L+N T +    + +  +    ++   LE  ++LS E +SLP+ +   +  LDCE + Q L  ++  L  I L   ++   +F R IC ++++I  R  K  ETT +++E+  Y+ +++T  +  L  ++  +   + +L++  I   + + LN T   W   I PI D S   + + + +  N L   +++ +  L  +  +++EF + ++L+   +   ++  + ++L +  E    IN+EE L     +T Y +++ I    EP+ KL+   + + +   KWM+G  L+++ E +E E +   +  Y++ K F   + K  +                            C++ +K ++++FK  +P++  LCNPG++ RHW+ MS   G D+TP   + L  +L   L  +LE    +S+ ASKEF LE+A   M   W  + F + PY++TGV+IL +VD+IQ +L+D IVKT TMR SPFI PFE+EI  W++ L  ++D ++ WLKVQ  WLYLEPIF S DI +Q+P EG  F+IV++ WR +M     D K++       L E LQ S  LLE I KGLN YLEKKRL+FPRFFFLSN+E+LEILSETKDP RVQPHLKKCFEGI+KL F     I  M S+E E V+F   I   EA G VEKW++QVE  M  S+R+V+ ++   Y +  R QWV++WPGQVVL AS ++WT +   AI+S  + L+++ ++   Q++ IVELVR + L    R TL A + +DVHARDV+ +L+   VSSE DF W++Q+RYYW        +NDN+ +R++  +V Y YEYLGN+ RLVITPLTDRCYRTL+GA  LNLGGAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY +MGKFFKGLA SGAWACFDEFNRIELEVLSV+AQQI  IQRAI  +LE F FEGTELRL+ +C + ITMNPGYAGRSELPDNLKVLFRTVAMMVP+YALIAEISLYS GF+ A+ L+ KIV  YRLCSEQLSSQ HYDYGMRAVK+VL AAG LK K     E+ ++L+SI DVN PKFL  DIPLF+GI SDLFPG+  P+ DY+              ++PV  FLDKIIQ YEM++VRHG M+VG+ F GKT     L+  L  +N+   N E  VI+  +NPK+I++G L+G+FD VSHEW+DGI+A TFRE ASSE+ ERKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQM+++ ++IFE  DL QASPATVSRCGMIYMEP QLG  PL+  W++  LP+ L  +  +T+ Q LF WL+PP+L  + ++C+  +   +   V ++ +L+  LL                               +  NE+   K  RT +++A F  +L+WS G                  C  TDS ++  K+ R      A N  +P           +KG ++D+ +  K  G W  W   I    L +  K T++ +I++PT+DTVR  + +   ++ GR P++ VG TGTGKS  +K  ++++L    FL   + FSA+TS++Q Q+   S+LD+RR+G+Y PP  K  ++F+DD++MP KE +GAQPPVE+LRQ  DH  W+D KD + + + D+ + SAM  P   R AVT R LRHFNI +I+ F DE+M  IF  I+ ++  +  F      +   IV AT +++Q  + + LPTPAKSHY FNLRDFSRV+QGCLLLK   L N         +IRL+VHE YRVF+DRL+  +D    F L   +V+  FK+ F  +F      NK      MR L+FGD++    D +E             +LY E+   E   + ++  LDEYN   K  M+LV+FR+ +EH++RI R+L+QP G++LLVG+GGSGRQS  +LATF+ +  +FQ E++++Y +++WR+D++RL++N G KG +T FL  D QIK+  FLED++ +LN+G++PN+F  +++ EI+E ++   Q  N  +E + + ++  F+ R ++NLH+V+ FSPIGDAF +RLR FPSLINCCTI+WFQ WPE+AL+ VANK L+ +++    R+++V +C+ FH S  DLS +F   +GR NYVTPTSYLELI  F  LL +++  ++++K RY+ GL+KL F+E+Q+S M+ EL   QP+L +   +  K++++   +++    V    K          +KA +A+++K++CES+LAEA+P + AA+ ALDTLK  D++IVKAM+NPP GVKLVM AVC++K +KPE+  DPSG  + + DYW  +KKLLGD+ FL  LK YDKD IP   M KIR +Y+ NP FDP K+   SSA EGLC W+ A+EVYDR+ KVV+PKK  L VA+    T MA L  K+ EL EVE +LA LQ+  + K +EK  LE  ++L   K+ERAEKLI GLGGEK RW K  +DL   +DN+ GDVL+ AG++AYLG FT  +R +C ++W   CKS  IP  S   FSLS  LGDP+++R W I GLP DSFS+DN VIV+++ RW L+IDPQGQANKW+K  E + N L VIKL+D  Y+R LENC+QFGTP LLENVGEELD  LE +LLKQ FKQ  V+ IRLG+ V+EYS DFRFYITT+LRNPHYLPE + KV L+NFMITP GLEDQ+LGIV AKE+PELE+ R  LI++SA+N++QLKEIEDQIL+ L +S+GNILEDE AI+IL ++K++S +I+ KQ+ A KTE EI   R GY+ +A H SILFFTI+DLA++DPMYQYSL+WF+NLY++SI +S  S ++E RL+ L  +FT  +Y N+CRSLFEKDKLLFSFLLC  +   + +++   + FLLTGG+ L +   NP P+WL +KSW+E+   S+L    G    F+        I DSK P     P  W ++L+ L+++++ RCL P+K+ PA+  ++   LG  +VEPP FDL  S+ +S+   P++FVLSPG DPM+ L +FA  KN+  +  K +SLGQGQGPIA   I  ++K   W+ LQNCHLA SW+  L KICE+  L     +PNFRLWLTSYPS  FPV +LQN VKMTNEPP GLR NLL+SY + PISD DFF    K+  V+EKLL+ +CFFHA+VQER+ +G +GWNIPY FN+SDL+ISIRQLQ+F+N+Y++V  EA+TYLTGECNYGGRVTD+ DRRL+M++L   Y+K+++    +  + SG Y  P   S    Y+  IK+ P    PEVFG+H N +++K+ Q+T  LF+S+L+T       G      + + D+A+DILSKLP  F IE   +K+PV YEE MNTVL+QE+ R+N     IR SL +L  A++GL++M   LE V  S+++GKVP  W++ SYPSLKPLGSY++D +AR+KF Q+W D  +PH FW+SGF+FTQ+F+TG LQNYAR+    ID L F++ ++         ++G +IHGL+L+  RW  +   L E + KVL+D +P+I I P+  + I+  + Y CP+YKT+ R+G LSTTGHSTN+V T+ LP+S+  QHWI RG+A LCQL+D
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 3885.88 bits (10076), Expect = 0.000e+0
Identity = 2039/3900 (52.28%), Postives = 2748/3900 (70.46%), Query Frame = 3
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 3860.84 bits (10011), Expect = 0.000e+0
Identity = 2034/3904 (52.10%), Postives = 2738/3904 (70.13%), Query Frame = 3
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 3622.79 bits (9393), Expect = 0.000e+0
Identity = 1870/3296 (56.74%), Postives = 2426/3296 (73.60%), Query Frame = 3
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 3518.78 bits (9123), Expect = 0.000e+0
Identity = 1836/3296 (55.70%), Postives = 2382/3296 (72.27%), Query Frame = 3

HSP 2 Score: 54.299 bits (129), Expect = 8.181e-6
Identity = 46/178 (25.84%), Postives = 82/178 (46.07%), Query Frame = 3
            ++ TS++K I+DYIL +  E++RL +   P+   + V+R  +PWH    ++  + Q      H   V  ++N F   Y+          CE     L  L +  E      S +    W+  C  +  S  D    ++P+   +   +++ FF C+A+L S  LR +V NS+ + + F
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 3515.7 bits (9115), Expect = 0.000e+0
Identity = 1841/3305 (55.70%), Postives = 2397/3305 (72.53%), Query Frame = 3
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Mouse
Match: Dnah3 (dynein, axonemal, heavy chain 3 [Source:MGI Symbol;Acc:MGI:2683040])

HSP 1 Score: 3756.07 bits (9739), Expect = 0.000e+0
Identity = 1979/3904 (50.69%), Postives = 2710/3904 (69.42%), Query Frame = 3
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Mouse
Match: Dnah3 (dynein, axonemal, heavy chain 3 [Source:MGI Symbol;Acc:MGI:2683040])

HSP 1 Score: 3713.31 bits (9628), Expect = 0.000e+0
Identity = 1971/3926 (50.20%), Postives = 2699/3926 (68.75%), Query Frame = 3
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Mouse
Match: Dnah7c (dynein, axonemal, heavy chain 7C [Source:MGI Symbol;Acc:MGI:3639762])

HSP 1 Score: 3411.31 bits (8844), Expect = 0.000e+0
Identity = 1850/3930 (47.07%), Postives = 2572/3930 (65.45%), Query Frame = 3
            +TN  ++   + ++++  SVKK+I+D++L +  E+   G +    P++  + VL +  PW    L +  Y++      +  ++ +L  +   + +LRL+ IE   +    L L++   I  ++ +   + L  +W  + + I        +    +S  +    ++ FFNC ATL +  L+ ++  S+ +F + I Q  +           S  A  +   I+R+ L+ D  S     F P F+   D L  I + +I +VS   R+E  L+ + E + S P  L  +   E +  +KEK+R+ +   S AP ++ ++Y  +++L+    E    +F+   +       E+ K + L +E   +    + + +F + CE + + L+ R+     K +  ++ NH    +      +C +++ I  +       T++L+E++  ++K+ T +++ L+ +L  +   + FL+        DI LNN+ F W  R+  I D     +  + E+    L+   ++FVE L     Q++EF+    L D     Q+   +  KL+   ++  Q N EE      V + Y Q ++I     P+ +L+++AV F   +  W  GP  +V+ ++VE +  + W+  Y+L KVF    +  P   A T  +++ +E+FK  +P+IQ +CNPGL  RHW+AMS  VG+ + P  D+ +   + M L+  L+    +S  ASKE+SLEKA  +M  +W  + F   PY+E+G  IL +VDDIQ+LL+DHI+KT TMR SPFI P+E ++  W+  L  L++ L+ WLKVQA WLYLEPIF S DI  Q+P EG +F+ VD+ WR +M  V  D +V+ V+  + +LE L+ S  LLE I KGLN+YLEKKRL+FPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGI+K++FTE   IT M S+E E V+    I   +A G VEKW++++E  M  S+ +V++ A+  Y + SR  WV+DWPGQ VL  S   WT +   AI K H  LE++L K +QQI  IV LVR + L    R+TL A +VLDVHARDV+A L   ++S + DF W+SQ+RYYW          +NL  +M+   + YGYEYLGN+ RLVITPLTDRCYRTL GA+ L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGL   GAWACFDEFNRI+LEVLSV+AQQI TIQR I    ++ +FEGTEL+LD +C +FITMNPGYAGRSELPDNLK LFRTVAMMVPDYA+IAEI LYS GFV AR L+ KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     EE ++L+SIIDVNLPKFL  D+PLF+GI SDLFPGV+ P  DY DL   + +   TM L+   +F +KI+QIYEM++VRHG MIVG+ F GKT A++ L+ AL D+  K L  EN V   ++NPK++++G LYG+FD VSHEWSDG+LA +FR  A+S + +RKW+IFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+ + N+IFEP DLE ASPATVSRCGMIYMEP  LG  PL+  WI   LP+ +   Q+  ++ LF+ ++P S++FI R  K         LV +++ L    +DD  +                         NK    N+   +E  + L   F  SLIWS GA    D ++KFD   R+L E  ++D    K+    + +   ++  +V  P+KGTI+D+ F+ +  G W  W + L + P +    K  + + I++PT+DTVR    L  +L   +KP +FVG TGTGKS  I  F+L+ L NKD ++  L   FSAQT++ Q Q+   SKLD+RR+G++ PP  K ++VF+DD++MP +E YGAQPP+E+LRQ +DH  W+D KD + + + D+ I  AM  P   R  +T R +RHFNI+ I+EF D++M  IF  I+ WH  + ++       ++  IV+ T  +++  M + LPTPAKSHY+FNLRDFSRVIQG  L +    +N         + RLWVHE  RV++DRL+ + D       I+ +++   +E FH LF   DF+ D     + ++R LMF DF   K+               E   Y E+ + +AL   ++ +LDEYN MSK PM+LVLFRFAIEHI+RI R+L+QP  H+LLVG+GGSGRQS  +LA  + D+ +FQ+E+++ Y   +W +D++ ++R   +  ++  FLF D QIK   FLED+N LLN+G++PNLF  + +  +    +     + +  Q + + I ++N FI+R R  LH+VL  SPIGDAF  RLR FP+L+NCCTI+WFQ WPEDAL+ VA++ L+++E+ ++ +E  + MC+ FH S  +LS  F+  + R NYVTPTSYLELI TF  LL KK+ E++  K RY VGL+KL+ + +Q++ MQ EL+A  PQL   S+E ++++ IIE E++EV K  K+VK +E     +A  AK+IKD+C+++LAEA+P++ +A+ ALDTL   DI++VK+M++PP GVKLVMEAVCILKG+K +K  DP  SGK +ED+W  AK+LLGD++FL  L  YDKD IP AYM  IR  YI NP F P KI+N S+A EGLC WV A++ YD++ K+V+PKK KLA AE   +  M  L+ KQ  LYEV+ KLAKLQ+  +  +Q+K DLEN ++L   K+ERAE+LI GLGGEK RW     +L   + N+ GD+L+ +G+VAYLG FT  YRQ   + W   CK   IP      +SL   LG+ V +R W I GLP DSFS+DN +I+ +  RW L+IDPQGQANKWIK +E + N L++IKLSD  Y+R LENC+QFGTP LLENVGEELD +LE +LLKQTFKQ     IRLGD  +EY+ DFRFYITT+LRNPHYLPE SVKVTL+NFMITP G++DQ+LGIV A+E+P+LE+ +  LI++ A N+RQLKEIED+IL++LS S+GNILEDE AI+ILSSSK L+ +IS KQE A +TE +I+  R GY+ +A H SILFF+I+DLA+++PMYQYSL+WFINL+I SIENSE S  +  RL+ L  HFT ++Y NICRSLFEKDKLLFSF L + +    N +++  WRFLLTGGI LD+P  NP   WL +KSW+E+  L +L  FK   ++F+     WK + DS  PH E FP DWE + +  +R+++IRCL P+KVIP +  +I+  LG  ++EPP FDL  +F +S+   P+IFVLSPG DPM+ L +FA+ +    + L  +SLGQGQGPIA   + +++K   W++LQNCHLATSW+P L K+CEE  L     +P+FR+WLTSYPS  FPV+VLQN VKMTNE PKGLRAN++RSY   PISD +FF + K+P+ F+KLL+ LCFFHA+VQERR +G +GWNIPYEFN++DL+IS++QL MF++ YE++  +AL Y+TGECNYGGRVTD+ DRR + S+L   +  EL+ +  +    SG Y +P  + D  SY+++ K  P   APEVFG++ NA++ K+Q ET  LF++IL+T  +     +KSS  ++ ++A DILSKLP  F IE    +YP  Y + MNTVL+QE+ RFNKL+  IR+S ++++ A++GL++M   LEEV  S++  K+P++W   SYPSLKPLGSY++D + R+KF Q W + G P  FW+SGF+FTQ+FLTG  QNYAR+    ID L FD+ +M+  EY    ++G +IHGL+L+   W  +   L ESH KVLYD +PV+ + P  KS I+   SY  P+YKT+ RRG LSTTGHSTN+V  + LPS Q  +HWI RG+A LCQLN
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Mouse
Match: Dnah7b (dynein, axonemal, heavy chain 7B [Source:MGI Symbol;Acc:MGI:2684953])

HSP 1 Score: 3406.31 bits (8831), Expect = 0.000e+0
Identity = 1846/3918 (47.12%), Postives = 2565/3918 (65.47%), Query Frame = 3
            + ++++  SVKK+I+D++L +   K +  ++  + P++  + VL +  PW    L +  Y++      +  ++ +L  +   + +LRL+ IE        L L++   I  ++ +   + L  +W  + + I        +    +S  +    ++ FFNC ATL +  L+ ++  S+ +F + I Q  +           S  A  +   I+R+ L+        + F P F+   D L  + + +I  VS   R+E  L+ + E + S P  L  +   E + ++KEK+R+ V   S AP ++ ++Y  +++L+    E    +F+   +       E+ K + L +E   +    + + +F + CE + + L+ R+  +    +  M    +  N  +C +++ I  +       T++L+E++ +V+KL T +++ L+ +L  +   + FL+        DI LNN+ F W  R+  I D     +  + E+    L+   ++FVE L     Q++EF+    L D     ++   +  KL+   ++ +Q N EE      V + Y Q ++I     P+ +L+++AV F   +  W  GP  +V+ ++VEA+  + W+  Y+L KVF    +  P   A T  +++ +E+FK  +P+IQ +CNPGL+ RHW+AMS  VGF + P  D+ +   + M L+  L+    +S  ASKE+SLEKA  +M  +W  + F   PY+E+G  IL +VDDIQ+LL+DHI+KT TMR SPFI P+E ++  W+  L  L++ L+ WLKVQA WLYLEPIF S DI  Q+P EG +F+ VD+ WR +M  V  D +V+ V+  + +LE L+ S  LLE I KGLN+YLEKKRL+FPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGI+K++FTE   IT M S+E E V+    I   +A G VEKW++++E  M  S+ +V+  A+  Y + SR  WV+DWPGQ VL  S   WT +   AI K H  LE +L K + QI  IV LVR + L    R+TL A +VLDVHARDV+A L+  ++S + DF W+SQ+RYYW          +NL  +M+   + YGYEYLGN+ RLVITPLTDRCYRTL GA+ L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGL   GAWACFDEFNRI+LEVLSV+AQQI TIQR I    E+ +FEGTEL+LD +C +FITMNPGYAGRSELPDNLK LFRTVAMMVPDYA+IAEI LYS GFV AR L+ KIVA YRLCSEQLSSQHHY+YGMRAVKSVLTAAG LK K     EE ++L+SIIDVNLPKFL  D+PLF+GI SDLFPGV+ P  DY +L   + E   TM L+   +F +KI+QIYEM++VRHG MIVG+ F GKT A++ L+ AL D+  K L  EN V   ++NPK++++G LYG+FD VSHEWSDGILA +FR  A+S + +RKW+IFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+ + N+IFEP DLE ASPATVSRCGMIYMEP  LG  PL+  WI   LP+ +   Q+  ++ LF+ ++P S++FI R  K         LV +++ L    +DD  +                         NK    N+    E  + L   F  SL WS GA    D +LKFD   R   E+ + P     R K           ++  +V  P+KGTI+++ F+ +  G W  W + L + P + + ++  E   I++PT+DT+R    L  +L   +KP +FVG TGTGKS  I  F+L+ L NKD ++  L   FSAQT++ Q Q+   SKLD+RR+G++ PP  K ++VF+DD++MP +E YGAQPP+E+LRQ +DH  W+D KD + + + D+ I  AM  P   R  +T R +RHFNI+ I+EF D++M  IF  I+ WH  + ++       L+  IV+ T  +++  M + LPTPAKSHY+FNLRDFSRVIQG  L +    +N         + RLWVHE  RV++DRL+ + D       I+++++   +E FH LF   DF+ D     + ++R LMF DF   K+               E   Y EI + +AL   ++ +LDEYN MSK PM+LVLFRFAIEHI+RI R+L+QP  H+LLVG+GGSGRQS  +LA  + D+ +FQ+E+++ Y   +W +D++ ++R   +  ++  FLF D QIK   FLED+N LLN+G++PNLF  + +  +    +     + +  Q + + I ++N FI+R R  LH+VL  SPIGDAF  RLR FP+L+NCCTI+WFQ WPEDAL+ VA++ L+++E+ ++++E  + MC+ FH S  +LS  F+  + R NYVTPTSYLELI TF  LL KK+ E++  K RY VGL+KL+ + +Q++ MQ EL+A  PQL   S+E ++++ IIE E++EV K  K+VK +E     +A  AK+IKD+C+++LAEA+P++ +A+ ALDTL   DI++VK+M++PP GVKLVMEA+CILKG+K +K  DP  SGK +ED+W  AK+LLGD++FL  L  YDKD IP AYM  IR  YI NP F P KI+N S+A EGLC WV A++ YD++ K+V+PKK KLA AE   +  M  L+ KQ  LYEV+ KLAKLQ+  +  +Q+K DLEN ++L   K+ERAE+LI GLGGEK RW     +L   + N+ GD+L+ +G+VAYLG FT  YRQ   + W   CK   IP      +SL   LG+ V +R W I GLP DSFS+DN +I+ +  RW L+IDPQGQANKWIK +E + N L++IKLSD  Y+R LENC+QFGTP LLENVGEELD +LE +LLKQTFKQ     IRLGD  +EY+ DFRFYITT+LRNPHYLPE SVKVTL+NFMITP G++DQ+LGIV A+E+P+LE+ +  LI++ A N+RQLKEIED+IL++LS S+GNILEDE AI+ILSSSK L+ +IS KQE A +TE +I+  R GY+ +A H SILFF+I+DLA+++PMYQYSL+WFINL+I SIENSE S  +  RL+ L  HFT ++Y NICRSLFEKDKLLFSF L + +   +N +++  WRFLLTGGI LD+P  NP   WL +KSW+E+  L +L  FK   ++F+     WK + DS  PH E FP DWE + +  +R+++IRCL P+KVIP +  +I+  LG  ++EPP FDL  +F +S+   P+IFVLSPG DPM+ L +FA+ +    + L  +SLGQGQGPIA   + +++K   W++LQNCHLATSW+P L K+CEEL  + +  +P+FR+WLTSYPS  FPV+VLQN VKMTNE PKGLRAN++RSY   PISD +FF + K+P+ F+KLL+ LCFFHA+VQERR +G +GWNIPYEFN++DL+IS++QL MF++ YE++  +AL Y+TGECNYGGRVTD+ DRR + S+L   +  EL+ +  +    SG Y VP  + D  SY+N+ K  P   APEVFG++ NA++ K+Q ET  LF++IL+T  +     +KSS  ++ ++A DILSKLP  F +E    +YP  Y + MNTVL+QE+ RFNKL+  IR+S ++++ A++GL++M   LEEV  S++  K+P +W   SYPSLKPLGSY++D + R+KF Q W + G P  FW+SGF+FTQ+FLTG  QN+AR+    ID L FD+ +M+  EY    ++G +IHGL+L+   W+ +   L ESH KVLYD +PV+ + P  KS I    SY  P+YKT+ RRG LSTTGHSTN+V  + LPS Q  +HWI RG+A LCQLN
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Mouse
Match: Dnah7b (dynein, axonemal, heavy chain 7B [Source:MGI Symbol;Acc:MGI:2684953])

HSP 1 Score: 3406.31 bits (8831), Expect = 0.000e+0
Identity = 1846/3918 (47.12%), Postives = 2565/3918 (65.47%), Query Frame = 3
            + ++++  SVKK+I+D++L +   K +  ++  + P++  + VL +  PW    L +  Y++      +  ++ +L  +   + +LRL+ IE        L L++   I  ++ +   + L  +W  + + I        +    +S  +    ++ FFNC ATL +  L+ ++  S+ +F + I Q  +           S  A  +   I+R+ L+        + F P F+   D L  + + +I  VS   R+E  L+ + E + S P  L  +   E + ++KEK+R+ V   S AP ++ ++Y  +++L+    E    +F+   +       E+ K + L +E   +    + + +F + CE + + L+ R+  +    +  M    +  N  +C +++ I  +       T++L+E++ +V+KL T +++ L+ +L  +   + FL+        DI LNN+ F W  R+  I D     +  + E+    L+   ++FVE L     Q++EF+    L D     ++   +  KL+   ++ +Q N EE      V + Y Q ++I     P+ +L+++AV F   +  W  GP  +V+ ++VEA+  + W+  Y+L KVF    +  P   A T  +++ +E+FK  +P+IQ +CNPGL+ RHW+AMS  VGF + P  D+ +   + M L+  L+    +S  ASKE+SLEKA  +M  +W  + F   PY+E+G  IL +VDDIQ+LL+DHI+KT TMR SPFI P+E ++  W+  L  L++ L+ WLKVQA WLYLEPIF S DI  Q+P EG +F+ VD+ WR +M  V  D +V+ V+  + +LE L+ S  LLE I KGLN+YLEKKRL+FPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGI+K++FTE   IT M S+E E V+    I   +A G VEKW++++E  M  S+ +V+  A+  Y + SR  WV+DWPGQ VL  S   WT +   AI K H  LE +L K + QI  IV LVR + L    R+TL A +VLDVHARDV+A L+  ++S + DF W+SQ+RYYW          +NL  +M+   + YGYEYLGN+ RLVITPLTDRCYRTL GA+ L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGL   GAWACFDEFNRI+LEVLSV+AQQI TIQR I    E+ +FEGTEL+LD +C +FITMNPGYAGRSELPDNLK LFRTVAMMVPDYA+IAEI LYS GFV AR L+ KIVA YRLCSEQLSSQHHY+YGMRAVKSVLTAAG LK K     EE ++L+SIIDVNLPKFL  D+PLF+GI SDLFPGV+ P  DY +L   + E   TM L+   +F +KI+QIYEM++VRHG MIVG+ F GKT A++ L+ AL D+  K L  EN V   ++NPK++++G LYG+FD VSHEWSDGILA +FR  A+S + +RKW+IFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+ + N+IFEP DLE ASPATVSRCGMIYMEP  LG  PL+  WI   LP+ +   Q+  ++ LF+ ++P S++FI R  K         LV +++ L    +DD  +                         NK    N+    E  + L   F  SL WS GA    D +LKFD   R   E+ + P     R K           ++  +V  P+KGTI+++ F+ +  G W  W + L + P + + ++  E   I++PT+DT+R    L  +L   +KP +FVG TGTGKS  I  F+L+ L NKD ++  L   FSAQT++ Q Q+   SKLD+RR+G++ PP  K ++VF+DD++MP +E YGAQPP+E+LRQ +DH  W+D KD + + + D+ I  AM  P   R  +T R +RHFNI+ I+EF D++M  IF  I+ WH  + ++       L+  IV+ T  +++  M + LPTPAKSHY+FNLRDFSRVIQG  L +    +N         + RLWVHE  RV++DRL+ + D       I+++++   +E FH LF   DF+ D     + ++R LMF DF   K+               E   Y EI + +AL   ++ +LDEYN MSK PM+LVLFRFAIEHI+RI R+L+QP  H+LLVG+GGSGRQS  +LA  + D+ +FQ+E+++ Y   +W +D++ ++R   +  ++  FLF D QIK   FLED+N LLN+G++PNLF  + +  +    +     + +  Q + + I ++N FI+R R  LH+VL  SPIGDAF  RLR FP+L+NCCTI+WFQ WPEDAL+ VA++ L+++E+ ++++E  + MC+ FH S  +LS  F+  + R NYVTPTSYLELI TF  LL KK+ E++  K RY VGL+KL+ + +Q++ MQ EL+A  PQL   S+E ++++ IIE E++EV K  K+VK +E     +A  AK+IKD+C+++LAEA+P++ +A+ ALDTL   DI++VK+M++PP GVKLVMEA+CILKG+K +K  DP  SGK +ED+W  AK+LLGD++FL  L  YDKD IP AYM  IR  YI NP F P KI+N S+A EGLC WV A++ YD++ K+V+PKK KLA AE   +  M  L+ KQ  LYEV+ KLAKLQ+  +  +Q+K DLEN ++L   K+ERAE+LI GLGGEK RW     +L   + N+ GD+L+ +G+VAYLG FT  YRQ   + W   CK   IP      +SL   LG+ V +R W I GLP DSFS+DN +I+ +  RW L+IDPQGQANKWIK +E + N L++IKLSD  Y+R LENC+QFGTP LLENVGEELD +LE +LLKQTFKQ     IRLGD  +EY+ DFRFYITT+LRNPHYLPE SVKVTL+NFMITP G++DQ+LGIV A+E+P+LE+ +  LI++ A N+RQLKEIED+IL++LS S+GNILEDE AI+ILSSSK L+ +IS KQE A +TE +I+  R GY+ +A H SILFF+I+DLA+++PMYQYSL+WFINL+I SIENSE S  +  RL+ L  HFT ++Y NICRSLFEKDKLLFSF L + +   +N +++  WRFLLTGGI LD+P  NP   WL +KSW+E+  L +L  FK   ++F+     WK + DS  PH E FP DWE + +  +R+++IRCL P+KVIP +  +I+  LG  ++EPP FDL  +F +S+   P+IFVLSPG DPM+ L +FA+ +    + L  +SLGQGQGPIA   + +++K   W++LQNCHLATSW+P L K+CEEL  + +  +P+FR+WLTSYPS  FPV+VLQN VKMTNE PKGLRAN++RSY   PISD +FF + K+P+ F+KLL+ LCFFHA+VQERR +G +GWNIPYEFN++DL+IS++QL MF++ YE++  +AL Y+TGECNYGGRVTD+ DRR + S+L   +  EL+ +  +    SG Y VP  + D  SY+N+ K  P   APEVFG++ NA++ K+Q ET  LF++IL+T  +     +KSS  ++ ++A DILSKLP  F +E    +YP  Y + MNTVL+QE+ RFNKL+  IR+S ++++ A++GL++M   LEEV  S++  K+P +W   SYPSLKPLGSY++D + R+KF Q W + G P  FW+SGF+FTQ+FLTG  QN+AR+    ID L FD+ +M+  EY    ++G +IHGL+L+   W+ +   L ESH KVLYD +PV+ + P  KS I    SY  P+YKT+ RRG LSTTGHSTN+V  + LPS Q  +HWI RG+A LCQLN
BLAST of dynein heavy chain 3, axonemal vs. UniProt/SwissProt
Match: sp|Q8BW94|DYH3_MOUSE (Dynein heavy chain 3, axonemal OS=Mus musculus OX=10090 GN=Dnah3 PE=1 SV=2)

HSP 1 Score: 3713.31 bits (9628), Expect = 0.000e+0
Identity = 1971/3926 (50.20%), Postives = 2699/3926 (68.75%), Query Frame = 3
BLAST of dynein heavy chain 3, axonemal vs. UniProt/SwissProt
Match: sp|Q8TD57|DYH3_HUMAN (Dynein heavy chain 3, axonemal OS=Homo sapiens OX=9606 GN=DNAH3 PE=2 SV=1)

HSP 1 Score: 3705.22 bits (9607), Expect = 0.000e+0
Identity = 1986/3952 (50.25%), Postives = 2691/3952 (68.09%), Query Frame = 3
BLAST of dynein heavy chain 3, axonemal vs. UniProt/SwissProt
Match: sp|Q8WXX0|DYH7_HUMAN (Dynein heavy chain 7, axonemal OS=Homo sapiens OX=9606 GN=DNAH7 PE=1 SV=2)

HSP 1 Score: 3403.61 bits (8824), Expect = 0.000e+0
Identity = 1835/3915 (46.87%), Postives = 2548/3915 (65.08%), Query Frame = 3
            + ++++  SV+K+I+D++L +  E+   K+   +  ++  + +L +  PW    L +  Y++      + T++ +L  +   + +LRL+ I+    C+   L L+    I  ++     + L   W  + + I      + +  +P    +   ++E FFNC A L +  L+ +   S+ +F + I Q  D V            A  +   I+R+ L+ D        F P      D    + D +I +VS   R+E  L+ K E + S P  L  +   E V ++KEK+++ +   S AP ++ ++Y  + +L+ +  E     F+  +        E+ K + L +E    S+ T + + +F + CE + + L+ R+  +    L  M    +  N  +C +++ I  +       T++L+E++ Y++K+   ++I L+ +L  +   + FL+ Y      D+ LNN+ F W  R+  I +     + ++ E+    L+   ++FVE L     Q +EF     L D     ++   +  KL+   ++ +Q N EE      + + Y Q ++I     P+ +L+++AV F   Y  W  GP  +V+ ++VEA+  + W+  Y+L K F    Y   M     +++K+E FK ++P+IQ +CNPGL+ RHW+AMS  VG+ + P  D+ +S  L M L+ +++    +S  ASKE+SLEKA  +M  +W  + F    Y+ETG  IL +VD+IQ+LL+DHI+KT TMR SPFI P+E ++  W+  L  L++ L+ WLKVQA WLYLEPIF S DI  Q+P EG +F  VD+ WR IM  V  D  V+ V+  D +LE L+ S  LLE I KGLN+YLEKKRL+FPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGI+K++FTE   IT M S+E E V+    I   +A G VEKW++++E  M +S+ +V   A   Y +  R  WV+DWPGQ VL  S + WT++   AI      LE++LK  ++QI  IV LVR + L    R+TL A +VLDVHARDV++ L+   +S + DF W+SQ+RYYW          ++L  +M+   + YGYEYLGN+ RLVITPLTDRCYRTL GA+ L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGL   GAWACFDEFNRI+LEVLSV+AQQI TIQR I    ++ +FEGTEL+LD +C +FITMNPGYAGRSELPDNLK LFRTVAMMVPDYA+IAEI LYS GFV AR L+ KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     EE ++L+SIIDVNLPKFL  D+PLF+GI SDLFPGV+ P  DY DL   + +   +M L+   +F +KI+Q+YEM++VRHG MIVG+ F GKT A++ L+ AL D+  K L  EN V   ++NPK++++G LYG+FD+VSHEWSDG+LA +FR  ASS + +RKW+IFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+ + N+IFEP DLE ASPATVSRCGMIYMEP  LG  PL+  W+   LP  +   Q+  +  LF+ ++P S++FI +  K         LV +++ L    +DD  +                          K+   N+    E  + L   F  SLIWS GA    D +LKF+   R   E+ +SP     R          +    A  +  P+KGTI+D+ F+ +  G W  W + L E P +    K    + I++PT+DT+R    L  +L   +KP +FVG TGTGKS  I  F+L+ L  + +    + FSAQT++ Q Q+   SKLD+RR+G++ PP  K +VVF+DD++MP +E YGAQPP+E+LRQ +DH  W+D KD + + + D+ I  AM  P   R  VT R +RHFNII I+EF D++M  IF  I+ WH    ++       L+  IV+ T  +++  M + LPTPAKSHY+FNLRDFSRVIQG      V L      ++   + RLWVHE  RV++DRL+ + D       I++++     E FH LF     DN      + +R LMF DF   K++                  Y EI D + L   ++ +L+EYN +SK PM+LVLFRFAIEHI+RI R+L+QP  H+LLVG+GGSGRQS  +LA  + D+ +FQ+E+++ Y  ++W +D++ ++R   +  ++  FLF D QIKE  FLED++ LLN+G+IPNLF  + +  +    +     + +  Q + + I ++N FI+  R  LH+VL  SPIGDAF +RLR FP+L+NCCTI+WFQ WPEDAL+ VA++ L+E+E+ +++R+  + MC+ FH S  DLSK F+  + R NYVTPTSYLELI TF  LL KK+ E++  K+RY VGLEKL+ + +Q++ MQ+EL+A  PQL   SKE ++++ +IE E+VEV K  K+VK +E     +A  +K+IKD+C+++LA A+P++ +A+ ALDTL   DI++VK+M++PP GVKLVMEA+CILKG+K +K  DP  SGK +ED+W  AK+LLGD++FL  L  YDKD IP AYM  IR  YI NP F P KI+N S+A EGLC WV A++ YD++ K+V+PKK KLA AE   +  M  L+ KQ  L EV+ KLA+LQ+  +  +Q+K DLEN ++L   K+ERAE+LI GLGGEK RW     +L   + N+ GD+L+ +G+VAYLG FT  YRQ   + W   CK   IP S + +      LG+ V +R W I GLP DSFS+DN +I+ +  RW L+IDPQ QANKWIK +E + N L VIKLS+  Y+R LENC+QFGTP LLENVGEELD +LE +LLKQTFKQ     IRLGD  +EY+ DFRFYITT+LRNPHYLPE SVKVTL+NFMITP G++DQ+LGIV A+E+P+LE+ +  LI++ A N+RQLKEIED+IL++LS+S+GNILEDE AI+ILSSSK L+ +IS KQE A +TE +I+  R GY+P+A H SILFF+++DLA+++PMYQYSL+WFINL+I SIENSE S  +  RL+ L  HFT ++Y N+CRSLFEKDKLLFSF L I +   +  +++  WRFLLTGGI LD+P  N +  WL +KSW+E+  L +L  FK   ++F+     WK + DS  PH E FP +WE++ +  +R+++IRCL P+KVIP +  +I+  LG  ++EPP FDL  +F +S+   P+IFVLSPG DPM+ L +FA+ +    + L  +SLGQGQGPIA   + +++K   W++LQNCHLATSW+P L K+CEE  L     +P+FR+WLTSYPS  FPV+VLQN VKMTNE PKGLRAN++RSY   PISD +FF + K+P+ F+KLL+ LCFFHA+VQERR +G +GWNIPYEFN++DL+IS++QL MF+N YE++  EAL Y+TGECNYGGRVTD+ DRR + S+L   ++ EL+ +  +    SG Y VP  + D  SY+ + K  P   APE+FG++ NA++ K+Q ET  LF++IL+T  +     +KSS  ++ ++ASDIL KLP  F IE    +YP  Y + MNTVL+QE+ RFNKL++ IR S V+++ A++GL +M   LEEV  S++  K+P +W   SYPSLKPLGSY++D +AR+KF Q W + G P  FW+SGF+FTQ+FLTG  QNYAR+    ID L FD+ +ME  EY  P ++G FIHGL+L+   W+ +   L ESH K+LYD +PV+ + P  ++ I    SY  P+YKT+ RRGVLSTTGHSTN+V  + LPS Q  +HWI RG+A LCQLN
BLAST of dynein heavy chain 3, axonemal vs. UniProt/SwissProt
Match: sp|Q63170|DYH7_RAT (Dynein heavy chain 7, axonemal OS=Rattus norvegicus OX=10116 GN=Dnah7 PE=2 SV=2)

HSP 1 Score: 3397.06 bits (8807), Expect = 0.000e+0
Identity = 1825/3919 (46.57%), Postives = 2552/3919 (65.12%), Query Frame = 3
            + ++++  SVKK+I+D++L +  E++   ++  + P++  + VL +  PW    L +  Y++      + T++ +L  +   + +LRL+ IE        L L+    I  ++ +   + L  +W  + + I      + +  +P    +   ++E FFNC ATL +  L+ ++  S+ +F + I Q  + +            A  +   I+R+ L+          F P F    D L  + + +I +VS   R+E  L+ K E + S P  L  +  +E + ++KEK+R+ V   S AP ++ ++Y  +++L+ +  E    +F+   +       E+ K + L +E   +    + + +F + CE + + L+ R+  +    +  M    +  N  +C +++ I  +       T++L+E++ +++K+ T +++ L  +L  +   + FL+        DI LNN+ F W  R+  I D     +  + E+    L+   ++FVE L     Q +EF     L D     ++   +  KL+   ++ +Q N EE      + + Y Q ++I     P+ +L+++AV F   +  W  GP  +V+ ++VEA+  + W+  Y+L K F    +  P   A T  ++A++E FK  +P++Q +CNPGL+ RHW+AMS  VG+ + P  D+ +   + M L+  L+    +S  ASKE+SLEK+  +M  +W+ + F   PY+E+G  IL  VDDIQ+LL+DHI+KT TMR SPFI P+E ++  W+  L  L++ L+ WLKVQA WLYLEPIF S DI  Q+P EG +F  VD+ WR +M  V  +  V+ V+  + +LE ++ S  LLE I KGLN+YLEKKRL+FPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGI++++FTE   IT M S+E E V+    I   +A G VEKW++++E  M  S+ +V+  A+T Y + +R  WV+DWPGQ VL  S   WT +   AI      LE++L K + QI  IV LVR + L    R+TL A +VLDVHARDV+A L+   +S + DF W+SQ+RYYW          +NL  +M+   + YGYEYLGN+ R+V+ P  D C+ TL GA+ L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGL   GAWACFDEFNRI+LEVLSV+AQQI TIQ  I    E+ +FEGTEL+LD +C +FITMNPGYAGRSELPDNLK LFRTVAMMVPDYA+IAEI LYS GFV AR L+ KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     EE ++L+SIIDVNLPKFL  D+PLF+GI SDLFPGV+ P  DY DL   + E   +M L+   +F +KI+QIYEM++VRHG MIVG+ F GKT A++ L+ ALGD+  K L  EN V   ++NPK++++G LYG+FD VSHEWSDGILA +FR  A+S + +RKW+IFDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+ + N+IFEP DLE ASPATVSRCGMIYMEP  LG  PL+  WI   LP+ +   Q+  ++ LF+ ++P S++FI R  K         LV +++ L    +DD  +  K+ +                             + +R NF  L   F  SLIWS GA    D ++K++   R   E+ + P     R K           ++ L V  P+KGTI+D+ F+ +  G W  W + L + P +    K  + + I++PT+DTVR    ++ +L   +KP +FVG TGTGKS  I  F+L+ L NKD ++  L   FSAQT++ Q Q+   SKLD+RR+G++ PP  K ++VF+DD++MP +E YGAQPP+E+LRQ +DH  W+D KD + + + D+ I  AM  P   R  +T R +RHFNII I+EF D++M  IF  I+ WH  + ++       L+  IV+ T  +++  M + LPTPAKSHY+FNLRDFSRVIQG  L +    +N         + RLWVHE  RV++DRL+ + D       I++++    +E FH LF +   DN       ++R LMF DF   K+               E   Y EI + +AL   ++ +LDEYN MSK PM+LVLFRFAIEHI+RI R+L+QP  H+LLVG+GGSGRQS  +LA  + D+ +FQ+E+++ Y   +W +D++ ++R   +  ++  FLF D QIK   FLED+N LLN+G++PNLF  + +  +    +     + +  Q + + I ++N FI+R R  LH+VL  SPIGDAF  RLR FP+L+NCCTI+WFQ WPEDAL+ VA++ L+++E+ +++RE  + MC+ FH S  +LS  F+  + R NYVTPTSYLELI TF  LL KK+ E++  K RY VGL+KL+ + +Q++ MQ EL+A  PQL   S++ + ++ +IE E++EV K  K+VK +E     +A  AK+IKD+C+++LAEA+P++ +A+ ALDTL   DI++VK+M++PP GVKLVMEA+CILKG+K +K  DP  SGK +ED+W  AK+LLGD++FL  L  YDKD IP AYM  IR  YI NP F P KI+N S+A EGLC WV A++ YD++ K+V+PKK KLA AE   +  M  L+ KQ  L EV+ KLAKLQ+  +  +Q+K DLEN ++L   K+ERAE+LI GLGGEK RW     +L   + N+ GD+L+ +G+VAYLG FT  YRQ   + W + CK   IP      +SL   LG+ V +R W I GLP D FS+DN +I+ +  RW L+IDPQGQANKWIK +E + N L++IKLSD  Y+R LENC+QFGTP LLENVGEELD +LE +LLKQTFKQ     IRLGD  +EY+ DFRFYITT+LRNPHYLPE SVKVTL+NFMITP G++DQ+LGIV A+E+P+LE+ +  LI++ A N+RQLKEIED+IL++LS+S+GNILEDE AI+ILSSSK L+ +IS KQE A +TE +I+  R GY+P+A H SILFF+I+DLA+++PMYQYSL+WFINL+I SIENSE S  +  RL  L  HFT ++Y NICRSLFEKDK+LFSF L + +   +N +++  WRFLLTGGI LD+P  NP   WL +KSW+E+  L  L  FK   ++F+   + WK + DS  PH E FP +WE + +  +R+++IRCL P+KVIP +  +I+  LG  ++EPP FDL  +F +S+   P+IFVLSPG DPM+ L +FA+ +    + L  +SLGQGQGPIA   + +++K   W++LQNCHLATSW+P L K+CEE  L     +P+FR+WLTSYPS  FPV+VLQN VKMTNE PKGLRAN++RSY   PISD +FF + ++P+ F+KLL+ LCFFHA+VQERR +G +GWNIPYEFN++DL+IS++QL MF+N YE++  +AL Y+TGECNYGGRVTD+ DRR + S+L   +  EL+ +  +    SG Y VP  + D  SY+ + K  P    PE+FG++ NA++ K+Q ET  LF++IL+T  +     +KSS  ++ ++A DIL KLP  F IE    +YP  Y + MNTVL+QE+ RFNKL+  IR+S ++++ A++GL++M   LEEV  S++  K+P +W   SYPSLKPLGSY++D +AR+KF Q W + G P  FW+SGF+FTQ+FLTG  QNYAR+    ID L FD+ +M+  EY    ++G +IHGL+L+   W+ +   L ESH KVLYD +PV+ + P  KS I    SY  P+YKT+ RRG LSTTGHSTN+V  + LPS Q  +HWI RG+A LCQLN
BLAST of dynein heavy chain 3, axonemal vs. UniProt/SwissProt
Match: sp|E9Q8T7|DYH1_MOUSE (Dynein heavy chain 1, axonemal OS=Mus musculus OX=10090 GN=Dnah1 PE=1 SV=1)

HSP 1 Score: 2748.38 bits (7123), Expect = 0.000e+0
Identity = 1594/3942 (40.44%), Postives = 2351/3942 (59.64%), Query Frame = 3
            Y+ L + E++++    PN+  +SVP    E P+  Q    KE        T   ++  LS    +  ++  +S+ +   S    L +  +I  Q   +   +L++SW+   +  +  S+  +        E+      M ++R   +    +  +  + LRF+V++S+  F +FI    D  C   E   D+  G  + N       N +  + L  D +  H    +  F+ I   L  + D  I +     +LE ++   I + G P    +L  +   E ++   E+LR  +       +   Q Y   +R  L     D S        Q    E   E      K K + D   SLP+ + +  F ++ + + Q L  + K L    L+ +         SIC ++ SI R++ ++  +  +L EL+++++ +   +L+ L+ ++ K       +  +   L TDD         W  +I+  +D       ++ E+        Q  F E L GL+  +  F+   ++  A E   E+ ++ ++L +C +     N  E +    + T Y +L  ++   +P+  LW +A  + +  + WMN P+  +DAE++E      +KT ++  K F   +       A  I+ ++E+FK  +P+IQ L NPG++ RHW+ +SN++  ++ P+ +   +  L M L  H+E + +V+  A KE+++E+A  +M+ +W  I+F+  PYKET   IL + D+   LL+DHIV T +M  SP+  PFE  IN W+  L   ++ L  WL  Q AWLYLEPIF S DI RQ+P+E  +++ ++  WR IM     + +V+NV     LL+ L+    LL+ +QKGL++YLE KR  FPRF+FLS++ELLEILS+TKDP  VQPHL+KCFE I++L F E+  IT M SAE EEVK ++ I+P      VE W+L+VE +MK S+ ++++ A+  Y  + R +WV +WPGQV +A    +WT +   A+++  +  +   +  +Q+S +V LVR + L  + R+ L A IV++VHA+DVV+KL+   V S  DF WISQ+RYYW        + D+L IR V  E  YGYEYLGN+ RLVITPLTDRCY TL GA+ L  GGAP GPAGTGKTET+KDL KA+A Q VVFNCSD LD+ +MGKFFKGLA +GAWACFDEFNRI++EVLSV+AQQI TIQ+A + ++E F+FEG E+ L  SC +FITMNPGYAGR+ELPDNLK LFR VAMMVPDYA+IAEISLYS GF EA  LA KI   ++L SEQLSSQ HYD+GMRAVK+V++AAG LKR+   + EE + L++I DVN+PKFL  D+ LF GI+SDLFP +++   DY  L + +        L+ V  FL K IQ+YE  +VRHGLM+VG +  GK+  ++ L+ A+  L  + +I   V     + ++NPK+I++G LYG FD ++HEW+DGI +   R  A +    +KW +FDGPVDA+WIENMNTVLDDNKKLCL SGEII++T    M+FE +DL  ASPATVSRCGM+Y+EP  LG  P ++ W+++ LP  +   +    + LF   +  S++F+    K  +   +  L  ++L+L          R   KK                      K+++  E+++          F  SL+WS GA  D  S++ F                ++ R K       L  P+ G ++D+                    KQ   W  W   ++      ++  T   NI++PT+DTV+  + L  +L N  KP++ +G TGTGK+  +   +L  LP  +++ H LTFSA+TS++Q QD   SKLD+RR+G++ PP  +  + FIDD++MP  E YGAQPP+E+LRQ +DH  W+DRK       + D+    AM  P   R A+T RL RHFN ++  E D+ + K IF  I++ W      E + +           L++ +V AT +++  + +  LPTPAKSHY FNLRD S+V QG L+ +   +++  Q      L+RLW HE  RVF DRL++ ED   F EL++  +E     +F V F               + +++GDF+    D               +K Y  IT E  + Q ++ Y+++YN ++ A + LVLF  A+ HI RI R LRQ  G++LL+G+GGSGR S  +LA+ + ++E FQIE+++ Y +S+WR+D+++++   G + +  TFLF D QIK   FLEDIN +LNSGDIPN++  +++             Q   ++ T  N+   +  RVR N+H+VL  SPIG+ F +RLR FPSL+NCCTI+WF  WP +ALK VA   L E+   E  ++V + ++ +C   HQSV+    ++   + R NYVTP SYLEL+  F  L+ +K+ME+ T+K R   GL+KL  +   ++ MQ EL+  +P L E +K+T   ++ I+ +T   E+ RK V+ EE     KA  A++I DD + +L EA+P ++AA+ +L  L +ND++ V+AMQ PP GVKLV+EAVCI+KG+KP+K   +  G  ++DYW   K LL D  +FL+ L  +DKD I EA ++ I+  YI+N  F P  I  +S AC  +C WVRA+  Y  + K V PK++ L  A+   +     L+  +  L+EVE  +A +Q  ++    +K +LE   E  + ++ RA+KLI GL  EK RW + + +L    DN+ GDVL+ AG VAYLGPFT  YR    E W N+     +P    S  +L + LG+PV++R WQI GLP D+ SV+N VI   + RW+  IDPQGQANKWIK +E E + L+V KLSD+ +LR +EN ++FG PCLLENVGEELD  LE VLLKQT+KQ     ++LGD V+ Y +DFR YITT+L NPHY PE S K+TL+NF ++P+GLEDQ+LG V A+E+P+LE+ + QLI+ +A  R++LK+IEDQIL  LS+S+GN ++D + I++L +SK+ + +I  K   A +TE +I+  R  Y PVA    ILFF +SDLA++DPMYQYSL WF+N+++  I NSE + +++ R+ N+N + T ++Y N+CRSLFEK KL+F+FLLC+ I   + K+++  WR+LL+GG S+ +  +NP P WLS+++W ++  LSNL  F  +  DFVM + ++++I DS  PH E  PG W   L   ++L+++RCL  +KV  A+  ++   L   ++EP   +L   FKES+S TP+IFVLSPG DP +DLY+FAE    S      +SLGQGQGP AE+ +  S++   W+  QNCHLA SW+P L ++ E   +   +++ +FRLWLTS PS+ FPV++LQN  KMT EPP+G++ANLL+SY +  +SD DF  + ++   F+ LL SLC FH    ERR +G +G+NIPYEF D DL+I I QL+MF+++YED+  + L Y  GE NYGGRVTD+ DRR +M++L   Y+  +L SE    + SG Y     T DLN YL++IK  P N  PE+FGLH NA +   Q ET  LF +IL   PK  S   +S + ++ED+A +IL ++P   +++E+  K+PVLYEE MNTVL+QE+IR+NKL+EVI ++L D+  A++GL++M   LE +  S+    VP LW   +YPSLKPL S+I DL+ R+ F  +WI++G P  FW+SGF+F Q+FLTG LQN+AR+   +ID + FDF+++     E  +    G +IHGL+LE  RW   +  L ES  K LY  + VI +LP     +  ++ Y CP+YKT  R G LSTTGHSTNYV  + +PS+Q  +HWI RG+A +C L+
BLAST of dynein heavy chain 3, axonemal vs. TrEMBL
Match: A0A2R2MQX7 (dynein heavy chain 3, axonemal OS=Lingula unguis OX=7574 GN=LOC106174593 PE=4 SV=1)

HSP 1 Score: 4489.87 bits (11644), Expect = 0.000e+0
Identity = 2290/4005 (57.18%), Postives = 2984/4005 (74.51%), Query Frame = 3

HSP 2 Score: 70.8626 bits (172), Expect = 1.101e-7
Identity = 28/71 (39.44%), Postives = 48/71 (67.61%), Query Frame = 3
            + + +  +N+FE +HRP ++  HLPPLS+    Y+++PK++ +G WT A P +++K  + +S SI  NYSP
BLAST of dynein heavy chain 3, axonemal vs. TrEMBL
Match: V3ZCU1 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_125424 PE=4 SV=1)

HSP 1 Score: 4445.57 bits (11529), Expect = 0.000e+0
Identity = 2289/3944 (58.04%), Postives = 2968/3944 (75.25%), Query Frame = 3
BLAST of dynein heavy chain 3, axonemal vs. TrEMBL
Match: W4ZLH0 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 4347.35 bits (11274), Expect = 0.000e+0
Identity = 2243/4006 (55.99%), Postives = 2932/4006 (73.19%), Query Frame = 3
BLAST of dynein heavy chain 3, axonemal vs. TrEMBL
Match: A0A1I8J3K8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 4240.26 bits (10996), Expect = 0.000e+0
Identity = 2187/3883 (56.32%), Postives = 2840/3883 (73.14%), Query Frame = 3
BLAST of dynein heavy chain 3, axonemal vs. TrEMBL
Match: A0A0L8FUX5 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22007301mg PE=4 SV=1)

HSP 1 Score: 4227.94 bits (10964), Expect = 0.000e+0
Identity = 2167/3913 (55.38%), Postives = 2877/3913 (73.52%), Query Frame = 3
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Cavefish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 3358.93 bits (8708), Expect = 0.000e+0
Identity = 1819/3934 (46.24%), Postives = 2552/3934 (64.87%), Query Frame = 3
            +N    V+++    IL +  +   +  + P   S V  L    PWH   ++S++ ++K  +  H  +  +L      + +L L+ +     S P+S   L        ++    L N+W      +L S  D+++ I          +++ F+NC +TL SN L+ +V  S+  FV                +LF  ++   +  + R++L  +      + F PSF  + + + +I  +I  ++ +   +++ L            +  +  + E  + N       V  N EAP ++ Q Y+N + +L+N+T +D   +FI  +     Y   +EK ++LS E +SLP+     +  LDCE + Q L  +++    I L  + N  R     IC ++++I ++  K+ ETT  ++E+  Y+   RT  L  L  K+ +  +   +LL+      +D+ LN+    W   I PI D +   L + +++   +L+  +++ +  L  L  +++EF + ++L+   +   E+  + + L E  +    IN+EE L     QT Y ++  +    EP+ K++   + + +   +WM+G  L+++ E +EAE    ++  Y++ K F                           H E    + C   I+ ++++FK ++P++  LCNPG++ RHW+ MS  V  D+TP   T L  +L   L  ++E    +S+ ASKEFSLEKA   M   W  I FS   ++E+GV+IL  VD+IQ +L+D IVKT TMR SPFI PFE EI  W++ L R++D ++ WLKVQA WLYLEPIF S DI +Q+P EG  F+ VD+ WR +M     D KV+       LLE LQ S  LLEQI KGLN YLEKKRL+FPRFFFLSN+E+LEILSETKDPLRVQPHLKKCFEGI+KL F     I  M S+E E V+    I   EA G VEKW++QVE  M  S+R+V+ ++   Y +  R QWV++WPGQVVL  S ++WT++   AI+S    L+ +  +   Q+  IVELVR + L    R TL A + +DVHARDVV +++   VS E DF W++Q+RYYW        +NDN+ + ++  +V Y YEYLGN+ RLVITPLTDRCYRTL+GA  LNLGGAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY +MGKFFKGLA SGAWACFDEFNRIELEVLSV+AQQI  IQRAI  +LE F FEGTELRL+ +C + ITMNPGYAGRSELPDNLKVLFRTVAMMVP+YALIAEISLYS GF+ A+ L+ KIV  YRLCSEQLSSQ HYDYGMRAVK+VL AAG LK K     E+ ++L+SI DVN PKFL  DIPLF+GI SDLFPG+  P  DYQ       E  +   ++PV  FLDK+IQ YEM++VRHG M+VG+ F GKT     L+  L  +N +  N E  V +  +NPK+I++G L+G+FD VSHEW+DGI+A TFRE+AS+E+ +RKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQM+N+ ++IFE  DL QASPATVSRCGMIYMEP QLG  PL+  W+   LP+ L  ++ +T+ L LFNWLIPP+L  + + C+  V   +   V ++ +L+  LL +                                 E    K  RT +++A F  SL+WS G   D+DS+ +FD F R   E+     +++P P  +   +C  N     KG ++D+ +  K  GCW  W   I+   L +  K T++ +I++PT+DT+    F T I+  +  +P++FVG TGTGKS  +K  ++++L  + +L   + FSA+TS++Q Q+   ++LD+RR+G++ PP  K  ++F+DD++MP  E +GAQPP+E+LRQ  DH  W+D KD + + + DV + SAM  P   R AVT R LRHFNI +++ F D+TM  IF  ++ ++  N+ F      +   IV AT ++++  M + LPTPAKSHY FNLRDFSRV+QGCLLLK   L+N         +IRL+VHE +RVF+DRL+  +D D  ++L+K +V+  FKE F  +F     ++ +    +MR L+FGD++             T   E   +LY E+   E+  Q ++ YL EYN   K  M+LV+FR+ +EH++RI R+L+QP G++LLVG+GGSGRQS  +LATF+ D  +FQ E+++ Y +++WR+D++ L++  G KG +T FL  D QIKE  FLED++ +LN+G++PNLF   E ++ +E++  ++ I Q  N  +E + + ++  F+ R R+NLH+V+ FSPIGDAF +RLR FPSLINCCTINWFQ WPE+AL+ VANK L+ +E+    R++++++C+ FH S   LS+KF   +GR NYVTPTSYLELI  F  LL  K+  ++ +K+RY+ GL+KL F+E+Q+  M+ EL   QP+L +   +  K++++IE E+V+VE   KVV+ EE     KA +A+++K++CES+LAEA+P + AA+ ALDTLK +D++IVK+M+NPP GVKLVM AVC++K +KPEK  DP+G  + + DYW  +KKLLGD+ FL  LK YDKD IP   M KIR +Y+ NP FDP K+   SSA EGLC W+ A+EVYDR+ KVV+PKK  L VA+      MA L  K+ EL EVE +LA L++  + K +E+  L+  ++L   K+ERAEKLI GLGGEK RW K   DL   +DN+ GDVL+ AG++AYLG FT G+RQ C + W   CKS +IP  S   FSLS  LGDP+++R W I GLP DSFS+DN VIV+++ RW L+IDPQGQANKW+K  E E N L VIKL+D  Y+R LENC+QFGTP LLENVGEELD  LE +LLKQ FKQ  ++ IRLG+ V+E+S DFRFYITT+LRNPHYLPE + KV+L+NFMITP GLEDQ+LGIV AKE+PELE+ R  LI++SA+N++QLKEIED+IL+ L +S+GNILEDE AI+IL S+K++S +IS KQ+ A KTE +I   R GY+P+A H SILFF+I+DLA++DPMYQYSL+WF+NLYI+SI++S  S  +E RL+ L +HFT  +Y N+CRSLFEKDKLLFSFLLC  +   + +++   + FLLTGG+ L +   NP P+WL +KSW+E+   S+L   +G       +   +  I DSK P+    P  W ++LS  +++++ RCL P+K+ PA+ +YI G LG ++VEPP FDL  S+ +S+S  P++FVLSPG DPM+ L +FA  KN+   N K +SLGQGQGPIA   I  ++K   W+ LQNCHLA SW+  L KICE+        +P+FRLWLTSYPS +FPV +LQN VKMTNEPP GLR NLL+SY + P+SD  FF A S +  V+EKLL+ +CFFHA+VQER+ +G +GWNIPY FN+SDL+ISIRQLQ+F+N YE+V  EA+TYLTGECNYGGRVTD+ DRRL++++L   Y+K+++ +  +  + SG Y  P   S    Y+  I+  P    PEVFG+H N +++K+ Q+T  LF+S+++T       G S    + + D+A+DI +KLP+ F I+    K+PVLYEE MNTVL+QE+ R+N L   IR SL +L  A++GL++M   LE +  S+++GKVP  W++ SYPSLKPLGSYI+D + R+KF Q+W D  +P+ FW+SGF+FTQ+FLTG +QNYAR+    ID L FD+ ++     +   ++G ++HGL+L+  RW  +   L E H KVL+D +P+I I P            HC  +     T+ R+G LSTTGHSTN+V +I LP+S+  QHWI RG+A LCQL++
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 2237.61 bits (5797), Expect = 0.000e+0
Identity = 1314/3714 (35.38%), Postives = 2102/3714 (56.60%), Query Frame = 3
            S+  + F P+  ++   +  I   +I ++S F RL ++L  K         + +++  +E +   +  +   +  N+     Y + +   R +  +NK +    +Q +N    +  +++++ +   +++      T L +   +LDC  +   L+    + +  +   ++  +    + + +       RL++  +T  +LVE  + +E L+ G+L  ++ ++         L  Y +    ++  LL      W      ++DS    L K +++  + L    ++F + +   +  +++FN        V +E  L++++    +L    EE+  I     +  T   T     +++  +++  D   ++W+ +  +   +D+W  G    +  E +E+  Q+++K   +L++     +++         K ++E+FK  +P+I  L +P ++ RHW+ +  ++   FD     +  L  ++A+GL++H E + E+S  A KE S+E++   +   W+E      PYK+ G       +++   LED+ V  STM+ S F+  FE E++ W++ L  + + +   L VQ  W+YLE IF   DIR+Q+P E  +F+ ++  W+TIM+++  D+  +       LLE L    + LE+IQK L+ YLE KR  FPRF+FLSN++LLEIL ++++P  VQPHLKKCF+ I  L+  +    ++   GM SA+ E V+F +   P+  EG VE W+  VE  M+ +L++ ++   T   +++  R +WV+DWPGQ+++ AS + WT   T  +           L+   KK    +    + +R  NL  ++R+ + A + ++VHARDV+ KL  +     + F+W+ Q+R YW  ++      D+ +IR   T   YGYEYLGN+ RLVITPLTDRCY TL  A+ L+ GG+P+GPAGTGKTET KDL K +    +V NCSDGLDYKSMG+ + GLAQ+GAW CFDEFNRI +EVLSV+AQQI +I  A+   L  F+FEG ++ L  SC IFITMNPGYAGR+ELPDNLK +FR ++M+VPD  LIAEI+L+  GF   + LA K+  +Y L  +QLS Q HYD+G+RA+ S+L  AG+ +R    + +E ++L S+ D+N+ K    D+PLF+GII DLFP VE P IDY  L   + E L    L+  P+ + K+IQ+YE    RH  MIVG++   K+  ++ L  AL  ++++     +++ +  +NPKA+S+G LYG +D  ++EW+DG+L+   R   + E  + KWI+FDGPVD +WIE+MN+V+DDNK L L++GE I M  + +++FE EDL  ASPATVSRCGM+Y +   LG  P ++ WI +     +D  +R     LF+  I  ++ F    CK  V    L  V ++ +LY SL      V                        N   NEN          +   F  SLIWS                    C   D   +K  +  N         P K TI+++    K      TW S  +K P           + I++PTVDTVR  F +  ++  G+ P++  G  GTGK++V ++ +L  L    +   ++  S+QT+S+ VQ    S++++R +G Y P   K ++ F+DD++MP  + +G+QPP+E+LR  ID+ FW+DR+     +  D+ + ++M  P   R  ++ RL   FN+I +    +  +K IF  +++      F+  +K +  ++  AT +++ ++ A FLPTPAK HY+FNLRD S+V QG  LL+S    +    D+   + RLW+HE +RVF DRL+   D + F  L+         EK   LF D +  N  P     ++ +FGDFLK                  E  +Y ++ D +AL   M+  L++YNL     PM LVLFR AIEH+ R+ R++ QP G+ LLVGIGGSGRQS ++LA +IC++ +FQ+E+T+ Y   ++R+DI++L R TG     T FLF D QI +  FLEDIN +L+SG++PNL+++++      +       +   +  TA  M+N  IERVR NLH+VL  SP+G+ F +R+R +P+L+NC T++WF  WP+DAL  VA + LD + +   + ++ K+  +    HQSV+  S++    + R NYVTPT+YLEL+  +  LL +K+ E+     +   GL K++ + +++  M VEL+  + ++ E  K+ E+ + +I  +  E ++ +  V         +    K++ ++ + +L EA+P +  A++AL++L + D++ +K+   PP  V+ VM+AV IL+G +P              W  AK+ LG+  F+  L  +DKD I +  ++KI  QY   P F P  I  +S A + LC+WVRA+EVY RI +VV PK+ +L  A +    + A L   +++  EVE KL +L+  +  K  +K DL    E  ++K++RA KL++GL GE+ RW + +  L      ++GD LL A  ++Y+GPF   YR+E +  +W  + + + +P S    F+    L  P  VR+W I GLP D+FS +N VIVT  NRW L++DPQGQA KWIK +ES+R  L+VI L    +LR+LEN +QFG+P LL+NV EELD  L  +L K          ++LGD  VEY+ DF+FYITT+L NPHY PE S K T+VNF +   GLE Q+LGIV  +E+PELE+++  L+I  AS +R+L+E+ED+IL++L+ + G++L+D + +  L +SK+ + ++S + E + +TE +I+  R  Y+P A   SILFF ++D+  +DPMYQ+SL  +I+L+  SIE S+ S  +E R+ NLN + T AVY+  CR LFE+ KLLFSF +C  I +   K++   + F L GG+ LD   +  NP   WL++ +W+ +  L  L  F G +  F    + W     S  P     PG+WE   + L++++++R L  ++V   V S+I+  LG  +VEPP  D++   ++S + TP+IFVLSPGVDP   L + AE   + P+    +SLGQGQ PIA   I E +K+ +W+ L NCHL+ SW+P+L K+ E+L ++ S  +P+FRLWL+S P   FP+ +LQ  +KMT EPPKG+++N+ R Y    +  E  F    RP V+ KLLFSLCFFH+++ ER+ +  +GWNI Y FNDSD ++S   + +++++YE++  +AL YL    NYGG VTD+ DRRL+ + +   + +  + +  F L+   TY +P   S  ++Y  +I++ PP   PEVFG H NA++A +  ET  LF+++L   P+  S    G   S +  + ++++D+  K+P++   E       +L ++   +N VL+QE+ R+N L+  IR SL +L+  ++GL++M ++LEE+++ +   +VP LW + +YPSLKPL S+  DL  R++ F +W +   P   FW+SGF F   FLT VLQ+ AR++  ++D L ++F +    + +   P  +G FI GLYLE   W  ++  L+E+    L   +P I+  P        +N Y CP Y    R G         ++V  + L S  +  +HWI RG A L  L++
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Cavefish
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 1748.41 bits (4527), Expect = 0.000e+0
Identity = 1150/3404 (33.78%), Postives = 1846/3404 (54.23%), Query Frame = 3
            +L  C EE  K +  +++L+ +  +   P     E+L ++     L +    +     +W     + ++ + ++  T+   K+  +L      P+    M  A  ++ ++++FK +LP++  L N  L+ R+      ++           L D   +G  + ++++++                     W+ + FS   Y    +E G  IL +VD+IQ  L+D+ V   +M  S FIGPF + I  W+K L  + + +  W+ VQ  W+YLE IF   DIR Q+P E  +F+ +D+ ++ IM+    D  +       N L DLQ+    LE+ QK LNDYL+ KR  FPRFFF+S++ELL IL  + +P  VQ H+ K ++ I+ L+F      ETV   ++SAE E ++      P+ AEG VE W+  V   M+ + R + K+A+  Y Q  SR  W+ D+ G VVLA + V WT       Q  ++ +   ++++ KK  QQI ++V  +  + LK   R  L   +++DVHARD+V   +   ++   +F W SQ+R+YW      +   D+L +R  + E  YGYEY+G   RLVITPLTDR Y TL  A+ + LGGAP GPAGTGKTE++KDLAKA+   CVV NC +G+DY ++GK F GLAQ GAW CFDEFNRI+  VLSVI+ QIQTI+ A+  QL+ F FEG E+ LD    IFITMNPGYAGR+ELP+++K LFR V ++VPD   I EI L+S GF+ A+ LA K+  +Y+L  EQLS Q HYD+G+RA+KSVL  AG+LKR    L E+ V+++++ D+NLPKF+  D+PLF G+ISDLFPG++ P + Y +    +   L   K   +P  +DK++Q+YE ++ RH  M+VG +  GK+     L  A   LG L K            +NPKA+S+  LYG  D V+ +W+DGIL+  FR+ +  ++  ER++I+FDG VDA+W+ENMN+V+DDNK L L +GE I++ N   ++FE  DL+ ASPATVSRCGM++++P  L   P  + W+    P+     ++  ++ LF   +P  ++ +         G K K+ V    L +V  +    S +LD                               +    ++  EE   F I   + SL     A+L+   K   D   +  C ++    +    P  +       +P   T+FD  F    KK    W  W SL+ K    PD       T+  +IL+PTVDT R  + L +++K  R P++ VG +GT K+A  + F L++L N DF +  ++ FS++T+S  +Q S  + +++R +  Y PP  K+L+VF+DD++MP  ++YG Q P+ +L+ L+D    +DR K+     ++D+   +AM      R  V SR +  F++  I   ++E +  I+  I+  H    FE  ++ +   +   T +++++++    PTP+K HY+FNLRD SRV  G      + L N  +  +  + +R+W +E  RVF+DRLI+  D  L    IK +++  F  +                ++ MR  ++FGD+              T   E E ++Y +I D +A     Q  L+EYN  +K  M+LVLF  A++H+ R+ R++R   GH+LLVG+GGSG+QS  KLA F    ++F+I ++R YS S++R+D++ L    G +   T FLF D  + E  FLE IN +L SG +P LF ++++  ++ +++    +        ++  Y  FI +   NLH+VL  SP+GD   +R RNFP L+N   I+WF  WP  AL  VA   L E  +      + VI  +C   H SV + S  F + + R NYVTP +YL+ I T+  LL  K   I+   +R   GL+KLE +  Q++ +  +L   +  L E S   E L++ I T T   E+ +K+ +E+      + +     K D ES+LAEA+P + AA  AL  L ++D++ +++   PP  V++V E + +++G K            E  W TAK ++ +  FL  L   D D+I    ++ +R  ++ N      +++ IS A  G+  +V AV  Y  + + + PK+EK+A  E  +     +L+  Q EL  ++ +L  L E +     EK  L+   +L + ++  A+KLI+GLG E  RW + + +L  +   ++GD L+ A  ++Y G F   +R E V E+WQ +     IP+S         +L D V +  W    LP D  SV N ++ T  +R+ + IDPQ QA  WIKK E + N L++   +D  +L+ LE  +++G P L ++V E +D V+++VL K        + I LGD  V+Y  +F+ Y+ T+L NP Y P    K  ++N+ +T  GLEDQ+L ++   E+ ELE++R +LI E++ N+R LK++ED +L+ L+TS GN+L++ + +  L  +K  + ++  K + A  T  +I+ +R+GY+P A  G+ILFF ++++A ++ MYQYSL+ F+ ++ +S+  S  +S +  RL N+ +  T  VY   C  LFE+ KLLFSF + I I + + +  +    F L G +SL+  ++    DWL ++ W ++  L+ L P  F   ++D   N ++WK+  D  +P    FP  + + L+  ++L+++RC   ++V  AV  Y+   +G +YV+PP    E  F++S   +PI+F+LSPG +P +DL + AE        LK +++GQGQ  +A   +  ++    W++LQNCHL   WL +L K  E +    ++ +P+FRLWLT+ P   FP+ +LQ S+K+  EPP GL+ N+  +Y    +   +   +   P  +  L++ L FFHAVVQERR YG IGWN+PY+FN+SD  + +  L  ++    +     +   +L YL GE  YGGR  D+ DRR I+++    Y  + +     P      +   Y +P   S    Y+  I+  P    PEVFGLH NAE+    Q    ++  ++   P+   SG   S    I  +A DI +KLP  F ++ I  K  P +     + VL+QEL RFN+L+  + +SL +L+ A+ G + M + L+EV R++  G++P++W + +  +LK LG+++     R + + +W++ G+P   W+SG +  +S+LT ++Q   RRN   +D+      +       E ++   +G ++ GLYLE   W VE   L+ S  K L   LP++ ++P     +  +N+   PVY T+ RR  +         VF   L +++   HW+ +G+
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Cavefish
Match: DNAH11 (dynein axonemal heavy chain 11 [Source:HGNC Symbol;Acc:HGNC:2942])

HSP 1 Score: 1496.1 bits (3872), Expect = 0.000e+0
Identity = 1020/3147 (32.41%), Postives = 1627/3147 (51.70%), Query Frame = 3
            F +++      L R +  L  WL+VQ  W +LE +F GS DI+ Q+P++   F  ++  ++ +M K      V+       LLE L+  +  L   +K L  YLE KR+ FPRF+F+S+ +LL+ILS    P +V PHL K F+ ++ L F++E T   G+ S E E +    D    +  G VE W+ +VE  M+  +R  + +A+  Y +  R  W  + P Q VL AS + W      A +  T      L ++ KK   Q++S++ ++  E L    R  +     LDVHARDVV++L+  +VSS   F W+SQ+R+ W  + K      +   ++  T+  Y YEYLGN  RLVITPLTDRCY TL  ++ LN+GGAP GPAGTGKTET+KDL +A+     VFNCS+ +DYKS+G  FKGL Q+GAW CFDEFNRI +EVLSV+A Q++T+Q A+R +   F+F   E+ L  S  +FITMNPGY+GR+ELP+NLK LFR  AM+VPD  LI EI L + GF+ A+ L  K + +Y LC E LS Q HYD+G+RAVKSVL  AG+L+R  +   E++V+++++ D N+PK +  D+P+F G++ DLFPGVE       D   ++ +    +KL+P   F+ K+ Q+ E++ VRH + +VG +  GK+   + L           N +   +++ +NPKA+S   L+G     + EW DG     F    S E                W ++        ++ C +S                  L  ++PATVSR G++Y+ P  L  +  +  WI        D  QR T +     L    +     + ++  K  +L    +M+Q   SLLD +                             +T EN  +   R  + + +F  + IW+FG    +D    +   F          +Q +     +K  +++ +P   T+FD  ++  Q   +  W   +    L+       +  +L+PTV+TVR ++FL  +L  G +P+M VG TGTGKS++I+  +LD+LP+ DFL  S      TSS  +Q      L++R    Y PP  + LV FIDD++M   + YG   P  ++RQ +D+  W+D +     LII    I  A   P A    +  RL RHF+++ ++    ET+  IF PI+  H  N  F  ++  +   +V A   +  +   HFLPT     +VF+L D SR+ QG L  +   +K   +      L++LWVHE+ RV+ DR     D +LF++L                     TD  R    +   L         ++P   L  G  + E    +Y  +   E L   +   L  YN +  + M+LVLF+ A+ H ++       P+ H++  VG+GGSG+QS  +LA    + ++FQ  + R Y + + + D+  L   TG K + T  L  D QI +  FL  ++ L+ SG++P +   E+            + + + +  T  N +  F ERVR+ L +VL  SP+G++   R++ FP+L++C T++WF  WP+ AL  V+   L E+  I+  V+E I +   H H S     +++ +   R  Y TP S+LEL++ +  LL ++   +     R   GL+KL+ +  Q+  ++ +L + +  L   +   E LI  I  +T  V + R+    EE        +    + DCE++LA+A P + AA  AL+TL + +++ +K   NPP  V  V+ AV +L          P G++  E  W  A+  +G +  FL  L SYDK+ IP+  +  ++ +Y+++P F P  +   S A  GLC W   +  Y  +   V+PK++ L+ A +   +  A+L   + +L +++  L  L   F+    EK   +  +  T   I+ A +L+ GL  EK RW + + +L  +   + GDVLL A  V+Y G F+  YR++ +E  W+   + +S PV          +L D   V  W   GLP D  SV+NA I+T + R  LL+DPQ QA KW++ L      L +++   KGY+ ++E  L  G   L+EN+ E+LD VLE +L + T  +++   + LG    +     R  + T+L NPH+ PE   + TL+NF +T  GLE+Q+LG V ++E+P+LE  + +L I+    R +LKE+ED++L  LS ++G+ L+D   +E L  +K  +  I  K   A + E +IN  R  Y+PVA   ++L+F I +L S++P+YQ+SL  F  +++ +IE++E   D+  R+++L    T +V Q+I R LF++D+L F       + + +G  +V+EL     L    S  SP       +LS ++W  +  LS LE F G  +D   + ++W+ +V+S+ P  E+ P DW+++ S +++L+++R + P+++  A+ +++   LG EY++    + E  F+ES S++PI F+LSPGV+P++++         S    NL  VSLGQGQ  +AE  +  +    +W+ILQN HL   WL  L  + E   L     +P +R++LT  P+      + P  +L+NS+K+TNEPP G+ A+L  + +     ++D  + S   Q F+ LLFSLC+FHA V ERR +G  GWN  Y FN  DL IS   L   +     V  E L YL GE  YGG +TD  DRRL  + L  +++ +L   E F        L P   +    D   Y  ++    P   P ++ LH NAE+      ++ LF ++L   P++ +   +S Q++   + D    +L KLP+ + + E+  K        +  V +QE  R N LI  +  SL++L  A++G + +   +E +  ++  G+VP +WS+ ++PS K L  + SD++ + +    W  D   P   W+SGF+  QSFLT ++Q+ AR+N   +D++    D       +Y  P  EGA++HGLY++  RW      L E+  K L   +PV+ I       +  +N+Y CPVY+T  R   L         ++   L +      W+  G+A L
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Cavefish
Match: ENSAMXT00000016172.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:1379218:1548247:-1 gene:ENSAMXG00000015711.2 transcript:ENSAMXT00000016172.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1115.91 bits (2885), Expect = 0.000e+0
Identity = 711/2171 (32.75%), Postives = 1148/2171 (52.88%), Query Frame = 3
            + +  P +GT+FD+ ++  +   +  W  ++ + ++D  I    +   L+ T +T+R  +F+ R+L+  R+PIM VG  GTGKS ++    L SL    +   ++ F+  T+S  +Q      L+++    Y PP  K L+ FIDD++MPE + YG   P  ++RQ +D+  W+DR       I  V   S M  P++    +  RL RHF++ A+     + +  I+  I+  H +  GF   +++    +V    D  Q V A FLPT  K HY+FNLRD S + QG L  KS  +K  T +D    L+++++HE+ RV+ D+++  +D   F +L  ++V            G F  D +          M+  F     +P                 Y  +   E+L +T+   LD YN ++ A M+LVLF  A+ HI RI R+L  P G++LLVG+GGSG+QS  +LA FI   E+FQI + + Y ++D + D+  L    G K I T FL  D Q+ +  FL  +N LL SG+IP+L+ +++            + +   +  +  N +  FIERVR+ L + L FSP+G     R R FP+++NC  I+WF  WP++AL+ V+ + L EVE I+ +V++ +     + H SV+  SK +     R NY TP S+LE IK + NLL  K+ ++    ER   GL+KL  +  Q+  ++ +L A +  L + +++ ++LI+++  ET +V + + V  EEE      A      + DCE +LA+A P + AA EAL+TL +N+++ +K+  +P   V  V  AV +L          P G++ +D  W  AK ++  +  FLD L +++K+ I E  ++ I+  Y+ +P F P  +   S+A  GLC WV  +  +  +   V PK++ L  A +   +   +L V + ++  +   LAKL   F+    +K   +   E T   I  A +L+ GL  E  RW + +++   +   + GDVLL    V+YLG FT  YR E ++  W+     + +P+         S+L D   V  WQ  GLP D  S +NA I+TS  RW L++DPQ Q  KWIK      + L+VI++  +GYL  +E  L  G   L+EN+ E +D VL  +L ++T K+    YI++GD   EY+  FR  + T+L NPHY PE   + TL+NF +T  GLEDQ+L  V + E+P+LE+ +  L  +    +  LK +ED +L  LS++ GN L D + +E L  +K  + +I  K + A  TE +IN  R  Y+P A   S+L+F ++DL  + PMYQ+SL  F  ++  ++  +     ++ R+ NL    T +V+Q   R LFE DKL ++  L   I     +++    + + R+ +  G++      +PV D+LS  SW  +  L +++ F+   +D   + ++WK  V+ + P  EKFP +W+ + S L++L ++R L P+++  A+  ++   LG +YV   + D  +SF+ES + TP+ F+LSPGVDP+ D+ +       +    N   VSLGQGQ  +AE  +  + +  +W+ILQN HL   WL  L K  E+     S+   NFR+++++ PSS     + P  +L+NS+K+TNEPP G+ ANL ++       ++D  +   R   F+ +LFSLC+FHAVV ERR +G  GWN  Y FN  DL IS+  L  ++     V  + L YL GE  YGG +TD+ DRRL  + L       +   EL L+  FPL  +  Y         N Y  +I    P  +P ++GLH NAE+    Q + +LF ++L   P++     G   S    ++ +  + L KLP+ F + E+  K  V        V +QE  R N L + I++SL +L   ++G + M N +E +  ++ + +VP  W++ +YPS+  L  + +DL+ RI+  ++W  D   P   W++GF+  QSFLT ++Q+ ARRN   +DK+     +++ +  ++S P  EGA++HGL++E  RW  +   ++++  K L   +PVI I           N Y CPVYKT  R            YV+T  L + +    W   G+A L Q+

HSP 2 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 406/1094 (37.11%), Postives = 611/1094 (55.85%), Query Frame = 3
            +E+  +KE +D +  S V F+   + W   P  E++ EE+E E +   K    L K      +       +T+K  L     +L  I  L NP ++ RHW  +    G   +   +      L      H ED +  +  +A KE  +EK    +   W  + F +  +  T V +L + +D+   LED+ V+   + +S  +  F  E++ W K L      ++ W +VQ  W +LE IF GS DIR Q+P +  +FE +D  ++ +    +K  N  +  N     + LED+Q   AL E   K L +YL+ KRL FPRF+F+S+ +LL+ILS   DP +VQ HL K F+  +K+KF  +          GM S E E V F     P +  G VE W+ +V   M+ ++R  M +A+  Y    R QW+ D+P QV L  + + WT     A         + ++E+ KK   Q+++++ ++  + L    R  +     +DVHARDVVAK+++ +V +   F W+SQ+R+ W    K   +N      +   +  Y YEYLGNT RLVITPLTDRCY TL  ++ L + GAP GPAGTGKTET+KDL +A+     VFNCS+ +DYKS G  +KGLAQ+GAW CFDEFNRI +EVLSV+A Q+++IQ AIRD+ + F F G E+ L  S  IFITMNPGYAGR+ELP+NLK LFR  AM+VPD+ LI EI L + GF+EAR LA K + +Y+LC E LS Q HYD+G+RA+KSVL  AG LKR      E++V+++++ D N+PK +  D+P+F G+I DLFP ++ P     D  + + E +  +KL+    F+ K++Q+ E++ VRH + +VG +  GK+   K+L+          N++   ++  +NPKA++   L+G  +  + EW DG+ +   RE A+      KWI+ DG +D +WIE++NTV+DDNK L L S E I +     ++FE   L  A+PATVSR G++Y+    LG +P +  WI +   +     ++  + +LF+  +P  LD +  + K  +      +V  +  L   LL
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001140.1 (pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 gene:ENSPMAG00000001005.1 transcript:ENSPMAT00000001140.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2188.3 bits (5669), Expect = 0.000e+0
Identity = 1228/2811 (43.69%), Postives = 1745/2811 (62.08%), Query Frame = 3
            + + ++  SVKKAI+D++L    NK  +KR  L  P++  + VL +  PW  +   ++  LQ+  +  +  ++ +L  +   Y +LRL+++E I   T  L L+   ++  ++     + L + W+ + + I   S  + + ++P+  +  +  +  +FNC A L +++L+ +  NSI +       Y D++C            V +   +LR+ L+ D      + F P F      L  + D ++ +++   R+E  L+    +    T   P +L      E +   +  +R  +   S  P ++ + Y  F  L+    E    +F++ +    ++E  +   + LS     S    + + +F L C+ +   L  R++ L    L  M+ + + F + +C +++SI  +       T  L+EL+EY++K+   E+  LQ KL +A   +LFLL++  L   ++  NNT F W  R+  I       LT++ E+    L+  +++F E+L     Q +EF+    L D  +  ++   +  KL    E  +  N EE   +    + Y Q ++I  +  P+ +L++ AV F   +  WM GP+ +V+ + VE +  + W+  Y+L +   + P+    +     +K+ +E F+ +LP+ Q LCNPGL+ RHWDA+S  VGF +  +    L   L M L+  L    ++S  ASKE+SLEKA  +M  +W E+ F+   Y+++G +IL  VDDIQ+LL+DHIVKT TMR SPFI PFES++  W++ L  L++ L+ WLKVQA WLYLEPIF S DI  Q+P EG +F  VD+ WR ++ +   D+ V+ V+  D +LE LQ S  LLE I KGLNDYLEKKRL+FPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGIS+++FTE   IT M S+E E V+    I   +A G VEKW+L++E  M  S+  V+ +A+  Y    R +WV+ WPGQ VL  S   WT +   AI+     LE +L + + QI  +V LVR + L    R+TL A +VLDVHARDV+  LL   ++ + DF W+SQ+RYYW         + +L  RM+   +PYGYEYLGNT RLVITPLTDRCYRTL GA+ L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGL   GAWACFDEFNRI+LEVLSV+AQQI TIQR I    +  +FEGTEL+L+ +C +FITMNPGYAGRSELPDNLK LFRTVAMMVPDYA+IAEI LYS GFV AR L+ KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     E+ ++L+SI+DVNLPKFL  D+PLF+GI SDLFPGV+ P  DY  L   + E    M L+   +F +KI+QIYEM++VRHG MIVG+ F GKTCA++ L+ ALGD+  K L  EN V   ++NPKAI++G LYG+FD +SHEWSDG+LA ++R  A+S S +RKW++FDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+ +  N+IFEP DLE ASPATVSRCGMIYMEP  LG  PL+  W+    P  L    +  +  LF  L+P  L F+ +  K         LV +++ L    +DD  +  K                       K  ++ ++     + ++   F  SL+WS GA      ++             ++   ++++   +N++      ++  P  G+++++ F+++  G W  W ++L   P +    +    ++I++PT+DT+R    L  +L   +KP++FVG TGTGKS  I  F+L  L    +   ++ FSAQT++ Q Q+    KLDRRR+G+Y P Q K +V+F+DD++MP +E+YGAQPPVE+LRQ +DH  W+D KD + + +E+V I  AM  P   R AVT+R LRHFN + I+EFDD++M  IF  IM WHF +   F      L++ +V +T +++++   + LPTP KSHY+FNLRDFSRVIQG CL L                + RLWVHE  RVF+DRL+   D       I+K +    KE F  LF   S  + +  + ++R LMF DF  +K D                K Y E++D E L   ++ +L+E+N +SK PM+LVLFRFAIEH+ RI R+L+QP  H+LLVG+GGSGRQS  +LA  + D E+FQ+E+++ Y+ ++WR+D++R++R + D      FLF D QIK+  FLEDIN LLNSG+IPNLF  +++  +    +     + ++ Q + + + + N F++R R  LH+VL  SPIGDAF +RLR FPSL+NCCTI+WFQ WP DAL+ VA + L++VE+ ++     + MC+ FH S   LS+KF     R NYVTPTSYLELI TF +LL KK++E++  K RY VGLEKLE + +Q++ MQ EL A QPQL+E   +    + +IE E+ EV +  +VVK +EA    +A  AK IKD+C+++LAEA+P++ +A+ ALDTL Q DI++VK M++PP GVKLVMEA+ ILKG+KP++  DP  SG+++ED W  AK+LLGD+KFL  L  +DKD IP A M+ IR +YI N  FDP KI+N S+A EGLC WV A+E YD++ KVV+PKK KL  AE+     M  L+ KQ+ L EV+ KLA LQ+  +  +Q+K DLEN +++   K++RAE+LI GLGGE+ RW +    L IR++++ GD L+ +GIVAYLG F   +RQ
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003955.1 (pep scaffold:Pmarinus_7.0:GL495754:4342:49943:-1 gene:ENSPMAG00000003592.1 transcript:ENSPMAT00000003955.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1558.5 bits (4034), Expect = 0.000e+0
Identity = 921/2213 (41.62%), Postives = 1302/2213 (58.83%), Query Frame = 3
            PW      +++ ++   +  HS L  +L        +  L+ +       PL L           +K  + L +SW      +      S E+             E F  CV+TL SN LR ++  +I  +V               +DL  G A+ +     R+ L  D  S       PS + +   +  +   I  S+     +   L        S P  + +   E+ +      L   V+ N + P ++ Q Y + + +L+N T  +  H FI+ D+   +    +E+ ++L  E   LP+ L   +  L C  + Q L+D+++    + L+ + N+ R  N  IC  ++ + +R  K  E + +++EL  YV+  R+  +  L  K+++  R + FLL+  IL  +DI  N+    W   I P  D +   +   + +  ++L   +++ +  L  L  ++  F + ++L+   +   ++  + ++L +  +    IN+EE+L    + T Y ++  I T  +PF KL+   + + +   KWM+G  LE++ E +  E +  ++  Y+  K F   + K     +  A  K + +  +  +   Q   +P +   + RHW  MS  V  DITP   T L  +L   L  +L+   ++S+ ASKE+SLEKA   M   W  I F+   Y+ETGV+IL +VD+IQ  L+D IVKT TMR S FI PFE+EI  W++ L R+++ L+ WLKVQA WLYLEPIF S DI +Q+P EG  F+ VD  WR +M   T D KV+       LLE LQ+   LL++I KGLN YLEKKRL+FPRFFFLSN+E+LEILSETKDPLRVQPHLKKCFEGI++L F     I  M S+E E V+    +   EA G VEKW+LQVE  M  S+R+V+ +A T Y    R  WV++WPGQVV+  S + WT +   AIK      L E+ ++   Q+  IVELVR  +L    R+TL A + +DVHARDVV  ++   VS+E DF W++Q+RYYW +E         + +R+V   V Y YEYLGN+ RLVITPLTDRCYRTL+GA  LNLGGAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY +M KFFKGLA SGAWACFDEFNRIELEVLSV+AQQI  IQRAI+ ++  F FEGTEL L+ +C + ITMNPGYAGRSELPDNLKVLFRTVAMMVP+YALIAEISLYS GF+ A+ L+ KIV  YRLCSEQLSSQ HYDYGMRAVK+VL AAG LK K     E+ ++L+SI DVN PKFL  DIPLF+GI SDLFPG+  P  DY        E      ++PV  FLDK+IQ YEM++VRHG M+VG+ F GKT   + L+  L  ++ +    E  V    +NPKAI++G L+G+FD VSHEW+DGI+A TFRE ASS++ +RKW++FDGP+D +WIE+MNTVLDD  +LCLMSGEIIQM+   ++IFE  DL QASPATVSRCGMIYMEP QLG  PL++ W+    P    ++ R  +Q LF WL+ PSL  + ++CK  +    L+L  N   QL  S +   R                              + N I        L A F  SL+WS GA  D D ++KFD F R   E+    ++ +P P  +   +C     + ++G ++D+++  K  G W  W  LI+ P L +  K T++ +I++PT+DT R  + +   +++ R P++FVG TGTGKS  IK  ++++L  + +L   + FSAQTS++Q Q+   SKLD+RR+G++ PP  K  V+F+DD++MP  EK+GAQPP+E+LRQ  DH  W+D KD + + +ED+ + +AM  P   R AVT+R LRHFNI  I+ F DETM  IF  +M ++  N+ F      +   IV AT ++++  M + LPTP KSHY FNLRDFSRVIQG LLL+          D    ++RL+VHE YRVFHDRL+  +D    + L + ++   FKE F  +F D   + +     +MRKLMFGD++    +P+ +          E +LY E+   +     ++  L+EYN   K  M+LV+F + +EH++RI R+L+QP GH+LLVG+GGSGRQS  +LAT +    +FQ E++++Y  ++WR+D++
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Sea Lamprey
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 1555.04 bits (4025), Expect = 0.000e+0
Identity = 861/2163 (39.81%), Postives = 1297/2163 (59.96%), Query Frame = 3
            K      +L+PT DT+R  + + ++L   +  ++F G TG GKS V +  +        ++   + FSAQTSS + Q+   SKL+++R+ +   P  K +++F+DD++MP+ ++YG+QPP+E+LRQ  D   ++DR+      I+D       +    A P   R  VT R +RHF+++ +    + ++K IFQ I+   F   F + +K+++  IV A  +++  +    LPTPAKSHY+FNLRD S+ +QG L   S  +++       N++ RL+ HE  RVFHDRLI++ED D F  ++ ++    F  +    +       K P       ++FGDF+K             V  +   ++Y ++TD E L   +Q YLD+YNL S   M LV F+ AIEH+ RI RM+RQ  G++LLVG+GG+G+QS  +LA  +C +  FQIE++R YS   + +D+R+L    G +  +T FLF D QI    FLEDIN +LNSG++PNLFE +D LE +    +   ++    E     +   FI RVR  LH+VL  SP+GDAF +R R FPS++NCCTI+WF  WP +AL  V+      V++  D ++E +  MC   H SV++L++ +Y  + R  Y TPTSYLELI  ++++L +K+ ++  S++R   GL KL  +   +  +Q+EL A +P L + S++ E L++ + T+    ++VR+VV E+EA   VKAE+ +++  D + +L EA+P + AA  ALD+L ++DIS V+   NPP+GV+ VMEA+CI+   KP+             W +AK+LLGD  FL  L  YDK+ I E  ++K+++ YINN  F P K++ +S AC+ +C+WVRA+++Y R+LK V PK+++LA A++     MA L  KQ  L +VE ++  LQ+ F     EK  L  N+ LT+ ++ RA KL + LG E+ RW + ++   +  +N+IG+V + +  VAY G FT  YRQ  ++ W + C+ + IP+++  +     +LGDP  +R+W   GLP D+ S +N ++VT   RW L+IDPQ QAN+WI+  E  +N L++IKL+D  +LR LEN ++ G P LLE + E LD  LE +LLKQTF       IRLGD  V+Y ++FRFY+TT++ NPHYLPE  +KVT++NF +T +GLEDQ+L  V   EKPELE++R +LI+   +++ QLK IED+IL++L TS+GNIL++E+ I+ L  SKV S  I  + + A  TE  IN  R  Y+PVA  GS+++F I+ L+ +DPMYQYSL +F  L+  +IE SE  SD+  RL+ L      A Y NI R LFE+ KL+FSF+LCI I +    V +  W   L G   +D   P K P   WL+E +WN    L +  P FKG  ++ V              +N + W+  +       E+       G W ERLS  ++LV+++    EKV+ A+  +++  LG  ++E P  DL   +++  + TP++FVLS G DPM    RFA     S   +  +SLGQGQGPIAE  I E++KS +W+ LQNCHLA SW+  + +I + L    + I+PN+RL+L+S P+  FPV VLQNSVK+TNEPPKGLRAN+ R++T  TP     FF+ +   Q + K++F +CFFHA++QER+ +G +GWNI YEFNDSD + ++  L +F  D   +  +AL Y+TGE  YGGRVTD+ D+R + ++L   +  +  L   +  + SG Y      + L  + ++I+  P N  PE+FG+H NA LA ++QET  L ++IL   P+    G   S+  I+++LA  IL+KLP+I  +E   M+     +E      + TVL QE+ RFN L++VIR SL  LK A+ G ++M   +E++Y S +  +VP LWS  +YPSLKPLG ++ DL  R  F   WI  G P +FW+SGF+F Q FLTG LQN+AR+    ID+L F ++              M   ++ +        PA  +G  +HGL+++  RW  ED  + ++ +  +   LPV++  P      +  + YH P+YKT+AR G LSTTGHSTN+V T+ +PS +   +WI++G A LCQLND

HSP 2 Score: 871.692 bits (2251), Expect = 0.000e+0
Identity = 501/1159 (43.23%), Postives = 719/1159 (62.04%), Query Frame = 3
            LEK+ +   +++  L  ++K   QR Q    ++   +  K+ E L E +    +  Q+ L      +   +++     + E  D+L      W S   +     +W+      +D E++ +E     K   +L K         P      +K K+E  +  LP++  L NP LK RHW+ +   +G  +  + +TPL+   ++ + +  + E + +VS +AS E SLE    ++++ W+   F   P++++  V IL   D+IQ+LL+D I+  ST+ +S ++GP +S ++ W + L      L  W+  Q  WLYLE IF + DI+RQ+P E   F  VD+ W+ IM K+      +       LL+  +++ ALLEQIQK L  YLE KR+ FPRF+FLSN+ELLEIL++T++P  VQPHL+KCF+ I++L+F         E T    I  M+S E E+V        L+A G VE W+ +VE AM  SLR + K A+  Y  + R +WV    P QVVL  + + W    T  ++        ++  F K+N ++++S+  LVR  NL  + R  + A I +DVHARD+V  ++  +V + ++F W  Q+RYYW  EL      DN V RM  ++  YGYEYLG   RLVITPLTDRCY  LMGA++L+LGGAP GPAGTGKTET+KDLAKA+A QCVVFNCSDGLDYK MG+FF GLAQSGAW CFDEFNRI++EVLSVIAQQ+ TI+ A   ++  F+FEG E++L ++C  FITMNPGYAGR+ELPDNLK LFR +AMMVP+YALIAE+ LYS GF  +R LA K+  +Y+LCSEQLS Q HYD+GMRAVKSVL  AG LKR+   L E+ V+++++ D NLPKFL  D  LF GI+SDLFPGVE P  DY  L   +   L+  KL+ VP  + K+IQ+YE +LVRHG+M+VG +  GKT  + ALS ALG L++    +++  +      ++NPK+IS+G LYG  + ++ EW DG++A + R   + +S++ KWI+ DGPVDA+WIEN+NTVLDDNK LCL + E I++T + +MIFE +DL+ ASPATVSRCGM+Y++  +L   P ++ W+   + +F +D  +  + L  N+ +   L F+ +KC
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009595.1 (pep scaffold:Pmarinus_7.0:GL478108:144315:184457:1 gene:ENSPMAG00000008659.1 transcript:ENSPMAT00000009595.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1196.03 bits (3093), Expect = 0.000e+0
Identity = 768/2432 (31.58%), Postives = 1252/2432 (51.48%), Query Frame = 3
            R++I+FDG VDA+W+ENMN+V+DDNK L L +GE I++ N   ++FE  DL+ ASPATVSRCGM+Y++P  L   P  + W+    P  +    +  +Q LF   +P  ++ I         G   K+ V    L +V+ +  + +++L                                    +E   EE    L  HF  +L  S GA L ++++  FD   + L  MT    D      P     +C          T+F++ F  ++   W  W  L+     D  ++     +IL+PTVDTVR  + L ++++  R+P++ VG +GT K+A    F L  L +   L   + FS++TSS  VQ S  + +++R +  Y PP  K L++F+DD++MP   ++YG Q P+ +L+ L++    +DR K+ T   + D+   +AM      R  V  R L  F +  +    +E++  I+  I+  H   F+        RL+      T  ++ + ++   PTP+K HY+FNLRD SR+ QG      + L    +  +   ++RLW +E  RVFHDRLI+++D  L    +++++E  F     V   D               ++FGD+  A       LS G      E +LY +I D EA     Q  L+EYN  S+ PM+LVLF  A+EH+ R+ R LR   GH+LLVG+GGSG+QS ++LA +    ++F+I ++R Y+ S  RDD++ L    G +G  T FLF D  + E  FLE IN +L +G +P LF ++++  +I +++    +        ++  Y  F+ +   NLH+VL  SP GD   +R RNFP L+N   I+WF  WPE AL  VA   L  +   I  D R  +V      H SV D S +F   + R NYVTP +YL+ + T+  LL +K + I+   +R   GL+KL  +  Q++ +   L   +  L   S   + L++ I   T  V + +           +  E A+ I+D          + E  L  A+P + AA  AL  L ++D++ +++   PP  V+ V E + +++G K            E  W  AK ++ +  FL +L   D D I +  ++ IR   + + G    ++  IS A  G+  +V AV  Y  + + + PK++K+A  E  +     +L+  Q EL  ++ +LA L   ++    E+  L+   E+ + ++  A+KLI+GLG E  RW   + +L  R   ++GD LL A  + Y G F+  +R   + + W+ E +   IP+S         +L D V +  W   GLP D  SV N ++ T  +R+ L IDPQ QA  WI++ E + N   V   +D  +L+ LE  +++G P L ++V + +D V+++VL +    Q   +Y+ LGD  V+Y   FR Y+ T+L NP   P    K  ++N+ +T  GLEDQ+L ++ A E+ ELE++R +LI E++ N+R LKE+ED +L+ L+TS GN+L++ + +  L  +K  + +++ K   A KT  +I+ +R+GY+P A  G++LFF+++D+A +  MYQYSLS F+ ++  S+  S   + +  RL N+    T  +Y   C  LFEK KLLFS  + I + + + +V +    F L G ISL+   +    DWL E+ W ++  L+ + P  F         N Q W    D  TP     P  +   LS  + L+V+RC   ++V  A+  Y+   +G  YV+PP  +LE   ++S   +P++F+LS G DP  DL + AE    S + LK++++GQGQ   A   +  ++   +W++LQNCHL   WL EL K  E +    S+ +P+FRLWLT+ P+  FP+ +LQ S+K+  EPP GL+ NL  +Y        +   +   P  F  L+++L FFHAVVQERR YG +GWN+ Y+FN+SD ++ +  L  +++   +     +   +L YL GE  YGGR  D+ DRR++ + +           + V+H        F  +E+   L P    D       ++  P    PEVFGLH+NAE+    Q    ++  ++   P+   +G   S    I  +A DI ++LP  F++ +   +   +       VL+QE+ RFN L++ + +SL +L+ A+ G + M   L+EV R++  G +P++W + +  +LK L +++     R + +  W+++G+P   W+SG +  +S+LT ++Q   R+N   +D+         FR  E  E ++   +G F+ GL+LE   W VE   L+ S  KVL   LPV+ I+P     +  +++   PVY T+ RR  +         VF   L +++   HW+ +G+
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003938.1 (pep scaffold:Pmarinus_7.0:GL495754:984:26133:-1 gene:ENSPMAG00000003592.1 transcript:ENSPMAT00000003938.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1179.47 bits (3050), Expect = 0.000e+0
Identity = 628/1260 (49.84%), Postives = 851/1260 (67.54%), Query Frame = 3
            V Y YEYLGN+ RLVITPLTDRCYRTL+GA  LNLGGAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY +M KFFKGLA SGAWACFDEFNRIELEVLSV+AQQI  IQRAI+ ++  F FEGTEL L+ +C + ITMNPGYAGRSELPDNLKVLFRTVAMMVP+YALIAEISLYS GF+ A+ L+ KIV  YRLCSEQLSSQ HYDYGMRAVK+VL AAG LK K     E+ ++L+SI DVN PKFL  DIPLF+GI SDLFPG+  P  DY        E      ++PV  FLDK+IQ YEM++VRHG M+VG+ F GKT   + L+  L  ++ +    E  V    +NPKAI++G L+G+FD VSHEW+DGI+A TFRE ASS++ +RKW++FDGP+D +WIE+MNTVLDD  +LCLMSGEIIQM+   ++IFE  DL QASPATVSRCGMIYMEP QLG  PL++ W+    P    ++ R  +Q LF WL+ PSL  + ++CK  V+     LV ++ +L+  LL  +  +G++ D                             K  R  +++A F  SL+WS GA  D D ++KFD F R   E+    ++ +P P  +   +C     + ++G ++D+++  K  G W  W  LI+ P L +  K T++ +I++PT+DT R  + +   +++ R P++FVG TGTGKS  IK  ++++L  + +L   + FSAQTS++Q Q+   SKLD+RR+G++ PP  K  V+F+DD++MP  EK+GAQPP+E+LRQ  DH  W+D KD + + +ED+ + +AM  P   R AVT+R LRHFNI  I+ F DETM  IF  +M ++  N+ F      +   IV AT ++++  M + LPTP KSHY FNLRDFSRVIQG LLL+          D    ++RL+VHE YRVFHDRL+  +D    + L + ++   FKE F  +F D   + +     +MRKLMFGD++    +P+ +          E +LY E+   +     ++  L+EYN   K  M+LV+F + +EH++RI R+L+QP GH+LLVG+GGSGRQS  +LAT +    +FQ E++++Y  ++WR+D++ L+++ G KG +T FL  D QIK+  FLEDI+ LLN+G++PNLF  ++R +I+E ++ + Q  N  +E++ + ++  F+ R R+NLH+V+ FSPIGDAF +RLR FPSLINCCTI+WFQ
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 369.392 bits (947), Expect = 2.754e-102
Identity = 283/1020 (27.75%), Postives = 505/1020 (49.51%), Query Frame = 3
            QL  ++   + +D +W+S     +   +    P   VD   ++++  +  + A  L +     E    +     +   + K      I+  L +  LK RHW+ +   +G      ++  +++  L D++ + L  +   L ++  +A KEF +EK+  R++  W+E  +    +  +G+ ++   D ++   ++ + +  +M+ S +   FE +    +  L +L +   +W++VQ  WL L  I G + DI+  +P+E  +F+ +  +++ I  +       + VI   N    L+ +   L+ I+  L+ +LE++R  FPRF+FL N++LL+I+   K   +V   +KK F  I  + F E+  ITG+ S E E +     I  L+     ++W+  ++  +K S   V  +   C  Q+         V  +  Q +L ++ V WTE     ++++   ++ K+ D +I  +++ +   +    V+  +EA +V  +H  +V+ +L +     E    W    ++Y   +   +L  +++ I      + Y +EY+G   RL+ TPL    + TL  ++    GG   GPAGTGKTET K   + + +  VVFNC D  DY+ + +   G+ Q GAW CFDEFNR++ +VLS V A   Q        +  + L E  E  L     +FIT+NPGY GRSELP+NLK  FR  +M  P    IAE+ L  MGF ++++LA+KIV    L S + SS +HY +G+R +K VL               E+ V++S+  V LP     D  +F   +S +F     PL + + + + L +  +         FL K +Q Y M   +  L++VG++ CGKT  +K +  A+   +   N    V++ +I+ K ++   LYG     + EW DG+     R    +   +  + R W++FD  +D  ++E MN+VLDDNK L L +GE + +     ++FE ++L+  +PAT++RCG+++

HSP 2 Score: 304.679 bits (779), Expect = 1.151e-82
Identity = 310/1398 (22.17%), Postives = 633/1398 (45.28%), Query Frame = 3
            +I+IPT+DT++       +L N ++ I+  G  G+GK+ +    M ++L N        + FS  T+++ +  +     +     +GL   P+   K LV+F D+I++P+ +KYG+Q  V  LRQL++ + ++   +N  + IE + I  A   P+   R  ++ R  RH  I+ +     +++  I++     ++ + F++    +  ++    A+  ++    A +  T  +SHY+F+ R+ +R+++G          N     +   LIRLW +E +R+F DRL+  ++ + F +L+ + V+     +           N   T+     L+  DF +  K                  L N I   E  F+T   + DE     +  + +V+    ++HI RI R L+Q  GH +L+G   +G+    +   ++   +I Q ++ R  ++SD+   +++ + +   K   T  +  +  I ET FLE +N LL + DIP+LF+ E  D+L       +   +    +  T   +Y+ F+  + KNLH+V T     +   S + + P+L N C INW   W    +  VAN  +D + ++                   Q +R+ +V +  HF        + FY+ M   +N  +P  +++ ++  + L+  K  ++  ++   +VGLEKL  S  +++ +   L     +L E  KE    +  +  E  E E+ ++  +E +    V+ ED +  K+    ++ +  P +  A   +  +K+  ++ +++M NPP GVK+VMEAVC + G +               W   ++ +    F+ ++  YD     +  +RK +  +++++P F    I   S AC  L  WV A   + ++L+ V P ++++   E          +A  ++ QD    +E    K     ++ +  KT++ N     +  ++R+  L+  L  EK RW       +     +IG+ ++ +    Y G      R + + + +      ++       F    V  D     +W   GL  + + ++N ++++ S +    L+DP       I       NK  ++   ++G+++ LEN ++FG+  ++++ GE  D ++  ++ ++     N   + +GDH V+ S DF+ +I +   +         +V LV+F+     +E ++  I   +E  E++++R  LI  +   + +LK +E ++L+ L+ S+GN+LE+++ +  L++ K  +  I  K   + +   + + +   Y  +  H   +F  +         Y  S+  F++ +    I+ S  +     R+  +     + VY     +L +K K++ +  + C+

HSP 3 Score: 55.4546 bits (132), Expect = 2.274e-7
Identity = 53/226 (23.45%), Postives = 96/226 (42.48%), Query Frame = 3
            ++  EL   S  +LK++ LG  +    A+  I +S     WI+LQN  ++ SW+   L K  EE   K +E +  F++++T +      P  +LQ + +   E   G+        T   +    FF             F L +FHA++  R      G++  Y FND D + +   L+  +  N   ++    +        YGG++ + +D  ++  L   V+
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Nematostella
Match: EDO34727 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNG1])

HSP 1 Score: 3697.52 bits (9587), Expect = 0.000e+0
Identity = 1982/3929 (50.45%), Postives = 2690/3929 (68.47%), Query Frame = 3
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Nematostella
Match: EDO45806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRR2])

HSP 1 Score: 3391.67 bits (8793), Expect = 0.000e+0
Identity = 1828/3918 (46.66%), Postives = 2543/3918 (64.91%), Query Frame = 3
            + K+++  SVKKAI+D++L +  E++        +  + + +   PW+   L +   +++  + T+ T+  +L  + K +  LRL+   +I      L L     +  ++ +   + L   W  + + I      +    +P +  +  + +E FFN  + L +N L+ +  NSI+++ E         C        S   + +   I+R+ L  D        F P F      L  + D +I +V    R+E  L+ +  GT  +L  I+S    EE V   K K+   ++     P ++ + Y  ++ L+ +  E    QF+    +   +  E+EK   L DE   +    + + +F L C+ + + L  R   L    L  M+   +V N+ +C +Y+ I  +       T  L+EL+ Y+E++    +  L+ +L +    + FL++Y      D+ LNN+ F W+ R+  + +     +   R +  N L+  +++FVE L     Q++EF     +++     ++   + ++L    E+    N EE        T Y Q Q+++    P+ KL+++ V F   Y +WM GP   +D ++VE+ET + W++ Y+L K  +  E     R A  +K K+E+FK  LP++Q + NPGL+ RHW+ MS  +GF + P  D  L+ M  M L+ +L     +S  ASKEFSLEKA  +M  +W  + F   PY+ETG +IL ++DDIQ LL+D IVKT TMR SPFI PFE+EI  W+  L   ++ ++ WLKVQA WLYLEPIF S DI  Q+P EG +F  VD+ WR  M     D  V+ VI  + +L  L+ S  LLE I KGLN+YLEKKRLYFPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGI+ L+FT+   IT M S+E E V     I   +A G VEKW+L+++  M  S+R+V+ +A+  Y +  R +WV+DWPGQ VL  +  +WT +   AI+     L+++L++N+ QI  IV LVR + L    R TL A +VLDVHARDV+ KL    +SSEDDF W++Q+RYY+          +N++ RM++  + YGYEYLGN+ RLVITPLTDRCYRTL GA++L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGLA  GAW+CFDEFNRI+LEVLSV+AQQI TIQ  I+   +  LFEGTE++LD +C +FITMNPGYAGRSELPDNLK LFRTVAMMVP+YA+IAEISLYS GFV AR+LA KIV  Y LCSEQLSSQHHYDYGMRAVKSVLTAAG LK K     E+ ++L+SI DVNLPKFL  D+PLF GI SDLFPGV+ P  DY  LT    E  ++M L+ V  FL KI+QIYEM++VRHG MIVG+ F GKTCA++ L+ AL D+  K L  EN V   +INPK+I++G LYG+FD VSHEWSDG+LA  +R  ASS + +RKW+IFDGPVDA+WIENMNTVLDDNKKLCL SGEIIQ+ +  N+IFEP DLE ASPATVSRCGMIYMEP  LG  PL+  W+   LP+ L++E +  ++ LF+ +    L FI +   K         LV + + +  +L+D+  +  +                       K  NE E+       +L   +  S +WS GA LD + +  FD   R++ E  ++     KY       P P+   C      P K T++D+ F+K+  G W  W   I+  D   + K    + I+IPTVDTVR  + + +++ +G KP +FVG TGTGKS  I  F+L  L  + +    + FSAQT++ Q QD   SKLD+RR+G+Y PP  K  VVF+DD++MP +E YGAQPP+E+LRQ +DH  W+D KD +P+ + D+ I +AM  P   R  +T R LRHFN I+I +FDD TM  IF  IM+WH  +     GF      +  ++V+ T +I+++ + + LPTPAKSHY+FNLRDF+RVIQG LL        +T+ D    L RLW HE +RVF+DRL+   D D  +  +++V +     +F  LF   DF  D K   + ++R L+F DF  AK DP               K Y E+ D + L   ++ YLDE+N MSK PM LVLFRFAIEH++RI R+++QP GH LLVG+GGSGRQS  +LA  + DF++FQ+E+ + Y+ ++WR+DI+ ++R T +      FLF D QIKE  FLEDIN LLN+G++PNLF  + +  +    +     + ++ Q + + + ++N FIERVR  LH+VL  SPIGDAF +RLR FPSL+NCCTI+WFQ WP DAL++VA + L+E EI+ DV+E  V MC+ FH S  DLS ++   + R NYVTPTSYLELI TF  LLNKKQ E++ +K RY VGLEKL  +++Q++ MQ EL+A QPQLI+  KE + ++ IIE +++EV K  K+VK +EA    +A  AK+IKD+C+ +L EA+P++ +A+ AL+TL   DI++VK M++PP GVKLVMEA+CILKG+KP++  DP  SGK +ED+W  +K++LGD+KFL  L++YDKD IP   +++IR +Y +NP FDP KIK  S+A EGLC WV A++ Y++   + +  K    +  S+       L  K+  L EV+ KLA+LQE ++   ++K+DLE  ++L   K++RAEKLI GLGGEK RW +V + L +R+ N+IGDVL+ +G+VAYLG FT  +RQ     + +  + +           L +++  PV++R+W I+GLP DSFS++N +I+ + NRW L+IDPQGQANKWIK +E ++N L VIKL+D  Y+R LENC+QFGTP LLENVGEELD +LE +LLKQTFKQ     I++GD V+EYS+DFRFYITT+LRNPHYLPE +VKVTL+NFMITP GLEDQ+LGIV A+E+PELE+ +  LI++SA N+RQLKEIED+IL++LS+S+GNILEDE AI +LSSSKVL+ +IS KQ  A +TE +I+  R GY P+A H +ILFF+I+DLA+++PMYQYSL+WFINL+I SI+NSE S +++ RL+NL +HFT ++Y N+CRSLFEKDKLLFSFLLC+ I     +V    WRFLLTGG+ LD+P  NP   WL  +SW+E+  L ++  FKG+ + F   ++ WK I DS  P     PG+WEE+    +++V++RCL P+K+ P V +++   LG +Y+EPP FDL  +F +S+S  P+IFVLSPG DP + L +FA+ +  S + L  +SLGQGQGPIA   I +++K   W++LQNCHLATSW+P L K+CEE  L     +P+FRLWLTSYPS  FPV VLQN VKMTNEPPKG+RAN++RSY   PISD +FF  +  K PQ F+K+LF LCFFHA+VQERR +G +GWNIPYEFN++DL+IS++QL MF+N Y++VQ EAL YLTGECNYGGRVTD++DRR ++++L   Y   ++  + +  + SG Y  P    D  +Y+ + +  P    PE+F +H N    +       +      T    +SG  +S   I+  ++ DILSK+PQ F  +    K+P  Y + MNTVL+QE++RFN+LI+V+R SLV+++ A++GL++M + LEEV   ++ GK+P LW + SYPSLKPLGSY++DL+AR+KF Q+W DNG P  FW+SGF+FTQ+FLTG  QN+AR+    ID L FDF ++E  +Y  P ++G +++GL++E  RW  +  ++ ES +KVL+D LPV+ + P     I     Y  PVYKT+ RRG LSTTGHSTN+V  + LPS Q  +HW+ RG+A LCQL+D
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Nematostella
Match: EDO37961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE81])

HSP 1 Score: 2336.61 bits (6054), Expect = 0.000e+0
Identity = 1255/2577 (48.70%), Postives = 1700/2577 (65.97%), Query Frame = 3
            ++R++   V YG EYLGN+ RLVITPLTDRCYRTLM A  LNLGGAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY  MGKFFKGLA  GAWACFDEFNRIELEVLSV+AQQI  IQRAI    + F+FEGT+L L+ +C + ITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALI EI LYS GFV+AR L+ KIV  Y LCSEQLSSQ HYDYGMRAVK+VL AAG LK K     E  ++L+SI+DVNLPKFL  DIPLF+GIISDLFPG++ P  DY      + E      ++ V +F +KIIQ YEM++VRHG        CG            G L    +   S +  +I  +         R+      W+DGI+A TFRE+A+       W                                                    PATVSRCGMIY+EP  LG DP+++ W+ + LPE L  E    +  LF W +P  L F+ + CK  V C    L  +++ L   +L +                               + E   +K  +  ++++ F  S++WS GA +D +S+ KFD FF+   ++       +P P  L       +P +G ++D++F +K  G W  W  LI+   L    K T I++I++PT+DT R  + +  ++ N  KP++FVG TGTGKSA +K  +++ LP   +L   + FSAQTS++Q QD   SKLD+RR+G++ PP  K  V+F+DD++MP  EKYGAQPP+E+LRQ +DH+ W+DRKD T + + D+    AM  P   R  V+ R LRHFN++++  F+DETM+ IF  I+ ++F N+ F          +V AT +I++  M + LPTPAKSHY FNLRDFSRV+ G LL+K   L +         + RLWVHE YRVF+DRL+  +D D     +       F      LF   S D       +MR LMF DFL    +P+ +          E +LY E+T+ + L++ ++  LDEYN   K  M+LV+FR+ +EH+ RI R+L+QP G++LLVG+GGSGRQS ++LA  I  F +FQ E++++Y +++WR+D++ L+++ G +   T FL  D QIKE  FLED++ LLN+G++PNLF  +++  +    +     Q ++   E + + ++N F+   ++ LH++L  SPIGDAF +RLR FP+LINCCTI+WFQ WPEDAL+MVANK L++  +  + R++IV +C++FH S  +LS+K+ EV+GR NYVTPTSYLELI +F  LL +KQ E++ SK RY VGLEKL F+ +Q++ MQVEL+  QPQL+  + E +K++ IIE E+ EVE   ++V+++EA   ++A +A+++KD+CE++LAEA+P + AA+ AL+TLK  DI+IVK+M NPP GVKLVM AVC++K +KPEK  DP  +GK + D+W  +KKLLGD+ FL  LK YD+D I    M KIR +YI NP FDP K+K  SSA EGLC WV A+E+YDR+ KVV+PKKE LA AE+     M+ L  K+ EL EVE+KLA L+  FQ   ++K +LE  ++L   K+ RAEKLI GLGGEK RW      L   FDN+ GDVL+ +G++AYLG FT G+R+EC   W   C+S +IP S +   S    LG+ +++R W I GLP DSFS+DN VIV    RW L+IDPQGQANKWIK  E E N+L VIKL+D  Y+R LEN +QFG P LLENV EELD  L+ +LL +  K+           V  IRLG+ V+EYS DFRFYITT+LRNPHYLPE S KVTL+NFMITP GL+DQ+LGIV AKE+P+LE+ R  LI++SA+N++QLKEIED+IL+ LS+S+GNILEDE AI+IL SSKVLS++IS KQ+ A++TE +IN  R GY P+A H S+LFF+I+DL ++DPMYQYSL+WF+NL+++SI +S  S  +E RL+ L+ HFT  +Y N+CRSLFEKDKLLFSF+LC  I K ++++D   + F LTGGI L++  +NP P WLS++SW+E+  + +L  FK + K F     +W+ I DSK PH    P  W E+L+  ++++VIRCL P+KV+P V +++   LG ++++PP FDL  S+ +S++  P++F+LSPG DPM+ L +FA+ K  S      +SLGQGQGP+A   I E++++ +W++LQNCHLA SW+  L KICE+  L     + +FRLWLTSYPS+ FPV VLQN VKMTNEPP GLR NLL+SY T PISD +FF    ++  V+EKLLF LCFFHA+VQERR +G +GWNIPY FN+SDL+IS+RQLQMFIN+YE+   +A+TYLTG CNYGGRVTD+ DRR +MS+L   ++ +++    +  + SG Y  P   S  + Y+  I+  P + +PEVFG+H N +++K+ + T  L    L        G  K S+  + ++A+DILSKLP+ F +E    KYPV YEE MNTVL+QE+ RFNK +
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Nematostella
Match: EDO34077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG6])

HSP 1 Score: 2064.27 bits (5347), Expect = 0.000e+0
Identity = 1229/3398 (36.17%), Postives = 1928/3398 (56.74%), Query Frame = 3
            +G   S  N +LR+ +   +     + F P+  ++   +  I   +   +  F RL ++L  K   +   P  L +   EE      +K++  +K    A   + Q Y      +R +     +    ++   +  +  ++A++ +   +++      T L +   +LDC  +   LL    +    + N  T   R       T+ ++ ++    +L+   ET  +L +    +E+L+  +L  ++ K     +    L  Y +   +++  +L+  +  W      ++DS    L K +E+    L    ++F + + GL     +F  +   + ++  ++ L+++ +   + +  K Q    E  L  G+      Q     LQ +    E  +++W     + +L+D W  G  +E+   ++E + Q L+K   RL K+    + K    C  +IK+++E+FK  +P+IQ L N  ++ RHW  +  +V   FD T   D  L  ++ +GLD+  E + E+S  ASKE S+E+A   + + W ++     PYK+ G   L   D++   LED+ V  STM+ S ++  FE+E++ W++TL  + + +   L VQ  W+YLE IF   DIR+Q+P E  +F+ V+  W+ IM ++  D   +    +  LLE L      LE+IQK L+ YLE KR  FPRF+FLSN++LLEIL ++K+P  VQPHLKKCF+ I  LK        ++T   GM SAE E V+F + +     EG VE W+  VE +M+ +L+E++K   L     +S R +WV++WPGQ+ + +S + WT     A+ S       +       +Q+S +    E++R  +L  + R+ + A + ++VH RDV+ KL+ +  +    F W+SQ+R YW  ++      D+ V+R   T+  YGYEYLGN+ RLVITPLTDRCY TL  A+ L+ GG+P+GPAGTGKTET KDL KA+    +V NCS+GLD+KSMG+ + GLAQ+GAW CFDEFNRI +EVLSV+AQQI +I  A+      F+FEG E+ L  SC IFITMNPGYAGR+ELPDNLK +FR ++M VPD  +IAEI L++ GF   + LA K+  +Y L  +QLS Q HYD+G+RA+ SVL  AG+ KR    +++E ++L S+ D+N+ K    D PLF+GI+SDLFPG+E P+IDY  L   ++  L+    +P P  + KIIQ+YE    RH  ++VGQ+  GK+  ++ L  A+  L ++     +V+ +  INPKA+S+G LYG FD  ++EW+DG+L+   R+  S E  E KWI+FD PVD +WIE+MN+V+DDNK L L++GE I M +  +++FE EDL  ASPATVSRCGM+Y +   LG  P +  W    L   +D +    +Q LF   +P  L+F    CK  V    L  V ++  L+ +L  +   V                         +++N      E     L   F   LIWS                    C   D  ++K  +  N         P K T+++ H+ +K++   W +W+  +          +   + I+IPTVDTVR  F +  +++  ++P++  G  GTGK++V +  +L  L  K +    +  SAQTSS+ VQ+   SK+++R +G+Y P   K ++ F+DD +MP K+ +G+QPP+E++R  ID+ FW+DR   T   ++D+ + ++M  P   R  ++ RL   FN+I +    +  +K IF  +++      FE  +K L  ++  AT +I+ +++A  LPTP + HY+FNLRD S++ QG  LL++    N    D+   + RLWVHE +RVF DRLI + D + F  L+   +   F   FH    +   + + P        +FG+F+K                  +  +Y ++ D +A+ + M+  +++YN+      ++LVLFR AIEH+ RI R++ QP G+ LLVGIGGSGRQS  +LA++I ++++FQIE+T+ Y   ++RDD++RL    G     T FLF D Q  E  FLED+N +L+SG++PNL++ ++      +           ++ T  +M++ FIERVR NLH+VL  SP+GD F +R+R +P+ +NC TI+WF  WP DAL  VA + L+ +E+  ++ +  +  +    H+SV D+S +    + R NYVTPT+YLEL+  + +LL +K+ E+  +  +   GL+K++ +  ++ +M VEL+        FQ Q  E      +  +  + +   V+   + +  EE  C V AE+A       + +L EA+P +  A++AL++L + D++ +K+   PP  V+ VMEAV IL+  +P              W  AK+ LGD  F+  L +YDKD + +  ++KI   Y   P F P  I  +S A + LC+WVRA+EVY RI +VV PKK++L  A +  + + A L   + +L EV  ++ +L+  +  K  +K +L    EL ++K++RA KL++GL GE+ RW   ++ L      ++GD L+ A  ++Y GPF   YR E V + W  + + + +  +   +FS    L  P  VREW I GLP D+FS +N V+VT  NRW L+IDPQGQA KWIK +E  ++ L++I L    YLR LEN +QFG+P LL+NV EELD  L  +L K   K      I+LGD  VEYS DFRFYITT+L NPHY PE S K T+VNF +   GLE Q+LGIV  +E+PELE+++  L+I  A+ +++L+E+ED+IL++L T++G++L+DE+ +  L+SSK  S++++ +   + +TE +I+  R GY+P A   SILFF ++D+  +DPMYQ+SL  +I+L+ +SIE S+ S +++ R++NLN + T AVY+  CR LFE+ KLLFSF +C  I +   K++   + F L GG+ LD   +  NP   WL++ SW+ +  L  L  F G +  F    + W     S  P     PG+WE   + L+R++V+R L P++V     S+IV  LG ++VEPP  D+     +S + TP+IFVLSPGVDP S L + AE   +S      +SLGQGQ PIA   I E +K  NW+ L NCHL+ SW+P+L K+ E+L ++  + +P+FRLWL+S P   FP+++LQ  +KMT EPPKGL+AN+ R Y    I+++ F +  K+ + ++KLLF LCFFH+V+ ERR +  +GWNI Y FNDSD ++S   L +++++YE+   +AL YL    NYGG VTD+ DRRL+ S +  +++ + + +  + L+   TY VP
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Nematostella
Match: EDO47920 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKK0])

HSP 1 Score: 1763.81 bits (4567), Expect = 0.000e+0
Identity = 1136/3370 (33.71%), Postives = 1803/3370 (53.50%), Query Frame = 3
            +E++ +K+    LW          ++W   P  E+D E +E E +   K    L K      + G     +T+K  +     +L  +  L NP +++RHW  +            DT L+D+LA+ L    +++  +  KA+KE  +EK    +   W ++ F    +  T + +L + +++   LED+ +V+   +  S +IG F  E+  W K L      +  W +VQ  W +LE IF GS DIR Q+P +  +F+ +D  ++ + N+    +K+ NV++  N   L E L++ +  L   +K L +YLE KRL FPRF+F+S+ +LL+ILS    P+ V  HL K F+ +++LKF E+          GM S E E V+F       + +G VE W+ +V   M+ ++R+   +++  Y +  R QW+ D+P QV L  + + WT +   A         + ++++ KK   Q+S+++ ++   +L    R  +     +DVHARDVVAKL+  +V S   F W+SQ+R+ W  +     +N      +   +  Y YEYLGNT RLVITPLTDRCY TL  ++ L + GAP GPAGTGKTET+KDL +A+     VFNCS+ +DYKS G  +KGL+Q+GAW CFDEFNRI +EVLSVIA Q+++IQ AIRD+ E F+F+G ++ L  +  +FITMNPGYAGR+ELP+NLK LFR  AM+VPD+ LI EI L + GF+EAR LA K + +Y LC E LS Q HYD+G+RA+KSVL  AG LKR  R   E++V+++++ D N+PK +  D+P+F G+I DLFP ++ P     D   ++ + +  +KL+P   F+ KI+Q+ E++ VRH + ++G +  GKT   ++L+    +  ++      ++FD +NPKA++   L+G  +  + EW DG+ +   R+ ++  SD  KWI+ DG +D +WIE++NTV+DDNK L L S E + +T    ++FE   L+ A+PATVSR G++++    +G +P +  WI     +     ++  +Q+LF+  +P  LD +  + K       + +V  +  L   LL                              N   + N+ L E        +F  + +W+FG  + +D  + +          T+         K +K       P  GT+FD+ ++  +   +  W   ++K +LD  +    +  +L+ T +T R RFF+  +++N R+P+M VG  GTGK+ ++  +   SL     +  ++ F+  T+S  +Q      L+++    Y PP +K L+ FIDD++MP  + YG   P  ++RQ +D+  WFDR   T L ++D+     +A   P+A    +  RL RHF + AI     + +K I+  I++ H     F   + + ++ +  A   + Q V + FLPT  K HYVFNLRD S + QG L      +K            RLW+HE  RV+ D+LI  +D ++F     ++ KK  E   +E  +           +P        MF  F           SSG     GE K Y  + D E L + +   L+ YN ++ A M+LVLF  A++H+ RI R+L  P G++LLVG+GGSG+QS A+LA FI   E+FQI + + Y + D + D+  L    G K I T FL  D Q+ E  FL  IN LL SG+IP L+ +++            + +   ++ T  N +  FIERVR+NL +VL FSP+G     R R FP++ NC  I+WF  WP++AL  V+ + ++++E ++ + +  +     + H SV++ S+ +     R NY TP S+LE I  + NLL KK  E+    ER   GL KL+ +  Q+  ++ +L + + +L + +++ +KLI+ +  ET +V K + +  +EE    V A+D    +  CE +LA+A P + AA EAL+TL + +++ +K+  +PP  V  V  AV +L          P+ K+ +D  W  AK ++G +  FLD L +YDK+ I E+ ++ ++  Y++NP F+P  IK  S A  G+C WV  +  +  I   V PK++ L  A +       +L   + ++ E++  LA+L  NF+    EK   +   E T   IE A +L+ GL  E  RWG+ +     +   + GDVLL    V+Y G FT  YR   + + W     S +  +         S+L D   +  W    LP D  S +NA I+T+  RW L+IDPQ Q  KWIK  E   N L +++L  KGYL  +E  +  G   L+EN+GE +D VL++++ + T K+     I++GD  VEY  DFR  + T+L NPHY PE   + TL+NF +T  GLEDQ+L  V +KE+P+LE+ +    I   + ++     +LKE+ED +L  LS + GN L D   +E L  +K  + +I ++   A +TE +IN  R  Y+P A   S+L+F ++DL  ++PMYQ+SL  F  ++  +IE +E + +++ R+ NL    T +V+    R LFEKDK++F+  +   +   + ++   EL +       +++ SP      D+LS  SW  +  LSN+E F+   +D   + ++WK   +S+ P  EKFP +W+ + + L++L ++R L P+++  AV +++   LGH+YVE       +SF+ES   TPI F+LSPGVDP+ D+    +    +    N   VSLGQGQ  +AE  +  + K  +W+ILQN HL  +WLP+L K  E         NP++R+++++ P+      + P  +L+ S+K+TNEPP G+ ANL ++       ++D  +   R   F+ +LFSLC+FHAVV ERR +G  GWN  Y FN  DL IS+  L  ++     V    L YL GE  YGG +TD+ DRRL  + L      E+L     L+  FPL  +         SD   Y  +I    P  +P ++GLH NAE+      ++ LF ++L   P++  G   +SQT    ++ +  DI  KLP+ F + E+  +  V        V  QE  R N L   ++ SL  L   ++G + + + +E++  ++ +  VP  W++ +YPS+  L ++  DL+ RIK  + W  D   P+  W+SGF+  QSFLT + Q+ AR+N   +DK  L  D       +++ P  EGA++HGL++E  RW  +   + +S  K L   +PV+ I        + +N Y CPVYKT  R            YV+   L + +    W   G+A L
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Medaka
Match: dnah12 (dynein axonemal heavy chain 12 [Source:NCBI gene;Acc:101164478])

HSP 1 Score: 3161.32 bits (8195), Expect = 0.000e+0
Identity = 1737/3787 (45.87%), Postives = 2438/3787 (64.38%), Query Frame = 3
            F+NC +TL SN LR ++   I EFV      R                  +   I ++ L  D      +   P+   +   + +I++ I  +  +   +++ L     G  S  F+ + +  + F+ + +  ++  V  N E P K+ Q Y ++ +L+N T +     F+  +    +Y  ++E   +L+ E +SLP  +   +  LDCE + Q L +++K                    IC+++++I +++    + T ++ ++++Y++  +   +  L  ++++A   +++LL   +  ++DI LN+T + W   I+   + S   L   R++   +L   +++    L  L+  IK F   ++L    E   ++    ++L E  E    IN+EE      + T Y +++ +    EP+ K+      W+      +TFH L  +WM+G  L+++ E +E +    ++  Y++ K F   + K     A T                          +  +++KFK  +P++  LCNPGL+ RHW+ MS   GFD+TP   T L  +L + L+  LE+   +S  ASKEFSLEKA   M   W  + F   P+K+TGV+I   +DDIQ++L+D IVKT TM  SPF+ PF+SE+  W++ L  ++++++ WLK+QA WLYLEPIF S DI +QIP EG  F+ VD  WR IM     DSKV+       LLE LQ S ALLE+I KGLN YLEKKRL+FP                                               M S+E E V+   +I   EA G VEKW+LQ+E  M  S+R+++ ++   Y + +R QWV++WPGQVVL  S + WT +   A+    L+++ ++   Q++ IVELVR E L    R TL A + +DVHARDVV  L+  +VS E DF W++Q+RYYW         NDN+ + ++  +V Y YEYLGN+ RLVITPLTDRCYRTL+GA  LNLGGAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY +MGKFFKGLA SGAWACFDEFNRIELEVLSV+AQQ+  IQRAI  +LE F FEGT L+L+ +C + ITMNPGYAGRSELPDNLKVLFRTVAMMVP+YALIAEISLYS GF+ A+ L+AKIV  YRLCSEQLSSQ HYDYGMRAVK+VL AAG LK K     E+ ++L+SI DVN PKFL  DIPLF+GI SDLFPGV  P+ DY+       E  +   ++P   F DK+IQ YEM++VRH  M+VG+SF GKT     L+  L  +N+  + E   VIF  +NPK+I++G L+G+FD VSHEW+DG++A TFRE A +E+ +RKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQM+N+ ++IFE  DL QASPATVSRCGMIYMEP QLG  PL+  WI          + R+ +  LF+WLIPPSL  + R C+  V   +   V  + +L+  +LD+    G                                  E    +++A F  SL+WS G   D DS+ KF+DF R   +     N+++P P+ ++   C  N    +KG ++D+ +  K+ G W  W   IE  +L E+   T+   I++PT+DTVR  + +   +  G  P++FVG TGTGKS  +K  +L++L    +L   + FSA TS++Q Q+   SK+D+RR+G++ PP  K  V+F+DD++MP +E++GAQPPVE+LRQ +DH   +D KD + + + DV   +AM  P   R AVTSR LRH NII+I+ F D+TM  IF  I+ +      F      +   IV A  ++++  MA+ LPTPAKSHY FNLRDFSRVIQGCLLLK   L      +    LIRL+VHE YRV+HDRL+  ED    ++L+  +V+  F   F  +FG     +K     +M+ L+FGD++    +P+          EG+ +LY E+   E   + ++  L+EYN M K  M+LV+F + +EH++RI R+L+QP G++LLVG+GGSGRQS  +LAT +    +FQ E+++ Y +++WRDD+++ L+RN G KG +T FL  D QIK+  FLEDI+ +LN+G++PNLF  +++ EIIE ++ I Q     +E++ + ++  F+ R ++NLH+V+ FSPIG AF  RLR FPSLINCCTI+WFQ WPE+AL+ VAN  L+ +E+ ++ R++++ +C+ FH S + LS  F   +GR NY+TPTSYLELI TF  L+++K+  I+ +K+RY  GL++L F+E++++ M+ EL   QP+L +   +  K++++IE E++EVE   +VV  +E    +KA +A+++K +CE++LAEA+P + AA+ ALDTLKQ +DISIVKAM+NPP GVKLVM AVC++K +KP++  DP+G  K + DYW  +KKLLGD+ FL  LK YDKD IP   M+ IR +++ NP FDP K+ N SSA EGLC W+ A+EVYD++ KVV+PKK KLA A+       A L  K+ EL EVE +L  LQ+ F+ K +EK  LE  +E    K+ERAEKLI GL GEK  W K   DL   +DN+ GDVL+ AG++AYLGPFT G+RQ C +LW   C+S +IP  S   FSLS  LG+P+ +R W I GLP DSFS+DN VIV ++ R  L+IDPQGQANKW+K LE + N L VIKL+D  Y+R LENC+QFGTP LLENVGEELD  LE +LLKQTFKQ  VE I+LG+ V+EYS DFRFY+TTRL+NPHYLPE + KV+L+NFMITP GLEDQ+LGIV AKE PELE+ R  LI++SA+N+RQLKEIED IL+ L +SKGNILEDE AI+IL S+K++S +I+ KQ  + A KTE +I   R GY+ VA H SILFF+I+DL ++DPMYQYSL WF+NLYI+SI++ + S  ++ RL+ L  HFT  +Y N+CRSLFEKDKLLFSFLLC  +   + +++     FLLTGGI L +   NP P WL +KSW+E+   S L  F+G L+ F+ N + +K I DS+ P     P  W E+L+ L+++++ RCL P+ ++PAV  ++   LG ++V+PPAFDL  SF +S+S  P++FVLSPG DPM+ L +FA  K +  +  + +SLGQGQGPIA   I+ ++++ +W+ LQNCHLA SW+  L KICE+  L  +  + +FRLWLTSYPS  FPV +LQN VKMTNE P GLR NLL+SY T P+SD +FF     K+P V+EKLLF LCFFHA+VQER+ +G +GWNIPY FN+SDL IS+RQLQ F+N+Y+ V  EA+TYLTGECNYGGRVTD+ DRRL+M+ L   Y ++++ +  +PL+ SG Y  P   S    Y+  I+  P +  PEVFGLH N +++K+ Q+T  LF+S+L+T     + G S      + D+A++IL+ +LP  F  E + +KYPVLYEE MNTVL+QE+ R+N L   I  SL +L  A++GL++M + LE V  ++++GKVP  W+++SYPSLKPLGSYI+D +AR+KF Q W +NGQP  FW+SGF+FTQ+FLTGV+QN+AR+ +  ID L FDF ++   +   P ++G +++GL+L+  RW  E   L E H ++L+D +P+I + P  K+ I  ++ Y CP+YKT+ R+G LSTTGHSTN+V  + L + +  QHWI RG+A L QL+D
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1099.35 bits (2842), Expect = 0.000e+0
Identity = 711/2172 (32.73%), Postives = 1180/2172 (54.33%), Query Frame = 3
            ++ T+FD+    +  G W  W + +E+    PD+     T +  +IL+P VD VR  F +  I K G K ++ +G  GT K+ ++K+FM    P    L   L FS+ T+    Q +  S +D+R    Y PP  K + + IDDI+MP   ++G Q   EI+RQL++ K +++  K      I DV   +AM  P   R  +  RL R F+I       + ++  IF  I + HF    GF   ++R    +V  T  ++Q      LPTPAK HY+FNLRD SR+ QG L   + V+      +S + L+ LW HE  RV  DR    +D + F + + K+VE    E           ++K+  +  + +  F DFL+   DP E  ++G   +E +    K+Y  I   E+L   +  +L +YN   +   MD+V F+ A+ H+ ++ R++R P G++LLVG+GGSG+QS  +LA+FI  ++IFQI +TR Y+ ++  +D++ L R  G +G   +F++ D++IKE  FLE +N +L+SG++ NLF   +  EI+  +  +++++  +   T  N+Y+ F+ RVR NLH+VL FSP+G+ F +R   FP+LI+ CT++WF  WP+DAL  V++  L   +++    V+ ++V     F   V++    ++    R  +VTP SYL  I+ +  +  +K+ E++ +      GL+KL+ +   ++ +  EL+  + +L   +++ + ++K +  +    E V+  V++ +       +   + K   E  L  A P +  A  AL T+K +DI+ V+ +  PP  +   M+ V +L  + + P  + +     +   W  +  L+    FL  LK + KDTI E  +  ++  Y N P ++  + +  SS   GL  W +A+  +  I K V P K  LAV E+        L+  Q EL   +++L  ++  ++    EK  L  + +  + K++ A  LI+GL GEK RW +   + A +   ++GDVLL    ++Y GPF   +R   +  WQ E K  SIP  +    +   +L D   V EW + GLP D  S+ N +IVT   R+ LLIDPQ Q   WIK  E+ +N+L++  L+ K +   LE  L  G P L+E+VGEELD VL++VL K   K  +   +++GD  V+  + F+ Y+TT+L NP Y PE S + ++++F +T  GLEDQ+LG V   EK E+EK R  L+ +   N+R++KE+ED +L  L++++G++++DE  I +L ++K  +E+++ K + A  T+ +IN  R  Y+PVA  GSIL+F I++++ ++ MYQ SL+ F+ L+  S+  S  SS+   R+K++  + T  VY    R L+E+ K LF+ LL + I      V    +  L+ GG SLD    PQK    +W+ + SW  +  LS L  F   L     + + WKS  D + P  E  P  ++  L    RL++IRC CP++ I     YI   +G +Y E    D+E +++ES+  TP+I  LS G DP   +    +   +     + VS+GQGQ   A   + +++ +  W +LQNCHL  +++ EL     + +++   IN +FRLW+T+     FP+ +LQ S+K TNEPP+GL+A L R+Y      ++D    S   Q ++ +L+ + F H+ VQERR +G +GWNIPYEFN +D   +++ +Q  ++D +  QL     + Y+ GE  YGGRVTD+ D+RL ++    V+  + +    F   +   Y +P  +S ++ YL +I+  P    PEVFGLH NA++  + ++   + ++IL   PK+  SG  ++ +  +  +A D+L KLP     F+++ +    P+   + MN  L QE+ R  ++I ++R +L+DLK A+ G I+M   L +    M   ++P+ W + S+ S   LG + ++L+ R + FQ W+  G+P+ FW++GF+  Q FLT + Q  AR N+  A+D      R++ C+E +K        P  +G +++GLYLE   W   +C L ES  KVL++++PVI +     + +     Y CP+YK   R  +        N + ++ L ++Q  +HW+ RG+A LC +

HSP 2 Score: 589.341 bits (1518), Expect = 4.051e-168
Identity = 357/969 (36.84%), Postives = 549/969 (56.66%), Query Frame = 3
            +K  +++F    P+++ + +  +  RHW  ++   G ++    +   L +++     K+ E++ ++   A KE  +E+    +  +W    F+F  +K  G  +L   +  ++   LED ++   ++ ++ +  PF+++I  W + L    D +  W+ VQ  W+YLE +F   DI +Q+P E   F  +D+ W  IM +      V+     D  +  L     LLEQ+   QK L  YLEKKRL FPRFFF+S+  LLEIL +  D   +Q HL   F+ I  ++F  E +   +L+  S E +      P+ AEG VE W+  +    + SL  V+++A L   N+      ++  +  QV L    + WT  +  A+  +H     + K +Q   +++  + D   ++L ++ R   E  I + VH RD+   L    + +  DF W+ Q R+Y+      N  +D + I +      Y  E+LG T RLVITPLTDRCY TL  A+ + +GGAP GPAGTGKTET KD+ + + K  VVFNCSD +D++ +G+ FKGLAQSG+W CFDEFNRIEL VLSV AQQI  +    +D+ + F+F +G  + ++    IF+TMNPGYAGR ELP+NLK+ FR+V+MMVPD  +I  + L S GF++   LA K   +Y+LC EQLS Q HYD+G+R + SVL   G  KR     TE  +V + + D+NL K +  D  LF  +I DLFPG+E     Y +L   + ++++ T  +   PW L K+IQ+YE   VRHG+M +G S  GKT   + L  A+   G  ++E+          +NPKAI+   ++GR D  +++W+DGI +  +R+   ++  E  WI+ DGPVDAIWIEN+N+VLDDN+ L L +G+ I M     ++FEP +++ ASPATVSR GM++M    LG  P+++ W++Q  P
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1092.8 bits (2825), Expect = 0.000e+0
Identity = 710/2179 (32.58%), Postives = 1176/2179 (53.97%), Query Frame = 3
            ++ T+FD+    +  G W  W + +E+    PD+     T +  +IL+P VD VR  F +  I K G K ++ +G  GT K+ ++K+FM    P    L   L FS+ T+    Q +  S +D+R    Y PP  K + + IDDI+MP   ++G Q   EI+RQL++ K +++  K      I DV   +AM  P   R  +  RL R F+I       + ++  IF  I + HF    GF   ++R    +V  T  ++Q      LPTPAK HY+FNLRD SR+ QG +L  +   +N+     +  L+ LW HE  RV  DR    +D + F + + K+VE    E           ++K+  +  + +  F DFL+   DP E  ++G   +E +    K+Y  I   E+L   +  +L +YN  +    MD+V F+ A+ H+ ++ R++R P G++LLVG+GGSG+QS  +LA+FI  ++IFQI +TR+  +      ++ L R  G +G   +F++ D++IKE  FLE +N +L+SG++ NLF   +  EI+  +  +++++  +   T  N+Y+ F+ RVR NLH+VL FSP+G+ F +R   FP+LI+ CT++WF  WP+DAL  V++  L   +++    V+ ++V     F   V++    ++    R  +VTP SYL  I+ +  +  +K+ E+     R + GL+KL+ +   ++ +  EL+  + +L   +++ + ++K +  +    E V+  V++ +       +   + K   E  L  A P +  A  AL T+K +DI+ V+ +  PP  +   M+ V +L  + + P  + +     +   W  +  L+    FL  LK + KDTI E  +  ++  Y N P ++  + +  SS   GL  W +A+  +  I K V P K  LAV E+        L+  Q EL   +++L  ++  ++    EK  L  + +  + K++ A  LI+GL GEK RW +   + A +   ++GDVLL    ++Y GPF   +R   +  WQ E K  SIP  +    +   +L D   V EW + GLP D  S+ N +IVT   R+ LLIDPQ Q   WIK  E+ +N+L++  L+ K +   LE  L  G P L+E+VGEELD VL++VL K   K  +   +++GD  V+  + F+ Y+TT+L NP Y PE S + ++++F +T  GLEDQ+LG V   EK E+EK R  L+ +   N+R++KE+ED +L  L++++G++++DE  I +L ++K  +E+++ K + A  T+ +IN  R  Y+PVA  GSIL+F I++++ ++ MYQ SL+ F+ L+  S+  S  SS+   R+K++  + T  VY    R L+E+ K LF+ LL + I      V    +  L+ GG SLD    PQK    +W+ + SW  +  LS L  F   L     + + WKS  D + P  E  P  ++  L    RL++IRC CP++ I     YI   +G +Y E    D+E +++ES+  TP+I  LS G DP   +    +   +     + VS+GQGQ   A   + +++ +  W +LQNCHL  +++ EL     + +++   IN +FRLW+T+     FP+ +LQ S+K TNEPP+GL+A L R+Y      ++D    S   Q ++ +L+ + F H+ VQERR +G +GWNIPYEFN +D   +++ +Q  ++D +  QL     + Y+ GE  YGGRVTD+ D+RL ++    V+  + +    F   +   Y +P  +S ++ YL +I+  P    PEVFGLH NA++  + ++   + ++IL   PK+  SG  ++ +  +  +A D+L KLP     F+++ +    P+   + MN  L QE+ R  ++I ++R +L+DLK A+ G I+M   L +    M   ++P+ W + S+ S   LG + ++L+ R + FQ W+  G+P+ FW++GF+  Q FLT + Q  AR N+  A+D      R++ C+E +K        P  +G +++GLYLE   W   +C L ES  KVL++++PVI +           K  +     Y CP+YK   R  +        N + ++ L ++Q  +HW+ RG+A LC +

HSP 2 Score: 407.142 bits (1045), Expect = 4.804e-113
Identity = 216/473 (45.67%), Postives = 305/473 (64.48%), Query Frame = 3
            T L   CY TL  A+ + +GGAP GPAGTGKTET KD+ + + K  VVFNCSD +D++ +G+ FKGLAQSG+W CFDEFNRIEL VLSV AQQI  +    +D+ + F+F +G  + ++    IF+TMNPGYAGR ELP+NLK+ FR+V+MMVPD  +I  + L S GF++   LA K   +Y+LC EQLS Q HYD+G+R + SVL   G  KR     TE  +V + + D+NL K +  D  LF  +I DLFPG+E     Y +L   + ++++ T  +   PW L K+IQ+YE   VRHG+M +G S  GKT   + L  A+   G  ++E+ +         NPKAI+   ++GR D  +++W+DGI +  +R+   ++  E  WI+ DGPVDAIWIEN+N+VLDDN+ L L +G+ I M     ++FEP +++ ASPATVSR GM++M    LG  P+++ W++Q  P
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 920.998 bits (2379), Expect = 0.000e+0
Identity = 667/2171 (30.72%), Postives = 1106/2171 (50.94%), Query Frame = 3
            ++ T+FD+    + +  W+T  +  I  PD+     T +  +IL+P VD VR  F +  I K G K ++ +G  GT K+ ++K+FM    P    L   L FS+ T+    Q +  S +D+R    Y PP  K + + IDDI+MP   ++G Q   EI+RQL++ K +++  K      I DV   +AM  P   R  +  RL R F+I       + ++  IF  I + HF    GF   ++R    +V  T  ++Q      LPTPAK HY+FNLRD SR+ QG L   + V+      +S + L+ LW HE  RV  DR    +D + F + + K+VE    E           ++K+  +  + +  F DFL+   DP E       S     K+Y  I   E+L   +  +L +YN   +   MD+V F+ A+ H+ ++ R++R P G++LLVG+GGSG+QS  +LA+FI  ++IFQI +T  Y+ ++  +D++ L R  G +G   +F++ D++IKE  FLE +N +L+SG++ NLF   +  EI+  +  +++++  +   T  N+Y+ F+ RVR NLH+VL FSP+G+ F +R   FP+LI+ CT++WF  WP+DAL    +  S  +++    V+ ++V     F   V++    ++   G +  +   S  E +      L  K+ E+  + E+  + L+++        L++VE+Q  + +                                 A  +V +  A   K   E  L  A P +  A  AL T+K +DI+ V+ +  PP  +   M+ V +L  + + P  + +     +   W  +  L+    FL  LK + KDTI E  +  ++  Y N P ++  + +  SS   GL  W +A+  +  I K V P K  LAV E+        L+  Q EL   +++L  ++  ++    EK  L  + +  + K++ A  LI+GL GEK RW +   + A +   ++ DVLL    ++Y GPF   +R   +  WQ E K  SIP             G+ + + E                          LLID     ++W          L++  L+ K +   LE  L  G P L+E+VGEELD VL++VL K   K  +   +++GD  V+  + F+ Y+TT+L NP Y PE S + ++++F +T  GLEDQ+LG                                    +++ T K ++++DE  I +L ++K  +E+++ K + A  T+ +IN  R  Y+P A  GSIL+F I++++ ++ MYQ SL+ F+ L+  S+ +S+ S+  E R+K++  + T  VY    R L+E+ K LF+ LL + I  +G+N   +    FL L  G SLD    PQK    +W+ + SW  +  LS L  F   L   + + +K WKS  D + P  E  P  ++  L    RL++IRC CP++ I      YI   +G +Y E    D+E +++ES+  TP+I  LS G DP   +    +   +     + VS+GQGQ   A   + +++ +  W +LQNCHL  +++ EL     + +++   IN +FRLW+T+     FP+ +LQ S+K TNEPP+GL+A L R+Y      ++D    S   Q ++ +L+ + F H+ VQERR +G +GWNIPYEFN +D   +++ +Q  ++D +  QL     + Y+ GE  YGGRVTD+ D+RL ++    V+  + +    F   +   Y +P  +S ++ YL +I+  P    PEVFGLH NA++  + ++   + ++IL   PK+ S G  ++ +  +  +A D+L KLP  +     Q+ E   K   L  + MN  L QE+ R  ++I ++R +L+DLK A+ G I+M   L +    M   ++P+ W +    +   LG + ++L+ R + FQ W+  G+P+ FW++GF+  Q FLT + Q  AR N+  A+D      R++ C+E +K        P  +G +++GLYLE   W   +C L ES  KVL++++PVI +    ++++     Y CP+YK   R  +        N + ++ L ++Q  +HW+ RG+A LC +

HSP 2 Score: 503.056 bits (1294), Expect = 7.616e-142
Identity = 339/969 (34.98%), Postives = 513/969 (52.94%), Query Frame = 3
            +K  +++F    P+++ + +  +  RHW  ++                               ++   A KE  +E+    +  +W    F+F  +K  G  +L    T + I  L +  +V  S M N  +  PF+++I  W + L    D +  W+ VQ  W+YLE +F   DI +Q+P E   F  +D+ W  IM +      V+     D  +  L     LLEQ+   QK L  YLEKKRL FPRFFF+S+  LLEIL +  D   +Q HL   F+ I  ++F E+   I  + S E E ++      P+ AEG VE W+  +    + SL  V+++A L   N+      ++  +  QV L    + WT  +  A+  +H     + K +Q   +++  + D   ++L ++ R   E  I + VH RD+   L    + +  DF W+ Q R+Y+      N  +D + I +      Y  E+LG T RLVITPLTD                           ET KD+ + + K  VVFNCSD +D++ +G+ FK LAQSG+W CFDEFNRIEL VLSV AQQI  +    +D+ + F+F +G  + ++    IF+TMNPGYAGR ELP+NLK+ FR+V+MMVPD  +I  + L S GF++   LA K   +Y+LC EQLS Q HYD+G+R + SVL   G  KR     TE  +V + + D+NL K +  D  LF  +I DLFPG+E     Y +L   + ++++ T  +   PW L K+IQ+YE   VRHG+M +G S  GKT   + L  +M  G  ++E+          +NPKAI+   ++GR D  +++W+DGI +  +R+   ++  E  WI+ DGPVDAIWIEN+N+VLDDN+ L L +G+ I M     ++FEP +++ ASPATVSR GM++M    LG  P+++ W++Q  P
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 883.248 bits (2281), Expect = 0.000e+0
Identity = 629/2163 (29.08%), Postives = 1054/2163 (48.73%), Query Frame = 3
            +P   T++D  F + Q   W  W SL+ +   +  +K  +I    +PTVDT R  + L +++K  R P++ VG  GT K+A+I+  + ++  +      ++ FS++T+S  +Q +  + +++R +  Y PP  K L+VF DDI+MP+ + +G Q PV +LR L+D    +DRK       I+D+   +AM      R  V  R L  F++  I     E++  I+  I+  H    F+  ++ + + I   T  +F +++    PTP+K HY F+ R+ SR+  G  L K      LT E    + +R+W +E  R FHDRL    D  L    IKK+VE  F+     +  D               ++FGD+  A++             E E ++Y +I D    +A+FQ                    LF  A+EH+ R+ R+LR   GH+LL+G  GS  Q+  KLA F  D E+F+I + R Y+  ++R+D++ L    G +   T FLF D  I E  FLE IN +L S  +P LF ++++  II+++     Q+       ++  Y  F+ +   NLH+VL  S  GDA  +R RNFP L++   I+W+  W   AL  VA   L+   I +     ++      H S+ D SK+      R NY T  S+L+ I ++  LL +        K  + +  + LE S N++   + ++                                           +K  D K +       LA+      A +E +D  K   IS  K    PP  V++V E + +L+G K            E  W TAKK++ +  FL  L   D D+I  +++  I+  ++ N      ++++IS A  G+  +V +   Y  I K V PKK+++   E  +    A+L+  +++L  ++ + + L+E +++   EK    +  +L + ++  A+KL+ GL  E+  W K + +L  + + ++GD L+ A  ++Y G F   +R   V + W  + K   IP            L  P ++           W   GLP D  SV N ++ T  +R+ L IDPQ QA  WIK  E + N  +V  L+D  +L+ LE  +++G P LL++V E++D ++ +VL +          I LGD  V Y  +F+ ++ T L NP Y P    K  ++N+  T  GLEDQ+L + T   +   +++   L+ E + N+  LK + D +L  L TS GN+L++ + I+ L  +K  + +   K   A     E   +R GY+PVA  G++LFF +SD+A ++ MYQYSL+ +++L+  S++ S    +++ RL+N+ +  T     N+   LF K KLLFS  + + I + +  V +    FL+   +S D  +     +W+ +++W ++  L+ L P  F     D   N   WKS  D + P    FP  + E LS  ++L+++RCL  +++  A+  Y+   +G+  V PP  +    ++ S + +PI+F++S G DP +DL +FAE    S T   ++++GQGQ  +    + +++   +W+ILQNCHL   WL +L K  E++    +  N NFR+W+T+     FP+ +LQ S K+  EPP+ ++ N+  +Y+   IS +    +S +   F  L++ L FFHAVVQER  YG  GW++P  FNDSD   S+  L  ++    +     +  E+L YL GE  YGGR  D+ DRR I+ +    Y  + L S      F   +   Y +P            I++ P    PEV GL +  E+    Q   +++  + V  P+   G        I  +A DI  +LP++F I  +  +         + VL+QEL RFNKL+  +++S+V+L  A+ G + M    +++  +     VP++W + +  +LK L  ++S L  R + + NW +  G+P   W+SG +  +S+L  V+Q   R+    +D+  F   +          D  +  ++ GL+LE   W +E+  L  S  KVL   LP++ ++P  K+ +   N+   PVY T+ RR            VF   L ++    HW+  G+ 

HSP 2 Score: 848.195 bits (2190), Expect = 0.000e+0
Identity = 600/1831 (32.77%), Postives = 941/1831 (51.39%), Query Frame = 3
            A  + + L++F+++L ++  L N  L+  HW+ +  + G  FD+  +  T L  + ++ L K+  D+ E+ + A KE S+E         W+   F+  P     +  V +L  VD+I V L++ ++K   M  S F GPF   I  W+K L    + +  WL+VQ  W+ LE IF   DI  Q+P E  + + + +K+  IM    N+  +         L  L      LE+IQK L ++L+ KR  FPRFF +S++ELL +L    DP  +Q H+ K ++ I  L+     + +TV+  M+S E E ++F   + PLEA   VE WI+ V   MK + R + K+A+  Y       W++ +   +VLAA+ V WT +  NAIK+      + L+++ ++  +QI  +V  +     +S  R+ +   +V DVHARD+V   +   +    DF W SQ+R+YW  E      +D+L +R   T + YGYEY+G   RL ITPLT R Y TL  A+ + LGGA  GPAG GKTET KDLAKA+   CVV +C++ +D  ++GK   GLA+ G W CFDEFNRI   VLSV++ QIQ I+ A+    +MF FEG ++ LD    I+ITMNP Y  R ELP+++KV FR V ++ PD   I EI L+S GF++A+ LA K+  +Y+    QLS Q HYD+G+ + KSVL  AG++KR    L+E+ V+++++ D+NLPK +  D+P+F G+ISD+FPG++   + +      + E L+      +P  +DK++QIYE++L +   MIVGQ+  GK+     L  A  LG   K            +NPKA S+  LYG FD  + +W+DGI +K FRE   S   + ++I+FDG VD+ W+ENMN+VLDDNK L L +G+ I++ +   ++FE  DL+ ASPATVSRC +++++P  L   P  + W++  L              LF   +P  +D +    ++ V    + +V+ +  +   LL+                                       K      L  +F  +L  S GA +++              C  T    +    P  +        P   T++D  F + Q   W  W SL+ +   +  +K  +I    +PTVDT R  + L +++K  R P++ VG  GT K+A+I+  + ++  +      ++ FS++T+S  +Q +  + +++R +  Y PP  K L+VF DDI+MP+ + +G Q PV +LR L+D    +DRK       I+D+   +AM      R  V  R L  F++  I     E++  I+  I+  H    F+  ++ + + I   T  +F +++    PTP+K HY F+ R+ SR+  G  L K      LT E    + +R+W +E  R FHDRL    D  L    IKK+VE  F+     +  D               ++FGD+  A+             +E E ++Y +I D    +A+FQ                    LF  A+EH+ R+ R+LR   GH+LL+G  GS  Q+  KLA F  D E+F+I + R Y+  ++R+D++ L    G +   T FLF D  I E  FLE IN +L S  +P LF ++++  II+++     Q+       ++  Y  F+ +   NLH+VL  S  GDA  +R RNFP L++   I+W+  W   AL  VA   L+   I +     ++      H S+ D SK+      R NY T  S+L+ I ++  LL +K   ++  K
BLAST of dynein heavy chain 3, axonemal vs. Planmine SMEST
Match: SMESG000013737.1 (SMESG000013737.1)

HSP 1 Score: 6590.37 bits (17097), Expect = 0.000e+0
Identity = 3379/3386 (99.79%), Postives = 3384/3386 (99.94%), Query Frame = 3
BLAST of dynein heavy chain 3, axonemal vs. Planmine SMEST
Match: SMESG000012956.1 (SMESG000012956.1)

HSP 1 Score: 3401.3 bits (8818), Expect = 0.000e+0
Identity = 1843/3958 (46.56%), Postives = 2593/3958 (65.51%), Query Frame = 3
            N +K +   +L  ++P++      + K+++  SVKKAI+D++L    E++       +   +P  R+E+     PW    + + ++ QK  Y T+  + ++L  +   +  LRL+ +E    + T + L D    C ++ +   + L   W+ D + I      + + ++P   ++    +ERFFNC +TL ++ L+ +  +S+ ++   ++   D+          + MA  +   +LR+ L   +       F PS +     L  + D ++  +S  +R+E+ L+    G  +  + L+ +   E +  +K  +R+ +   S  P ++ + +  +R L+N+  +          +  H F    K L DY   ++K++  S  +  L       +F L C+ + + L  R++ +    L+ +    R  NR +  +Y+ I R+       T Q++EL ++V       ++ L+ KL+K+   ++FL++Y    T D+ LN + F  ++R+  I D +  N+ +++E     L+  +++F+E L   + Q++EF      N++N  ++  Q LD    KL   I   +  N+EE      V T Y   QE+  +  P+ KL+++AV F+  Y  WM G + +V+ ++V+A+  + ++T ++L K F +     P + A  +K K+E+FK ++P+IQ L  PGL+ RHW  +S+ VG+ +       LS ++ M L+  +     +S  A KEF+LEKA  +M+N+W  + F    Y+ETG  IL +VDDIQ++L+DHIVKT TMR SPFI PFE+EI  W+  L  ++D L+ WLKVQA WLYLEPIF S DI  Q+P EG +F  VD+ W+ IM +V  D +V+ VI+ + +L+ L+ S  LLE I KGLN YLEKKRLYFPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGI+ L FTE   IT M S+E+E V     I   +A G VEKW+L++E  M  S+R  + + L  Y    R +WV+ W GQ VLA S  +WT    +AIK     L+ +LK N+ QI  IV LVR + L    R TL+A IVLDVHARDV+  L+  +V++E+DF W+ Q+RYYW          +N++ +M+ + + YGYEYLGNT RLVITPLTDRCYRTL GA+ L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGLA  GAW+CFDEFNRI+LEVLSV+AQQI TIQRAI  Q +  +FEGTEL+LD +C +FITMNPGYAGRSELPDNLK LFR+VAMMVPDYALIAEISLYS GFV AR LA KIVA YRLCSEQLSSQ HYDYGMRAVKSVLTAAG LK K     E+ ++L+SIIDVNLPKFL  D+PLF+GI SDLFPGV +P+ DY  L + + E    M LE   +F++KI QIYEM++VRHG MIVG+ F GKT A+K L+ ALGD+ ++ L  EN V + I+NPKAI++G LYG+FD VSHEWSDG+LA ++R  A+S + +RKW+IFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQ++   N+IFEP DLE ASPATVSRCGM+YMEP  LG  P+   W++  LP  + D  +     +F   I   +  I +   K       + +V ++L L    +D   +  K S                        ++ +IL      +L   FF +  WS GA  +++ +  FD   R   E+ +    +  R         P  L+  + L  P KGTI+D+ F+ ++    FG W  W  L++  D   + K  + + I++PT DTV+  + +  +L +  KP +FVG TGTGKS  I  F+L+ + NKD    +L  FSAQTS++Q Q+   SKLDRRR+G++ PP  K ++VF+DD++MP +E YGAQPP+E+LRQ +DH  W+D KD T + + D+    AM  P   R  +T R LRH N I I+EF DETM  IF  I++WH     F    K     ++ AT D+++S M + LPTPAKSHY+FNLRDFSRVIQG LL     L N  +E ++ K  RLW HE +RV++DRL++ +D + FF  I++V      E F +LF   DF  D K  T  ++R L++ DF  AK    E               Y E+TD E L +T++ YLDEYN MSK PM+LVLFRFAIEH++RI R+L+QP  H+LLVG+GGSGRQS  +LA  + D+++FQ+E++++Y+ ++WR+D++R++R + +      FLF D+QIK+  FLEDIN LLN+G++PNL+  +++  +    +     + +  Q + + + +YN F++RVR  LH+VL  SPIGDAF +RLR FPSL+NCCTI+WFQ WPEDAL  VA + L++VE+ Q +++  + +C+ FH S   LS+K+   + R NYVTPTSYLELI TF NLL+KK+ E+   K RY VGLEKL+ + + IS+MQ EL+ +QP+L+E SKE +K + I+E ++ E  K  K+VK EEA    +A+ A++IK++C+++LAEA+P++ +A++AL+TL   DI+IV+ M +PP GV+LVMEAVC+LKG+KP++  DPSG  K +ED+W  +K+LLG++KFL+ LK++DKD IP   M+ IR +Y+ N  F P +I   S+ACEGLC WV A+E YD++ KVV+PKK  L  A + Y T M+ L  K+  L EV+ KL  L E  ++ ++ K DLEN ++L   K+ RAE+LI GLGGEK RW +   DL +RF N+ GD+LL +G+VAYLG FT  +R E  + W ++    SIP S + +      LGDPV +R W IYGLP D FS++N +I++++ RW L+IDPQGQANKWIK +E ++N L+VIKL+D  ++R+LENC+QFGTP LLEN+GEELD +LE +LLKQTFKQ     I+LGD ++EYS DFRFYITT+LRNPHYLPE SVKVTL+NFMITP GL+DQ+LGIV ++E+PELE+ + +LI +SA+N+++LKE+ED+IL +LSTS+GNILEDE AI++L+SSK LS +I+ KQ    +TE +I+  R GY P+A H +ILFF+I+DLA++DPMYQYSL+WFINL+  SI+NSE S +++ RL+NL S+FT ++Y N+CRSLFEKDKLLFSF+LC  I K  + + E  WRFLLTGG+ LD+P +NP   WL  KSW+E+  L +L  F G  + F+     WK I DS  PH ++ P +W ERL     ++ V+RCL P+K++ A+ +++   +G +Y+EPP FDL  SF +S+  +P++F+LSPG DPM+ L +FA+ +       + +SLGQGQGPIA   I   +K   W++LQNCHLA SW+  L K  EE  L     +P+FRLWLTSYPSS FPV +LQN VKMTNEPPKGLR N+ RSY + PISD +FF  SK    ++KLLF LCFFHA+VQERR +G IGWNI YEFN++DL+IS++QL MFI+ Y+ VQ +AL YLTGECNYGGRVTD+ DRR ++++L   Y  ++     +   +SG Y  P    D   Y+ +IK  P N  P VFG+H NA++ K+ QET  LF+SIL+T  +  SG  KS+  I++++++D+L++LP  F  E +  KYP  YE+ MNTVL+QE++RFN L+  IR SL +++ A++GL++M + LEEV  SM+  K+P +W + SYPSLKPLGSY++D +AR+KF  +W DNG P  FW+SGFYFTQ+FLTGV QNYAR+    ID L FD+ I++   Y +  ++GA++ GL+L+  RW  +   + ESH KVL D +PVI + P  KS I  + SY  P+YKT+ RRG LSTTGHSTN+V  + LP+ +  +HWI RG+A LCQL+D
BLAST of dynein heavy chain 3, axonemal vs. Planmine SMEST
Match: SMESG000012956.1 (SMESG000012956.1)

HSP 1 Score: 3398.22 bits (8810), Expect = 0.000e+0
Identity = 1843/3972 (46.40%), Postives = 2596/3972 (65.36%), Query Frame = 3
            N +K +   +L  ++P++      + K+++  SVKKAI+D++L    E++       +   +P  R+E+     PW    + + ++ QK  Y T+  + ++L  +   +  LRL+ +E    + T + L D    C ++ +   + L   W+ D + I      + + ++P   ++    +ERFFNC +TL ++ L+ +  +S+ ++   ++    ++    +        +++  SI  +    DL   + HP            + F PS +     L  + D ++  +S  +R+E+ L+    G  +  + L+ +   E +  +K  +R+ +   S  P ++ + +  +R L+N+  +          +  H F    K L DY   ++K++  S  +  L       +F L C+ + + L  R++ +    L+ +    R  NR +  +Y+ I R+       T Q++EL ++V       ++ L+ KL+K+   ++FL++Y    T D+ LN + F  ++R+  I D +  N+ +++E     L+  +++F+E L   + Q++EF      N++N  ++  Q LD    KL   I   +  N+EE      V T Y   QE+  +  P+ KL+++AV F+  Y  WM G + +V+ ++V+A+  + ++T ++L K F +     P + A  +K K+E+FK ++P+IQ L  PGL+ RHW  +S+ VG+ +       LS ++ M L+  +     +S  A KEF+LEKA  +M+N+W  + F    Y+ETG  IL +VDDIQ++L+DHIVKT TMR SPFI PFE+EI  W+  L  ++D L+ WLKVQA WLYLEPIF S DI  Q+P EG +F  VD+ W+ IM +V  D +V+ VI+ + +L+ L+ S  LLE I KGLN YLEKKRLYFPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGI+ L FTE   IT M S+E+E V     I   +A G VEKW+L++E  M  S+R  + + L  Y    R +WV+ W GQ VLA S  +WT    +AIK     L+ +LK N+ QI  IV LVR + L    R TL+A IVLDVHARDV+  L+  +V++E+DF W+ Q+RYYW          +N++ +M+ + + YGYEYLGNT RLVITPLTDRCYRTL GA+ L+LGGAPEGPAGTGKTET+KDLAKAVAKQCVVFNCSDGLDY ++GKFFKGLA  GAW+CFDEFNRI+LEVLSV+AQQI TIQRAI  Q +  +FEGTEL+LD +C +FITMNPGYAGRSELPDNLK LFR+VAMMVPDYALIAEISLYS GFV AR LA KIVA YRLCSEQLSSQ HYDYGMRAVKSVLTAAG LK K     E+ ++L+SIIDVNLPKFL  D+PLF+GI SDLFPGV +P+ DY  L + + E    M LE   +F++KI QIYEM++VRHG MIVG+ F GKT A+K L+ ALGD+ ++ L  EN V + I+NPKAI++G LYG+FD VSHEWSDG+LA ++R  A+S + +RKW+IFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQ++   N+IFEP DLE ASPATVSRCGM+YMEP  LG  P+   W++  LP  + D  +     +F   I   +  I +   K       + +V ++L L    +D   +  K S                        ++ +IL      +L   FF +  WS GA  +++ +  FD   R   E+ +    +  R         P  L+  + L  P KGTI+D+ F+ ++    FG W  W  L++  D   + K  + + I++PT DTV+  + +  +L +  KP +FVG TGTGKS  I  F+L+ + NKD    +L  FSAQTS++Q Q+   SKLDRRR+G++ PP  K ++VF+DD++MP +E YGAQPP+E+LRQ +DH  W+D KD T + + D+    AM  P   R  +T R LRH N I I+EF DETM  IF  I++WH     F    K     ++ AT D+++S M + LPTPAKSHY+FNLRDFSRVIQG LL     L N  +E ++ K  RLW HE +RV++DRL++ +D + FF  I++V      E F +LF   DF  D K  T  ++R L++ DF  AK    E               Y E+TD E L +T++ YLDEYN MSK PM+LVLFRFAIEH++RI R+L+QP  H+LLVG+GGSGRQS  +LA  + D+++FQ+E++++Y+ ++WR+D++R++R + +      FLF D+QIK+  FLEDIN LLN+G++PNL+  +++  +    +     + +  Q + + + +YN F++RVR  LH+VL  SPIGDAF +RLR FPSL+NCCTI+WFQ WPEDAL  VA + L++VE+ Q +++  + +C+ FH S   LS+K+   + R NYVTPTSYLELI TF NLL+KK+ E+   K RY VGLEKL+ + + IS+MQ EL+ +QP+L+E SKE +K + I+E ++ E  K  K+VK EEA    +A+ A++IK++C+++LAEA+P++ +A++AL+TL   DI+IV+ M +PP GV+LVMEAVC+LKG+KP++  DPSG  K +ED+W  +K+LLG++KFL+ LK++DKD IP   M+ IR +Y+ N  F P +I   S+ACEGLC WV A+E YD++ KVV+PKK  L  A + Y T M+ L  K+  L EV+ KL  L E  ++ ++ K DLEN ++L   K+ RAE+LI GLGGEK RW +   DL +RF N+ GD+LL +G+VAYLG FT  +R E  + W ++    SIP S + +      LGDPV +R W IYGLP D FS++N +I++++ RW L+IDPQGQANKWIK +E ++N L+VIKL+D  ++R+LENC+QFGTP LLEN+GEELD +LE +LLKQTFKQ     I+LGD ++EYS DFRFYITT+LRNPHYLPE SVKVTL+NFMITP GL+DQ+LGIV ++E+PELE+ + +LI +SA+N+++LKE+ED+IL +LSTS+GNILEDE AI++L+SSK LS +I+ KQ    +TE +I+  R GY P+A H +ILFF+I+DLA++DPMYQYSL+WFINL+  SI+NSE S +++ RL+NL S+FT ++Y N+CRSLFEKDKLLFSF+LC  I K  + + E  WRFLLTGG+ LD+P +NP   WL  KSW+E+  L +L  F G  + F+     WK I DS  PH ++ P +W ERL     ++ V+RCL P+K++ A+ +++   +G +Y+EPP FDL  SF +S+  +P++F+LSPG DPM+ L +FA+ +       + +SLGQGQGPIA   I   +K   W++LQNCHLA SW+  L K  EE  L     +P+FRLWLTSYPSS FPV +LQN VKMTNEPPKGLR N+ RSY + PISD +FF  SK    ++KLLF LCFFHA+VQERR +G IGWNI YEFN++DL+IS++QL MFI+ Y+ VQ +AL YLTGECNYGGRVTD+ DRR ++++L   Y  ++     +   +SG Y  P    D   Y+ +IK  P N  P VFG+H NA++ K+ QET  LF+SIL+T  +  SG  KS+  I++++++D+L++LP  F  E +  KYP  YE+ MNTVL+QE++RFN L+  IR SL +++ A++GL++M + LEEV  SM+  K+P +W + SYPSLKPLGSY++D +AR+KF  +W DNG P  FW+SGFYFTQ+FLTGV QNYAR+    ID L FD+ I++   Y +  ++GA++ GL+L+  RW  +   + ESH KVL D +PVI + P  KS I  + SY  P+YKT+ RRG LSTTGHSTN+V  + LP+ +  +HWI RG+A LCQL+D
BLAST of dynein heavy chain 3, axonemal vs. Planmine SMEST
Match: SMESG000065732.1 (SMESG000065732.1)

HSP 1 Score: 3315.78 bits (8596), Expect = 0.000e+0
Identity = 1814/3958 (45.83%), Postives = 2532/3958 (63.97%), Query Frame = 3
            ++ LI+ KQNF  S+K++++   L    +  LE   L       I +   +E   WH   ++++E L K     +  + KLLS     + E  +  +  +     +    L    +   +K    +   W      I     S+  IE  +  S          F+NC   L SN ++ ++  ++  +V+  +        EG               IL+++LN D   S+ + F P++D + + +  II+ I  S+ +   ++ +    +   P   FI ++L     +   KE+LR       E P +Y   IY   + YL+N   E +  +F+N +    +Y   +EK + ++ +   LP     HL  L+CE +   L+  + +L  I LN +    R  N  I  ++++I +      ET+ +L +L  Y+E+ R   +I L  K+  +   + +LL+      +D+ LN+  FTW  +I PI D +       + +    L + +++ +  L   K ++ EFN+  +++  +  +  Q++  +  KL E  +E   IN EE L     ++ + +++EI    +PF +L++  + + K   KW++G   ++ A+++EAE   +++  +++ K F++   K  M                                      C+ T+  ++ +FK  +P+I  LC PG+K+RHWD MS+    DITP   T L+ +LAMGLD ++E+  ++S+ AS+EF+LE    +M+ +W+ + FS T Y+E+G++IL +VDDIQ LL+D IVKT TMR SPFI PFE+EI  W++ L    + ++ WLKVQA WLYLEPIF S DI +Q+P EG  F+ VD  W+ IM     D  VM    F  +LE L+ S  LLE+I KGLN YLEKKRL+FPRFFFLSN+E+LEILSETKDPLRVQPHLKKCFEGI+KL+F  +  I  M S+E+E++K +  I   EA G VE+W+LQV+  M  S+R+V+  +   Y   +R +WV +W GQVVL  S ++WT +   A++     L  + +K ++QIS IV+LVR + L +  RITL A + +DVHARDVV  +    V SE+DFNW+SQ+RYYW          +N ++R+    V Y YEYLGN+ RLVITPLTDRCYRTL+GA  LNL GAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY +MGKFFKGLA SGAWACFDEFNRIELEVLSV+AQQI  I RAI+  +E F+FEGTELRL+++C + ITMNPGYAGRSELPDNLKVLFR VAMMVPDYA+I EISLYS GF++AR+LA KIV  YRLCSEQLSSQ HYDYGMRAVK+VL+AAG LK K     E  ++L+SI+DVNLPKFL  DIPLF GIISDLFPGV  P  DY    + + E      L+ V +F +KIIQ YEM++VRHG M+VG+ F GKT     L+ A+  LN+E N E   VI+  INPK+I++G L+G+FD VSHEW+DGI A TFRE AS+++ +RKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQM+   ++IFE  DL QASPATVSRCGMIY++P  +G  P+   W+    PE L  D     + +LF W +   L F+ + CK  +  GS+ LV N+L L   ++                               K   E E + E R N  I   + +  ++ WS G +LD DS+ KFD FFR   E+    N+ +P PK +     +M+P+ G ++D+ +  K  G W  W       DL++ +   E  NI   L+PT+DT R +F +   +++ R+ +MFVG TGTGKS   +  +++ LP   ++   + FSAQTS++Q Q    SKLDRRR+G++ PP  K  V+F+DD++MP KE YGAQPP+E+LRQ  DH  W+D KD T ++++D+ +  AM  P   R  VT R LRHFN++++  F D+TM  IF  +M  +   G E T   L+  + +V AT +++++ +++ LPTPAKSHYVFNLRDFSRVI G  L+K        Q +      RLWVHE  RVF+DRLI   D +  ++L+K+ ++  FKE F VLF   +T    P   E +R LMFGD++     P             E ++Y E+ +    +  ++  +DEYN   K  M LV+FR+ +EH++RICR+L  P G++LLVG+GGSGRQS  +LA  + +  +FQ E+++ Y   +WR+D++ L++  G +G  T FL  D QIK+  FLEDI+ LLN+G++PNLF  E++ E+IE ++Q  Q  N   + + + ++  F+ R R+ LH+V+ FSPIG AF +RLR FP+LINCCTI+WFQ WPEDAL+ VA K+L+ V+++ D+R   V + +HFH SV +LS++F++ +GR NYVTPTSYLELI +F  LLN KQ E +  K+RY  GL+KL F+  Q+S MQ++L+  QPQL++  K  E L+  I  E++  E  R  VK EE     KA+ +K++ D+C ++LAEA+P + AA+ ALDTL+  DI+IVK MQNPP GVKLVME +CI++ +KPE+  DP+  GK M DYW  +KKLLGD+ FL +L+ YDKD I    M KIR ++I NP FDP+K+   SSA EGLC W+ A+E YDR+ KVV+PKK KLA AES  +  M +L   Q +L  VE KL  L++  ++ + EK  L+  +EL   K+ERA+KLI GLGGEK RW +   +L   +DN+IGDVLL AG++AYLGPFT  YR +C+  W   CKS  IP S + + +    LG+PV+++ W I+GLP DSFS+DN+VIV +  RW L+IDPQ QANKWIK +E E   L VIKL+D  ++R LEN +QFG P LLENVGEELD  LE +LLKQ FKQ+ V+ +RLG+ ++EYS++FR YITT+LRNPHYLPE +VKV+L+NFMIT  GLEDQ+LGIV AKEKPELE  R +LII SA+NRR LKE ED+IL  LS S+GNILE+E AI+IL SSK +S+ I  KQE A +T+ +I+  R  Y P+A H +ILFF+I+DL ++DPMYQYSLSWF+NLYI+SI +S  S  ++ RL+ L+ HFT ++Y N+CRSLFEKDKLLFSFLLC  I   +  ++   + FLLTGG+ L++   NP   WLS+KSW+E+  L++L+ FKG+ + F  N++ W++  DSK P   K P  W  +L   + L+V+RC+ P+K++PA+ +Y+   LG +++EPP FDL  SF++S    P+IFVLSPG DP   L +FAE K    +    +SLGQGQGPIA   I E+ +   W++LQNCHLA SW+  + KICEE+  + +  N  FRLWLTSYPS  FPV VLQN VKMTNEPP GLR NL +S+    IS+ +FF     +   FEKLLF LCFFHA+VQERR +G +GWNIPY FNDSDL+IS RQLQMF+N+YE V  +A+ YLTGECNYGGRVTD+ DRR +M++L   Y++ +++   +  + SGTY+VP    +   Y+  IK  P    PEVFG+H N ++ +E Q++  L +S+L+TL +  S    SS+  + ++A+DIL K+P  F +E+  + YPV Y E MNTVL+QE+ RFNKL   IR+SL +L  A++GL++M   LE +  S+++GK+P++WS+YSYPSLKPLGSYI+DLI R+ F Q W + G+P TFWVSGFYFTQ+FLTGV+QN+AR+    ID L FDF +++    +   ++GA+I GL+L+  RW+ E   L E   KVLY+ +PVI + P  +  I+  EN Y CPVYKT+ R+GVLSTTGHSTN+V  + LP+ + V HW+ RG A LCQL+D
BLAST of dynein heavy chain 3, axonemal vs. Planmine SMEST
Match: SMESG000065732.1 (SMESG000065732.1)

HSP 1 Score: 3294.98 bits (8542), Expect = 0.000e+0
Identity = 1818/4005 (45.39%), Postives = 2535/4005 (63.30%), Query Frame = 3
            ++ LI+ KQNF  S+K++++   L    +  LE   L       I +   +E   WH   ++++E L K     +  + KLLS     + E  +  +  +     +    L    +   +K    +   W      I     S+  IE  +  S          F+NC   L SN ++ ++  ++  +V+  +        EG               IL+++LN D   S+ + F P++D + + +  II+ I  S+ +   ++ +    +   P   FI ++L     +   KE+LR       E P +Y   IY   + YL+N   E +  +F+N +    +Y   +EK + ++ +   LP     HL  L+CE +   L+  + +L  I LN +    R  N  I  ++++I +      ET+ +L +L  Y+E+ R   +I L  K+  +   + +LL+      +D+ LN+  FTW  +I PI D +       + +    L + +++ +  L   K ++ EFN+  +++  +  +  Q++  +  KL E  +E   IN EE L     ++ + +++EI    +PF +L++  + + K   KW++G   ++ A+++EAE   +++  +++ K F++   K  M                                      C+ T+  ++ +FK  +P+I  LC PG+K+RHWD MS+    DITP   T L+ +LAMGLD ++E+  ++S+ AS+EF+LE    +M+ +W+ + FS T Y+E+G++IL +VDDIQ LL+D IVKT TMR SPFI PFE+EI  W++ L    + ++ WLKVQA WLYLEPIF S DI +Q+P EG  F+ VD  W+ IM     D  VM    F  +LE L+ S  LLE+I KGLN YLEKKRL+FPRFFFLSN+E+LEILSETKDPLRVQPHLKKCFEGI+KL+F  +  I  M S+E+E++K +  I   EA G VE+W+LQV+  M  S+R+V+  +   Y   +R +WV +W GQVVL  S ++WT +   A++     L  + +K ++QIS IV+LVR + L +  RITL A + +DVHARDVV  +    V SE+DFNW+SQ+RYYW          +N ++R+    V Y YEYLGN+ RLVITPLTDRCYRTL+GA  LNL GAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY +MGKFFKGLA SGAWACFDEFNRIELEVLSV+AQQI  I RAI+  +E F+FEGTELRL+++C + ITMNPGYAGRSELPDNLKVLFR VAMMVPDYA+I EISLYS GF++AR+LA KIV  YRLCSEQLSSQ HYDYGMRAVK+VL+AAG LK K     E  ++L+SI+DVNLPKFL  DIPLF GIISDLFPGV  P  DY    + + E      L+ V +F +KIIQ YEM++VRHG M+VG+ F GKT     L+ A+  LN+E N E   VI+  INPK+I++G L+G+FD VSHEW+DGI A TFRE AS+++ +RKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQM+   ++IFE  DL QASPATVSRCGMIY++P  +G  P+   W+    PE L  D     + +LF W +   L F+ + CK  +  GS+ LV N+L L   ++                               K   E E + E R N  I   + +  ++ WS G +LD DS+ KFD FFR   E+    N+ +P PK +     +M+P+ G ++D+ +  K  G W  W       DL++ +   E  NI   L+PT+DT R +F +   +++ R+ +MFVG TGTGKS   +  +++ LP   ++   + FSAQTS++Q Q    SKLDRRR+G++ PP  K  V+F+DD++MP KE YGAQPP+E+LRQ  DH  W+D KD T ++++D+ +  AM  P   R  VT R LRHFN++++  F D+TM  IF  +M  +   G E T   L+  + +V AT +++++ +++ LPTPAKSHYVFNLRDFSRVI G  L+K        Q +      RLWVHE  RVF+DRLI   D +  ++L+K+ ++  FKE F VLF   +T    P   E +R LMFGD++     P             E ++Y E+ +    +  ++  +DEYN   K  M LV+FR+ +EH++RICR+L  P G++LLVG+GGSGRQS  +LA  + +  +FQ E+++ Y   +WR+D++ L++  G +G  T FL  D QIK+  FLEDI+ LLN+G++PNLF  E++ E+IE ++Q  Q  N   + + + ++  F+ R R+ LH+V+ FSPIG AF +RLR FP+LINCCTI+WFQ WPEDAL+ VA K+L+ V+++ D+R   V + +HFH SV +LS++F++ +GR NYVTPTSYLELI +F  LLN KQ E +  K+RY  GL+KL F+  Q+S MQ++L+  QPQL++  K  E L+  I  E++  E  R  VK EE     KA+ +K++ D+C ++LAEA+P + AA+ ALDTL+  DI+IVK MQNPP GVKLVME +CI++ +KPE+  DP+  GK M DYW  +KKLLGD+ FL +L+ YDKD I    M KIR ++I NP FDP+K+   SSA EGLC W+ A+E YDR+ KVV+PKK KLA AES  +  M +L   Q +L  VE KL  L++  ++ + EK  L+  +EL   K+ERA+KLI GLGGEK RW +   +L   +DN+IGDVLL AG++AYLGPFT  YR +C+  W   CKS  IP      FSL++ LG+PV+++ W I+GLP DSFS+DN+VIV +  RW L+IDPQ QANKWIK +E E   L VIKL+D  ++R LEN +QFG P LLENVGEELD  LE +LLKQ FKQ+ V+ +RLG+ ++EYS++FR YITT+LRNPHYLPE +VKV+L+NFMIT  GLEDQ+LGIV AKEKPELE  R +LII SA+NRR LKE ED+IL  LS S+GNILE+E AI+IL SSK +S+ I  KQE A +T+ +I+  R  Y P+A H +ILFF+I+DL ++DPMYQYSLSWF+NLYI+SI +S  S                                       +D+ I        RL+ L+ HFT ++Y N+CRSLFEKDKLLFSFLLC  I   +  ++   + FLLTGG+ L++   NP   WLS+KSW+E+  L++L+ FKG+ + F  N++ W++  DSK P   K P  W  +L   + L+V+RC+ P+K++PA+ +Y+   LG +++EPP FDL  SF++S    P+IFVLSPG DP   L +FAE K    +    +SLGQGQGPIA   I E+ +   W++LQNCHLA SW+  + KICEE+  + +  N  FRLWLTSYPS  FPV VLQN VKMTNEPP GLR NL +S+    IS+ +FF     +   FEKLLF LCFFHA+VQERR +G +GWNIPY FNDSDL+IS RQLQMF+N+YE V  +A+ YLTGECNYGGRVTD+ DRR +M++L   Y++ +++   +  + SGTY+VP    +   Y+  IK  P    PEVFG+H N ++ +E Q++  L +S+L+TL +  S    SS+  + ++A+DIL K+P  F +E+  + YPV Y E MNTVL+QE+ RFNKL   IR+SL +L  A++GL++M   LE +  S+++GK+P++WS+YSYPSLKPLGSYI+DLI R+ F Q W + G+P TFWVSGFYFTQ+FLTGV+QN+AR+    ID L FDF +++    +   ++GA+I GL+L+  RW+ E   L E   KVLY+ +PVI + P  +  I+  EN Y CPVYKT+ R+GVLSTTGHSTN+V  + LP+ + V HW+ RG A LCQL+D
The following BLAST results are available for this feature:
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH30.000e+050.25dynein axonemal heavy chain 3 [Source:HGNC Symbol;... [more]
DNAH70.000e+046.87dynein axonemal heavy chain 7 [Source:HGNC Symbol;... [more]
DNAH120.000e+046.49dynein axonemal heavy chain 12 [Source:HGNC Symbol... [more]
DNAH10.000e+040.95dynein axonemal heavy chain 1 [Source:HGNC Symbol;... [more]
DNAH60.000e+039.97dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhc-18.062e-17524.43Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-12.139e-17424.48Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-12.139e-17424.48Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
che-33.097e-14131.95Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
dhc-36.446e-6040.90Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhc36C0.000e+043.75gene:FBgn0013810 transcript:FBtr0304742[more]
Dhc62B0.000e+041.95gene:FBgn0013811 transcript:FBtr0303106[more]
kl-20.000e+033.49gene:FBgn0001313 transcript:FBtr0346722[more]
Dnah30.000e+045.23gene:FBgn0035581 transcript:FBtr0289982[more]
CG94920.000e+033.34gene:FBgn0037726 transcript:FBtr0309029[more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah30.000e+050.78dynein axonemal heavy chain 3 [Source:ZFIN;Acc:ZDB... [more]
dnah70.000e+047.08dynein, axonemal, heavy chain 7 [Source:ZFIN;Acc:Z... [more]
dnah120.000e+046.01dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
dnah120.000e+046.46dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
CR450723.10.000e+046.22dynein, axonemal, heavy chain 12 [Source:NCBI gene... [more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttc21a0.000e+052.28tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
ttc21a0.000e+052.10tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
ttc21a0.000e+056.74tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
ttc21a8.181e-655.70tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
ttc21a0.000e+055.70tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah30.000e+050.69dynein, axonemal, heavy chain 3 [Source:MGI Symbol... [more]
Dnah30.000e+050.20dynein, axonemal, heavy chain 3 [Source:MGI Symbol... [more]
Dnah7c0.000e+047.07dynein, axonemal, heavy chain 7C [Source:MGI Symbo... [more]
Dnah7b0.000e+047.12dynein, axonemal, heavy chain 7B [Source:MGI Symbo... [more]
Dnah7b0.000e+047.12dynein, axonemal, heavy chain 7B [Source:MGI Symbo... [more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BW94|DYH3_MOUSE0.000e+050.20Dynein heavy chain 3, axonemal OS=Mus musculus OX=... [more]
sp|Q8TD57|DYH3_HUMAN0.000e+050.25Dynein heavy chain 3, axonemal OS=Homo sapiens OX=... [more]
sp|Q8WXX0|DYH7_HUMAN0.000e+046.87Dynein heavy chain 7, axonemal OS=Homo sapiens OX=... [more]
sp|Q63170|DYH7_RAT0.000e+046.57Dynein heavy chain 7, axonemal OS=Rattus norvegicu... [more]
sp|E9Q8T7|DYH1_MOUSE0.000e+040.44Dynein heavy chain 1, axonemal OS=Mus musculus OX=... [more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R2MQX71.101e-757.18dynein heavy chain 3, axonemal OS=Lingula unguis O... [more]
V3ZCU10.000e+058.04Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
W4ZLH00.000e+055.99Uncharacterized protein OS=Strongylocentrotus purp... [more]
A0A1I8J3K80.000e+056.32Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0L8FUX50.000e+055.38Uncharacterized protein OS=Octopus bimaculoides OX... [more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah120.000e+046.24dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
dnah20.000e+035.38dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
si:dkeyp-86b9.10.000e+033.78dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
DNAH110.000e+032.41dynein axonemal heavy chain 11 [Source:HGNC Symbol... [more]
ENSAMXT00000016172.20.000e+032.75pep primary_assembly:Astyanax_mexicanus-2.0:4:1379... [more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001140.10.000e+043.69pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 ge... [more]
ENSPMAT00000003955.10.000e+041.62pep scaffold:Pmarinus_7.0:GL495754:4342:49943:-1 g... [more]
DNAH60.000e+039.81dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
ENSPMAT00000009595.10.000e+031.58pep scaffold:Pmarinus_7.0:GL478108:144315:184457:1... [more]
ENSPMAT00000003938.10.000e+049.84pep scaffold:Pmarinus_7.0:GL495754:984:26133:-1 ge... [more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYN12.754e-10227.75Cytoplasmic heavy chain dynein; microtubule motor ... [more]
back to top
BLAST of dynein heavy chain 3, axonemal vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5