Receptor-type tyrosine-protein phosphatase eta

Overview
NameReceptor-type tyrosine-protein phosphatase eta
Smed IDSMED30004027
Length (bp)3530
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Receptor-type tyrosine-protein phosphatase eta (SMED30004027) t-SNE clustered cells

Violin plots show distribution of expression levels for Receptor-type tyrosine-protein phosphatase eta (SMED30004027) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Receptor-type tyrosine-protein phosphatase eta (SMED30004027) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Receptor-type tyrosine-protein phosphatase eta (SMED30004027) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004027

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30004027SMESG000068004.1 SMESG000068001.1 SMESG000067998.1 SMESG000049225.1 SMESG000049064.1 SMESG000048842.1 SMESG000009365.1 SmedASXL_018044SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30004027SMESG000068004.1 SMESG000068001.1 SMESG000049225.1 SMESG000049064.1 SMESG000048842.1 dd_Smed_v4_2577_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004027SMESG000067957.1 dd_Smed_v4_10477_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004027SMESG000067946.1 SMESG000067957.1 SMESG000068004.1 SMESG000067998.1 SMESG000049225.1 SMESG000068001.1 SMESG000049064.1 SMESG000048842.1 dd_Smed_v6_2577_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Human
Match: PTPRF (protein tyrosine phosphatase receptor type F [Source:HGNC Symbol;Acc:HGNC:9670])

HSP 1 Score: 144.05 bits (362), Expect = 3.362e-34
Identity = 103/324 (31.79%), Postives = 161/324 (49.69%), Query Frame = 3
Query: 2520 FNTQTSKNEILESPVTSSDINEQSITTNKRKMVETLSDQFEKL-----MKESKDQESLLHLTTSKGENAN---KFKKNRFVNIIPYDQNRVKVGE-EEYPG-NYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDC-RKEITQFHMNTWLDECAPNIEYFNKFL--FRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYLTCGQNQ 3440
             N QT  + +   P TSS  +   I       +  L+D  E+L     +K S++ ES+        EN+N      KNR+ N+I YD +RV +   +  PG +YINA+YI  D    +  YIATQGP   T+ +FW+M+W++    ++M+T+L++ +     QYWP +  +   +    + LLD ++   +  R   +       ++E+ QF    W D   P  EY    L   R  K  +     P +VHCS+G+ +TG FI ID +  ++ K EK V+I+  V  +R  R  MVQ + Q+ FIHE     L +  TCG  +
Sbjct:  380 LNYQTPGSSVPSCPNTSSMRDHPPIP------ITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVILTSIDGVPGSDYINANYI--DGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPARGTETCGL--IQVTLLDTVELATYTVRTFALHKSGSSEKRELRQFQFMAWPDHGVP--EYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERM-KHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHE----ALLEAATCGHTE 686          

HSP 2 Score: 126.331 bits (316), Expect = 1.072e-28
Identity = 86/270 (31.85%), Postives = 135/270 (50.00%), Query Frame = 3
Query: 2643 KLMKESKDQESLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKV----GEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCR-KEITQFHMNTWLDECAPNI-EYFNKFLFRFHKVASN-ASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKY 3419
            KL+  SK   S      S     NKFK NR VNI+PY+  RV +    G E    +YINAS++  D    +  YIATQGP   + ++FW+M+W+ N   I+MLTKL +       QYWP +         F +  + +     ++ R+  ++D  D + + I QF    W ++  P   E F  F+ + HK       + P  VHCS+G+ +TG FI +  +  ++ + E +V++F+TV  LR  R  MVQ + Q+   +     +L  +
Sbjct:  716 KLLASSKAHTSRF---ISANLPCNKFK-NRLVNIMPYELTRVCLQPIRGVEG--SDYINASFL--DGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPAERSARYQY--FVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERM-RYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSF 974          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Human
Match: PTPRF (protein tyrosine phosphatase receptor type F [Source:HGNC Symbol;Acc:HGNC:9670])

HSP 1 Score: 144.436 bits (363), Expect = 3.752e-34
Identity = 105/324 (32.41%), Postives = 162/324 (50.00%), Query Frame = 3
Query: 2520 FNTQTSKNEILESPVTSSDINEQSITTNKRKMVETLSDQFEKL-----MKESKDQESLLHLTTSKGENAN---KFKKNRFVNIIPYDQNRVKVGE-EEYPG-NYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKL-DKNNV---QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDC-RKEITQFHMNTWLDECAPNIEYFNKFL--FRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYLTCGQNQ 3440
             N QT  + +   P TSS  +   I       +  L+D  E+L     +K S++ ES+        EN+N      KNR+ N+I YD +RV +   +  PG +YINA+YI  D    +  YIATQGP   T+ +FW+M+W++    ++M+T+L +K+ V   QYWP +  +   +    + LLD ++   +  R   +       ++E+ QF    W D   P  EY    L   R  K  +     P +VHCS+G+ +TG FI ID +  ++ K EK V+I+  V  +R  R  MVQ + Q+ FIHE     L +  TCG  +
Sbjct:  692 LNYQTPGSSVPSCPNTSSMRDHPPIP------ITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVILTSIDGVPGSDYINANYI--DGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPARGTETCGL--IQVTLLDTVELATYTVRTFALHKSGSSEKRELRQFQFMAWPDHGVP--EYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERM-KHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHE----ALLEAATCGHTE 998          

HSP 2 Score: 127.102 bits (318), Expect = 9.195e-29
Identity = 86/270 (31.85%), Postives = 135/270 (50.00%), Query Frame = 3
Query: 2643 KLMKESKDQESLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKV----GEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCR-KEITQFHMNTWLDECAPNI-EYFNKFLFRFHKVASN-ASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKY 3419
            KL+  SK   S      S     NKFK NR VNI+PY+  RV +    G E    +YINAS++  D    +  YIATQGP   + ++FW+M+W+ N   I+MLTKL +       QYWP +         F +  + +     ++ R+  ++D  D + + I QF    W ++  P   E F  F+ + HK       + P  VHCS+G+ +TG FI +  +  ++ + E +V++F+TV  LR  R  MVQ + Q+   +     +L  +
Sbjct: 1028 KLLASSKAHTSRF---ISANLPCNKFK-NRLVNIMPYELTRVCLQPIRGVEG--SDYINASFL--DGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPAERSARYQY--FVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERM-RYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSF 1286          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Human
Match: PTPRF (protein tyrosine phosphatase receptor type F [Source:HGNC Symbol;Acc:HGNC:9670])

HSP 1 Score: 144.436 bits (363), Expect = 4.543e-34
Identity = 105/324 (32.41%), Postives = 162/324 (50.00%), Query Frame = 3
Query: 2520 FNTQTSKNEILESPVTSSDINEQSITTNKRKMVETLSDQFEKL-----MKESKDQESLLHLTTSKGENAN---KFKKNRFVNIIPYDQNRVKVGE-EEYPG-NYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKL-DKNNV---QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDC-RKEITQFHMNTWLDECAPNIEYFNKFL--FRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYLTCGQNQ 3440
             N QT  + +   P TSS  +   I       +  L+D  E+L     +K S++ ES+        EN+N      KNR+ N+I YD +RV +   +  PG +YINA+YI  D    +  YIATQGP   T+ +FW+M+W++    ++M+T+L +K+ V   QYWP +  +   +    + LLD ++   +  R   +       ++E+ QF    W D   P  EY    L   R  K  +     P +VHCS+G+ +TG FI ID +  ++ K EK V+I+  V  +R  R  MVQ + Q+ FIHE     L +  TCG  +
Sbjct:  733 LNYQTPGSSVPSCPNTSSMRDHPPIP------ITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVILTSIDGVPGSDYINANYI--DGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPARGTETCGL--IQVTLLDTVELATYTVRTFALHKSGSSEKRELRQFQFMAWPDHGVP--EYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERM-KHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHE----ALLEAATCGHTE 1039          

HSP 2 Score: 126.716 bits (317), Expect = 1.060e-28
Identity = 86/270 (31.85%), Postives = 135/270 (50.00%), Query Frame = 3
Query: 2643 KLMKESKDQESLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKV----GEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCR-KEITQFHMNTWLDECAPNI-EYFNKFLFRFHKVASN-ASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKY 3419
            KL+  SK   S      S     NKFK NR VNI+PY+  RV +    G E    +YINAS++  D    +  YIATQGP   + ++FW+M+W+ N   I+MLTKL +       QYWP +         F +  + +     ++ R+  ++D  D + + I QF    W ++  P   E F  F+ + HK       + P  VHCS+G+ +TG FI +  +  ++ + E +V++F+TV  LR  R  MVQ + Q+   +     +L  +
Sbjct: 1069 KLLASSKAHTSRF---ISANLPCNKFK-NRLVNIMPYELTRVCLQPIRGVEG--SDYINASFL--DGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPAERSARYQY--FVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERM-RYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSF 1327          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Human
Match: PTPRJ (protein tyrosine phosphatase receptor type J [Source:HGNC Symbol;Acc:HGNC:9673])

HSP 1 Score: 140.198 bits (352), Expect = 8.020e-33
Identity = 87/244 (35.66%), Postives = 139/244 (56.97%), Query Frame = 3
Query: 2703 ENANKFKKNRFVNIIPYDQNRVKVGEEEYP-GNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKT----GDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPNIEYFN---KFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYI 3398
            E A    KNR+ N++PYD +RVK+  + +   +YINA+Y+P     +K ++IATQGP  NTLK+FW+M+W++NV  IIMLTK  +       +YWP K     GD ++V   S I+L +        + +  S+    R    QFH  +W D   P+        ++L R + +  +    P LVHCS+G+ +TGTFI IDR+  ++ + E  V+++  V +LR  R +MVQ + Q+ F+++ +
Sbjct: 1062 ELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMP--GYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGD-ITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLR----QFHFTSWPDHGVPDTTDLLINFRYLVRDY-MKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQI-ENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV 1296          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Human
Match: PTPRJ (protein tyrosine phosphatase receptor type J [Source:HGNC Symbol;Acc:HGNC:9673])

HSP 1 Score: 140.198 bits (352), Expect = 8.179e-33
Identity = 87/244 (35.66%), Postives = 139/244 (56.97%), Query Frame = 3
Query: 2703 ENANKFKKNRFVNIIPYDQNRVKVGEEEYP-GNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKT----GDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPNIEYFN---KFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYI 3398
            E A    KNR+ N++PYD +RVK+  + +   +YINA+Y+P     +K ++IATQGP  NTLK+FW+M+W++NV  IIMLTK  +       +YWP K     GD ++V   S I+L +        + +  S+    R    QFH  +W D   P+        ++L R + +  +    P LVHCS+G+ +TGTFI IDR+  ++ + E  V+++  V +LR  R +MVQ + Q+ F+++ +
Sbjct: 1066 ELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMP--GYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGD-ITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLR----QFHFTSWPDHGVPDTTDLLINFRYLVRDY-MKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQI-ENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV 1300          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Celegans
Match: Y41D4A.5 (Tyrosine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:Q95Y26])

HSP 1 Score: 135.191 bits (339), Expect = 3.820e-33
Identity = 86/250 (34.40%), Postives = 134/250 (53.60%), Query Frame = 3
Query: 2718 FKKNRFVNIIPYDQNRVKVGEE-EYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNN----VQYWPDKTGDHLSVEGFSIILLDD--LQHDGHVER--KMIISDECDCRKEITQFHMNTWLDECAPNIEY----FNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKI--VNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYL 3422
            + +NR+ +I+PYD+NRV++ ++ E P  Y+NAS I       K E+IA Q P   TL E+W+MI +  V  +++L KL + N     +YWP++ G+      + I L ++     D ++ R  KM      +CRK + Q H   W D   P+ E         +   H+  S   + P LVHCS+G+ +TGT I I+ I R+  K E +  ++IF  V+ LR+ R  MVQ Q QF F+H  I  +  ++L
Sbjct:  127 YARNRYRDILPYDKNRVEIQKDSENPEGYMNASLIQLP--GGKTEFIAAQAPLPATLDEWWKMIDEHRVSLVVILCKLVELNKIKCERYWPEQVGESELFGDYEITLEEEKLFDDDEYLMRCLKMENQTTGECRK-VHQLHYREWPDHGCPSGEKQLLNMIDLMENIHEEVSPQDSSPILVHCSAGVGRTGTIIAINFI-REQMKAETLHSIDIFGLVMTLRKQRASMVQTQDQFQFVHRCIASYCRRHL 372          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Celegans
Match: dep-1 (Receptor-type tyrosine-protein phosphatase dep-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGJ9])

HSP 1 Score: 132.494 bits (332), Expect = 1.030e-32
Identity = 87/238 (36.55%), Postives = 129/238 (54.20%), Query Frame = 3
Query: 2721 KKNRFVNIIPYDQNRVKVGEEE--YPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKL-----DKNNVQYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQF----HMNTWLDECAP----NIEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIH 3389
             KNRF NI  YD +RVK+        G+YINA+Y+P    +++ E+IA QGP   T   FWQM W++    II LTK      DK + QYWPD     +      + ++ + + D  V R + + ++      +T+F    H   W D  AP     I  F++ +FR H +  +  N P +VHCS+G+ ++GTFI IDR+ +  S G+ I ++F TV  +R  R  MVQN+ Q+ FIH
Sbjct:  146 PKNRFTNIPSYDHSRVKLSNPNNIEGGDYINANYVP--GFSSRREFIAAQGPLPTTRDHFWQMTWEQQCPAIIALTKCVEKGRDKCH-QYWPDHENVPVLYGDIEVTIVAEKEFDEFVIRDIRL-EKSGPDGRVTRFVRHWHYMAWPDFGAPSHPNGIIQFSR-MFR-HHLPHSPHNAPTIVHCSAGVGRSGTFISIDRLLQSSSFGDPI-DVFGTVCEMRYERCQMVQNEQQYIFIH 376          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Celegans
Match: dep-1 (Receptor-type tyrosine-protein phosphatase dep-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGJ9])

HSP 1 Score: 134.42 bits (337), Expect = 1.722e-31
Identity = 89/244 (36.48%), Postives = 132/244 (54.10%), Query Frame = 3
Query: 2724 KNRFVNIIPYDQNRVKVGEEE--YPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKL-----DKNNVQYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQF----HMNTWLDECAPN----IEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFL 3410
            KNRF NI  YD +RVK+        G+YINA+Y+P    +++ E+IA QGP   T   FWQM W++    II LTK      DK + QYWPD     +      + ++ + + D  V R + + ++      +T+F    H   W D  AP+    I  F++ +FR H +  +  N P +VHCS+G+ ++GTFI IDR+ +  S G+ I ++F TV  +R  R  MVQN+ Q+ FIH  I   L
Sbjct: 1099 KNRFTNIPSYDHSRVKLSNPNNIEGGDYINANYVP--GFSSRREFIAAQGPLPTTRDHFWQMTWEQQCPAIIALTKCVEKGRDKCH-QYWPDHENVPVLYGDIEVTIVAEKEFDEFVIRDIRL-EKSGPDGRVTRFVRHWHYMAWPDFGAPSHPNGIIQFSR-MFR-HHLPHSPHNAPTIVHCSAGVGRSGTFISIDRLLQSSSFGDPI-DVFGTVCEMRYERCQMVQNEQQYIFIHYCILQVL 1335          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 129.798 bits (325), Expect = 5.980e-30
Identity = 85/240 (35.42%), Postives = 126/240 (52.50%), Query Frame = 3
Query: 2724 KNRFVNIIPYDQNRVKVGE-EEYPG-NYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDK-TGDHLSVEGFSIILLDDLQHDGHVERKMIIS--DECDCRKEITQFHMNTWLDECAPN-IEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLN 3413
            KNR+ N+  YD +RV +   E YPG +YINA+Y+  D       YIATQGP   T  +FW+M+W+E    I+MLT L++ +     QYWP + T  +  +E   + LL+ +    +  R M +    E + R EI       W D   P+    F  FL R   +  N +  P + HCS+GI +TG FI ID +  +L + +  V+I+  V  LR  R  MVQ + Q+ FIH+ +   +N
Sbjct:  960 KNRYANVAAYDHSRVVLSNVEGYPGMDYINANYV--DGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIE---VTLLESVHLAHYTMRTMRLKMVGEPEVR-EIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAG-PIISHCSAGIGRTGAFIVIDCMLERL-RYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVN 1191          

HSP 2 Score: 120.939 bits (302), Expect = 3.224e-27
Identity = 93/290 (32.07%), Postives = 141/290 (48.62%), Query Frame = 3
Query: 2625 LSDQFEKLMKESKDQESLL-----HLTTSKGEN-----AN---KFKKNRFVNIIPYDQNRVKVGEEEYPG----NYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNVQ----YWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCR--KEITQFHMNTWLDECAPNI-EYFNKFLFRFHKV-ASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKY 3419
            L      L + S DQ S +     HLTT K  +     AN      KNR ++ +PYD NRV +     PG    +YINAS+I  D    +  YIATQ PT  T  +FW+ IW+ N   I ML + ++   +    YWP +TG  + +     +   D++H  +  R+  ISD  + R  + + QFH   W D   P+  ++F  F+ + H   A      P  VHC SG  +T  FI +  I  ++ + E +V++F TV  LR  R+ M+Q   Q+ F++   + +L  Y
Sbjct: 1202 LHQHLHILSQPSADQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIM--RLLPGADGSDYINASWI--DGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKH--YHLREFRISD-INTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRM-RAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAY 1483          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 129.413 bits (324), Expect = 6.293e-30
Identity = 85/240 (35.42%), Postives = 126/240 (52.50%), Query Frame = 3
Query: 2724 KNRFVNIIPYDQNRVKVGE-EEYPG-NYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDK-TGDHLSVEGFSIILLDDLQHDGHVERKMIIS--DECDCRKEITQFHMNTWLDECAPN-IEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLN 3413
            KNR+ N+  YD +RV +   E YPG +YINA+Y+  D       YIATQGP   T  +FW+M+W+E    I+MLT L++ +     QYWP + T  +  +E   + LL+ +    +  R M +    E + R EI       W D   P+    F  FL R   +  N +  P + HCS+GI +TG FI ID +  +L + +  V+I+  V  LR  R  MVQ + Q+ FIH+ +   +N
Sbjct:  940 KNRYANVAAYDHSRVVLSNVEGYPGMDYINANYV--DGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIE---VTLLESVHLAHYTMRTMRLKMVGEPEVR-EIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAG-PIISHCSAGIGRTGAFIVIDCMLERL-RYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVN 1171          

HSP 2 Score: 120.553 bits (301), Expect = 3.396e-27
Identity = 93/290 (32.07%), Postives = 141/290 (48.62%), Query Frame = 3
Query: 2625 LSDQFEKLMKESKDQESLL-----HLTTSKGEN-----AN---KFKKNRFVNIIPYDQNRVKVGEEEYPG----NYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNVQ----YWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCR--KEITQFHMNTWLDECAPNI-EYFNKFLFRFHKV-ASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKY 3419
            L      L + S DQ S +     HLTT K  +     AN      KNR ++ +PYD NRV +     PG    +YINAS+I  D    +  YIATQ PT  T  +FW+ IW+ N   I ML + ++   +    YWP +TG  + +     +   D++H  +  R+  ISD  + R  + + QFH   W D   P+  ++F  F+ + H   A      P  VHC SG  +T  FI +  I  ++ + E +V++F TV  LR  R+ M+Q   Q+ F++   + +L  Y
Sbjct: 1182 LHQHLHILSQPSADQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIM--RLLPGADGSDYINASWI--DGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKH--YHLREFRISD-INTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRM-RAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAY 1463          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Fly
Match: Ptp4E (gene:FBgn0004368 transcript:FBtr0343528)

HSP 1 Score: 139.043 bits (349), Expect = 9.471e-33
Identity = 93/269 (34.57%), Postives = 146/269 (54.28%), Query Frame = 3
Query: 2625 LSDQFEKLMKESKDQE-SLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVG--EEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWP-DKT----GDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPN-IEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHE 3392
             S++FE+L    +DQ  S  +L  ++        KNRF NI+PYD +R K+   +++   +YINA+Y+P  N     E+I TQGP  +T +EFW+M W+ N + I+MLT+  +       QYWP D+     GD + V+    +++D   HD  +   M +S  C+ R  +  FH  TW D   P   +   +F+  F  V       P +VHCS+G+ ++GTFI +DRI + + K +  V+IF  V  +R+ R  MVQ + Q+  IH+
Sbjct: 1329 FSEEFEELKHVGRDQACSFANLPCNR-------PKNRFTNILPYDHSRFKLQPVDDDDGSDYINANYMPGHNSPR--EFIVTQGPLHSTREEFWRMCWESNSRAIVMLTRCFEKGREKCDQYWPVDRVAMFYGD-IKVQ----LIIDTHYHDWSISEFM-VSRNCESRI-MRHFHFTTWPDFGVPEPPQSLVRFVRAFRDVIG-TDMRPIIVHCSAGVGRSGTFIALDRILQHIHKSD-YVDIFGIVFAMRKERVFMVQTEQQYVCIHQ 1579          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Fly
Match: Ptp4E (gene:FBgn0004368 transcript:FBtr0070725)

HSP 1 Score: 139.043 bits (349), Expect = 9.937e-33
Identity = 93/269 (34.57%), Postives = 146/269 (54.28%), Query Frame = 3
Query: 2625 LSDQFEKLMKESKDQE-SLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVG--EEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWP-DKT----GDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPN-IEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHE 3392
             S++FE+L    +DQ  S  +L  ++        KNRF NI+PYD +R K+   +++   +YINA+Y+P  N     E+I TQGP  +T +EFW+M W+ N + I+MLT+  +       QYWP D+     GD + V+    +++D   HD  +   M +S  C+ R  +  FH  TW D   P   +   +F+  F  V       P +VHCS+G+ ++GTFI +DRI + + K +  V+IF  V  +R+ R  MVQ + Q+  IH+
Sbjct: 1329 FSEEFEELKHVGRDQACSFANLPCNR-------PKNRFTNILPYDHSRFKLQPVDDDDGSDYINANYMPGHNSPR--EFIVTQGPLHSTREEFWRMCWESNSRAIVMLTRCFEKGREKCDQYWPVDRVAMFYGD-IKVQ----LIIDTHYHDWSISEFM-VSRNCESRI-MRHFHFTTWPDFGVPEPPQSLVRFVRAFRDVIG-TDMRPIIVHCSAGVGRSGTFIALDRILQHIHKSD-YVDIFGIVFAMRKERVFMVQTEQQYVCIHQ 1579          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Fly
Match: Ptp4E (gene:FBgn0004368 transcript:FBtr0343529)

HSP 1 Score: 139.043 bits (349), Expect = 1.038e-32
Identity = 93/269 (34.57%), Postives = 146/269 (54.28%), Query Frame = 3
Query: 2625 LSDQFEKLMKESKDQE-SLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVG--EEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWP-DKT----GDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPN-IEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHE 3392
             S++FE+L    +DQ  S  +L  ++        KNRF NI+PYD +R K+   +++   +YINA+Y+P  N     E+I TQGP  +T +EFW+M W+ N + I+MLT+  +       QYWP D+     GD + V+    +++D   HD  +   M +S  C+ R  +  FH  TW D   P   +   +F+  F  V       P +VHCS+G+ ++GTFI +DRI + + K +  V+IF  V  +R+ R  MVQ + Q+  IH+
Sbjct: 1329 FSEEFEELKHVGRDQACSFANLPCNR-------PKNRFTNILPYDHSRFKLQPVDDDDGSDYINANYMPGHNSPR--EFIVTQGPLHSTREEFWRMCWESNSRAIVMLTRCFEKGREKCDQYWPVDRVAMFYGD-IKVQ----LIIDTHYHDWSISEFM-VSRNCESRI-MRHFHFTTWPDFGVPEPPQSLVRFVRAFRDVIG-TDMRPIIVHCSAGVGRSGTFIALDRILQHIHKSD-YVDIFGIVFAMRKERVFMVQTEQQYVCIHQ 1579          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Fly
Match: Ptp4E (gene:FBgn0004368 transcript:FBtr0070724)

HSP 1 Score: 139.043 bits (349), Expect = 1.040e-32
Identity = 93/269 (34.57%), Postives = 146/269 (54.28%), Query Frame = 3
Query: 2625 LSDQFEKLMKESKDQE-SLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVG--EEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWP-DKT----GDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPN-IEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHE 3392
             S++FE+L    +DQ  S  +L  ++        KNRF NI+PYD +R K+   +++   +YINA+Y+P  N     E+I TQGP  +T +EFW+M W+ N + I+MLT+  +       QYWP D+     GD + V+    +++D   HD  +   M +S  C+ R  +  FH  TW D   P   +   +F+  F  V       P +VHCS+G+ ++GTFI +DRI + + K +  V+IF  V  +R+ R  MVQ + Q+  IH+
Sbjct: 1329 FSEEFEELKHVGRDQACSFANLPCNR-------PKNRFTNILPYDHSRFKLQPVDDDDGSDYINANYMPGHNSPR--EFIVTQGPLHSTREEFWRMCWESNSRAIVMLTRCFEKGREKCDQYWPVDRVAMFYGD-IKVQ----LIIDTHYHDWSISEFM-VSRNCESRI-MRHFHFTTWPDFGVPEPPQSLVRFVRAFRDVIG-TDMRPIIVHCSAGVGRSGTFIALDRILQHIHKSD-YVDIFGIVFAMRKERVFMVQTEQQYVCIHQ 1579          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Fly
Match: Ptp4E (gene:FBgn0004368 transcript:FBtr0301796)

HSP 1 Score: 139.043 bits (349), Expect = 1.040e-32
Identity = 93/269 (34.57%), Postives = 146/269 (54.28%), Query Frame = 3
Query: 2625 LSDQFEKLMKESKDQE-SLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVG--EEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWP-DKT----GDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPN-IEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHE 3392
             S++FE+L    +DQ  S  +L  ++        KNRF NI+PYD +R K+   +++   +YINA+Y+P  N     E+I TQGP  +T +EFW+M W+ N + I+MLT+  +       QYWP D+     GD + V+    +++D   HD  +   M +S  C+ R  +  FH  TW D   P   +   +F+  F  V       P +VHCS+G+ ++GTFI +DRI + + K +  V+IF  V  +R+ R  MVQ + Q+  IH+
Sbjct: 1329 FSEEFEELKHVGRDQACSFANLPCNR-------PKNRFTNILPYDHSRFKLQPVDDDDGSDYINANYMPGHNSPR--EFIVTQGPLHSTREEFWRMCWESNSRAIVMLTRCFEKGREKCDQYWPVDRVAMFYGD-IKVQ----LIIDTHYHDWSISEFM-VSRNCESRI-MRHFHFTTWPDFGVPEPPQSLVRFVRAFRDVIG-TDMRPIIVHCSAGVGRSGTFIALDRILQHIHKSD-YVDIFGIVFAMRKERVFMVQTEQQYVCIHQ 1579          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Zebrafish
Match: ptprjb.1 (protein tyrosine phosphatase receptor type Jb, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-090304-1])

HSP 1 Score: 136.732 bits (343), Expect = 9.354e-35
Identity = 83/232 (35.78%), Postives = 132/232 (56.90%), Query Frame = 3
Query: 2724 KNRFVNIIPYDQNRVKVGEEEYP-GNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTG--DHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAP-NIEYFNKFLFRFHKVASNASNH-PYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHE 3392
            KNR+ N++PYD +RVK+     P  +YINA+++P  N  ++ E+IA QGP   TL EFW+MIW++NV  I+MLTK ++       +YWP  T   +++SV   S I LDD      +    I + +    + + QFH   W D   P   E    F     +     S H P +VHCS+G+ +TGTFI ID ++ ++ + + +V+I+  V ++R  R +MVQ + Q+ ++H+
Sbjct:   52 KNRYSNVLPYDASRVKLSMCGSPFDDYINANHVPGYN--SRKEFIAAQGPLPVTLNEFWRMIWEKNVYTIVMLTKCNEMGRVKCEKYWPSATSHYNNISVTTTSEIELDDWT----IRDFRIKNVKTAETRYVRQFHFTAWPDHGVPETTEILIDFRHLVREHMDQYSRHSPTVVHCSAGVGRTGTFIAIDHLSFQIER-DSMVDIYGIVHDMRMHRALMVQTEDQYVYLHQ 276          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Zebrafish
Match: ptprjb.2 (protein tyrosine phosphatase receptor type Jb, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131120-137])

HSP 1 Score: 134.035 bits (336), Expect = 7.878e-34
Identity = 80/236 (33.90%), Postives = 132/236 (55.93%), Query Frame = 3
Query: 2721 KKNRFVNIIPYDQNRVKVGEEEYP-GNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNN----VQYWPDKTG--DHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPNIEYFNKFLFRFHKVASNASNH-----PYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHE 3392
            +KNR++N++PYD +RVK+ + E P  +YINA+Y+P  N  ++ E+IA QGP   T+ +FW+MIW+  V  I+MLTK ++       +YWP +T    ++SV   S   LDD        + +   + C+ R    QFH   W D   P      + L  F  +     N      P +VHCS+G+ +TGTFI ID +  ++ + + +V+I+  V ++R  R +MVQ + Q+ ++++
Sbjct:   49 EKNRYLNVLPYDASRVKLLKCENPFDDYINANYVPGYN--SRKEFIAAQGPLPVTINKFWRMIWENKVYTIVMLTKCNELGKVKCEKYWPSETDFYHNISVTTTSETELDDWTIRDFSIKNVETEETCNVR----QFHFTAWPDHGVPET---TEVLIEFRHLVREHMNQYSCTSPTVVHCSAGVGRTGTFIAIDHLISQIER-DSMVDIYGIVHDMRMHRALMVQTEDQYVYLYQ 274          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Zebrafish
Match: ptprb (protein tyrosine phosphatase receptor type b [Source:ZFIN;Acc:ZDB-GENE-101108-3])

HSP 1 Score: 140.969 bits (354), Expect = 3.995e-33
Identity = 96/300 (32.00%), Postives = 157/300 (52.33%), Query Frame = 3
Query: 2550 LESPVTSSDINEQSITTNKRKMVETLSDQFEKLMKESKDQESLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVG--EEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTK-LDKNNVQ---YWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCR--KEITQFHMNTWLDECAPNIEYFNKFLFRFHKVAS---NASNHP--YLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFL 3410
            + SPV +++  E  +   +      LS++FE L    + Q      T +         KNR+ NI+PYD  RV++   E++   +YINA+YIP +N   ++EYIATQGP   T  +FW+M+W++NV  ++M+T+ +++  V+   YWP  + + L      + LL +        R   IS E   R  + + QFH   W D   P+     + L +F +      N +N P   +VHCS+G+ +TGTFI +DR  ++L +    V+I+  V +LR  R  MVQ + Q+ +IH+ +   L
Sbjct: 1586 IRSPVQAANF-ESHLAKLQSDSSYLLSEEFEGLKDVGRIQ------TQNAARLLGNRNKNRYNNILPYDSTRVRLSCLEDDPCSDYINANYIPGNN--FRWEYIATQGPLPGTKDDFWRMVWEQNVHSLVMVTQCVERGMVKCDHYWPTDS-EPLCYGDIVVQLLSEKVFPEWTIRDFKISCESQLRYPRMVRQFHYTIWPDHGVPDT---TQSLIQFVRTVRDFINRTNSPGISVVHCSAGVGRTGTFIVLDRALQQLDR-NCTVDIYGCVFDLRLHRSYMVQTECQYAYIHQCVRDVL 1871          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Zebrafish
Match: ptprb (protein tyrosine phosphatase receptor type b [Source:ZFIN;Acc:ZDB-GENE-101108-3])

HSP 1 Score: 140.969 bits (354), Expect = 3.995e-33
Identity = 96/300 (32.00%), Postives = 157/300 (52.33%), Query Frame = 3
Query: 2550 LESPVTSSDINEQSITTNKRKMVETLSDQFEKLMKESKDQESLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVG--EEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTK-LDKNNVQ---YWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCR--KEITQFHMNTWLDECAPNIEYFNKFLFRFHKVAS---NASNHP--YLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFL 3410
            + SPV +++  E  +   +      LS++FE L    + Q      T +         KNR+ NI+PYD  RV++   E++   +YINA+YIP +N   ++EYIATQGP   T  +FW+M+W++NV  ++M+T+ +++  V+   YWP  + + L      + LL +        R   IS E   R  + + QFH   W D   P+     + L +F +      N +N P   +VHCS+G+ +TGTFI +DR  ++L +    V+I+  V +LR  R  MVQ + Q+ +IH+ +   L
Sbjct: 1586 IRSPVQAANF-ESHLAKLQSDSSYLLSEEFEGLKDVGRIQ------TQNAARLLGNRNKNRYNNILPYDSTRVRLSCLEDDPCSDYINANYIPGNN--FRWEYIATQGPLPGTKDDFWRMVWEQNVHSLVMVTQCVERGMVKCDHYWPTDS-EPLCYGDIVVQLLSEKVFPEWTIRDFKISCESQLRYPRMVRQFHYTIWPDHGVPDT---TQSLIQFVRTVRDFINRTNSPGISVVHCSAGVGRTGTFIVLDRALQQLDR-NCTVDIYGCVFDLRLHRSYMVQTECQYAYIHQCVRDVL 1871          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Zebrafish
Match: ptpn18 (protein tyrosine phosphatase non-receptor type 18 [Source:ZFIN;Acc:ZDB-GENE-050320-12])

HSP 1 Score: 136.346 bits (342), Expect = 4.554e-33
Identity = 80/284 (28.17%), Postives = 141/284 (49.65%), Query Frame = 3
Query: 2592 ITTNKRKMVETLSDQFEKLMKESKDQESLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVGE--EEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTK---LDKNNVQYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPNIEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKL--SKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYL 3422
            ++ + R   + +S +F  + K++   +    LTT+ G      KKNR+ +I+PYDQ RV +     EY  +YINA+++          YIATQGP  +T+ +FW+MIWQ NVK IIM  +   + K   + +   T D  ++  F++  L++ + +  V  + ++ + CD  ++++ F    W D   P++      +    +        P ++HCS+G  +TG    +D +   L   + ++  NI + VL LRR R   VQ + Q+ F+   +     K L
Sbjct:   16 LSNHDRSGDQLISSEFSLIRKKTASLKEDYGLTTNAGGMKENVKKNRYRDILPYDQTRVCLTPTTSEYQSDYINANFV--KGAVRNRTYIATQGPLSSTVVDFWRMIWQHNVKVIIMACREIEMGKKKCEVYWASTSDTSTLGPFTVSTLEESRPNEEVIVRTLVVNYCDEARKVSHFQYTAWPDHGIPDMPDGILGMMELARQKQGNQTDPVVIHCSAGCGRTGVICAVDYVNDLLLTEQIQEDFNILDLVLELRRQRPSAVQTKEQYGFVFHTVAQMFQKAL 297          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Xenopus
Match: sema6d (semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070])

HSP 1 Score: 140.584 bits (353), Expect = 7.910e-33
Identity = 95/289 (32.87%), Postives = 151/289 (52.25%), Query Frame = 3
Query: 2625 LSDQFEKL-----MKESKDQESLLHLTTSKGENAN---KFKKNRFVNIIPYDQNRVKVGE-EEYPG-NYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMII-SDECDCRKEITQFHMNTWLDECAPNIEYFNKFL--FRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYLTCGQNQ 3440
            L+D  E+L     +K S++ ES+        E++N      KNR+ N+I YD +RV +   E  PG +YIN++YI  D    +  YIATQGP   T  +FW+M+W++    I+M+TKL++ +     QYWP +  +   +    I LLD ++   +  R   +  +    ++E+ QF    W D   P  E+   FL   R  K  +     P +VHCS+G+ +TG FI ID +  ++ + EK V+I+  V  +R  R  MVQ + Q+ FIH+     L + +TCG  +
Sbjct: 1346 LADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYINSNYI--DGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIKCDQYWPSRGTETYGL--IQITLLDTVELATYTVRTFALYKNGSSEKREVRQFQFTAWPDHGVP--EHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERI-RHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHD----ALLEAVTCGNTE 1623          

HSP 2 Score: 127.487 bits (319), Expect = 7.275e-29
Identity = 83/247 (33.60%), Postives = 132/247 (53.44%), Query Frame = 3
Query: 2712 NKFKKNRFVNIIPYDQNRVKV----GEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCR-KEITQFHMNTWLDECAP-NIEYFNKFLFRFHKVASN-ASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIH----EYIHHF 3407
            NKFK NR VNI+PY+  RV +    G E    +YINAS+I  D    +  YIATQGP   T ++FW+M+W+ N   ++MLTKL +       QYWP +       + F +  + +     ++ R+  ++D  D + + + QF    W ++  P + E F  F+ + HK       + P  VHCS+G+ +TG FI +  +  ++ + E +V+IF+TV  LR  R  +VQ + Q+ F +    EY+  F
Sbjct: 1673 NKFK-NRLVNIMPYESTRVCLQPIRGVEG--SDYINASFI--DGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARY--QYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERM-RYEGVVDIFQTVKMLRTQRPAVVQTEDQYQFCYRAGLEYLGSF 1911          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Xenopus
Match: sema6d (semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070])

HSP 1 Score: 140.584 bits (353), Expect = 8.191e-33
Identity = 95/289 (32.87%), Postives = 151/289 (52.25%), Query Frame = 3
Query: 2625 LSDQFEKL-----MKESKDQESLLHLTTSKGENAN---KFKKNRFVNIIPYDQNRVKVGE-EEYPG-NYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMII-SDECDCRKEITQFHMNTWLDECAPNIEYFNKFL--FRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYLTCGQNQ 3440
            L+D  E+L     +K S++ ES+        E++N      KNR+ N+I YD +RV +   E  PG +YIN++YI  D    +  YIATQGP   T  +FW+M+W++    I+M+TKL++ +     QYWP +  +   +    I LLD ++   +  R   +  +    ++E+ QF    W D   P  E+   FL   R  K  +     P +VHCS+G+ +TG FI ID +  ++ + EK V+I+  V  +R  R  MVQ + Q+ FIH+     L + +TCG  +
Sbjct: 1350 LADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYINSNYI--DGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIKCDQYWPSRGTETYGL--IQITLLDTVELATYTVRTFALYKNGSSEKREVRQFQFTAWPDHGVP--EHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERI-RHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHD----ALLEAVTCGNTE 1627          

HSP 2 Score: 127.487 bits (319), Expect = 8.411e-29
Identity = 83/247 (33.60%), Postives = 131/247 (53.04%), Query Frame = 3
Query: 2712 NKFKKNRFVNIIPYDQNRVKV----GEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCR-KEITQFHMNTWLDECAP-NIEYFNKFLFRFHKVASN-ASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIH----EYIHHF 3407
            NKFK NR VNI+PY+  RV +    G E    +YINAS+I  D    +  YIATQGP   T ++FW+M+W+ N   ++MLTKL +       QYWP +         F +  + +     ++ R+  ++D  D + + + QF    W ++  P + E F  F+ + HK       + P  VHCS+G+ +TG FI +  +  ++ + E +V+IF+TV  LR  R  +VQ + Q+ F +    EY+  F
Sbjct: 1677 NKFK-NRLVNIMPYESTRVCLQPIRGVEG--SDYINASFI--DGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQY--FVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERM-RYEGVVDIFQTVKMLRTQRPAVVQTEDQYQFCYRAGLEYLGSF 1915          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Xenopus
Match: sema6d (semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070])

HSP 1 Score: 140.198 bits (352), Expect = 9.005e-33
Identity = 95/289 (32.87%), Postives = 151/289 (52.25%), Query Frame = 3
Query: 2625 LSDQFEKL-----MKESKDQESLLHLTTSKGENAN---KFKKNRFVNIIPYDQNRVKVGE-EEYPG-NYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMII-SDECDCRKEITQFHMNTWLDECAPNIEYFNKFL--FRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYLTCGQNQ 3440
            L+D  E+L     +K S++ ES+        E++N      KNR+ N+I YD +RV +   E  PG +YIN++YI  D    +  YIATQGP   T  +FW+M+W++    I+M+TKL++ +     QYWP +  +   +    I LLD ++   +  R   +  +    ++E+ QF    W D   P  E+   FL   R  K  +     P +VHCS+G+ +TG FI ID +  ++ + EK V+I+  V  +R  R  MVQ + Q+ FIH+     L + +TCG  +
Sbjct: 1355 LADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYINSNYI--DGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIKCDQYWPSRGTETYGL--IQITLLDTVELATYTVRTFALYKNGSSEKREVRQFQFTAWPDHGVP--EHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERI-RHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHD----ALLEAVTCGNTE 1632          

HSP 2 Score: 127.102 bits (318), Expect = 8.711e-29
Identity = 83/247 (33.60%), Postives = 131/247 (53.04%), Query Frame = 3
Query: 2712 NKFKKNRFVNIIPYDQNRVKV----GEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCR-KEITQFHMNTWLDECAP-NIEYFNKFLFRFHKVASN-ASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIH----EYIHHF 3407
            NKFK NR VNI+PY+  RV +    G E    +YINAS+I  D    +  YIATQGP   T ++FW+M+W+ N   ++MLTKL +       QYWP +         F +  + +     ++ R+  ++D  D + + + QF    W ++  P + E F  F+ + HK       + P  VHCS+G+ +TG FI +  +  ++ + E +V+IF+TV  LR  R  +VQ + Q+ F +    EY+  F
Sbjct: 1682 NKFK-NRLVNIMPYESTRVCLQPIRGVEG--SDYINASFI--DGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQY--FVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERM-RYEGVVDIFQTVKMLRTQRPAVVQTEDQYQFCYRAGLEYLGSF 1920          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Xenopus
Match: sema6d (semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070])

HSP 1 Score: 140.198 bits (352), Expect = 9.361e-33
Identity = 95/289 (32.87%), Postives = 151/289 (52.25%), Query Frame = 3
Query: 2625 LSDQFEKL-----MKESKDQESLLHLTTSKGENAN---KFKKNRFVNIIPYDQNRVKVGE-EEYPG-NYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMII-SDECDCRKEITQFHMNTWLDECAPNIEYFNKFL--FRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYLTCGQNQ 3440
            L+D  E+L     +K S++ ES+        E++N      KNR+ N+I YD +RV +   E  PG +YIN++YI  D    +  YIATQGP   T  +FW+M+W++    I+M+TKL++ +     QYWP +  +   +    I LLD ++   +  R   +  +    ++E+ QF    W D   P  E+   FL   R  K  +     P +VHCS+G+ +TG FI ID +  ++ + EK V+I+  V  +R  R  MVQ + Q+ FIH+     L + +TCG  +
Sbjct: 1340 LADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYINSNYI--DGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIKCDQYWPSRGTETYGL--IQITLLDTVELATYTVRTFALYKNGSSEKREVRQFQFTAWPDHGVP--EHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERI-RHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDA----LLEAVTCGNTE 1617          

HSP 2 Score: 127.487 bits (319), Expect = 7.205e-29
Identity = 81/247 (32.79%), Postives = 131/247 (53.04%), Query Frame = 3
Query: 2712 NKFKKNRFVNIIPYDQNRVKV----GEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCR-KEITQFHMNTWLDECAP-NIEYFNKFLFRFHKVASN-ASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKY 3419
            NKFK NR VNI+PY+  RV +    G E    +YINAS+I  D    +  YIATQGP   T ++FW+M+W+ N   ++MLTKL +       QYWP +       + F +  + +     ++ R+  ++D  D + + + QF    W ++  P + E F  F+ + HK       + P  VHCS+G+ +TG FI +  +  ++ + E +V+IF+TV  LR  R  +VQ + Q+ F +     +L  +
Sbjct: 1667 NKFK-NRLVNIMPYESTRVCLQPIRGVEG--SDYINASFI--DGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARY--QYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERM-RYEGVVDIFQTVKMLRTQRPAVVQTEDQYQFCYRAGLEYLGSF 1905          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Xenopus
Match: mtpn (myotrophin [Source:Xenbase;Acc:XB-GENE-1014016])

HSP 1 Score: 137.117 bits (344), Expect = 6.648e-32
Identity = 98/279 (35.13%), Postives = 144/279 (51.61%), Query Frame = 3
Query: 2586 QSITTNKRKMVETLSDQFEKLMKESKDQESLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVG--EEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNN----VQYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDEC--DCRKEITQFHMNTWLDECAPNIEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYI 3398
            Q IT  KR       +++E L     + ++    T  + EN NK   NR+ NII YD +RV++   E +   +YINA+Y+  D       YIATQGP + T+K+FW+MIWQEN   ++M+T L +      V+YWPD+T  +  ++  S+I  + L    +V R   +  +   D R EI QFH  +W D   P          R  K  +     P  VHCS+G  +TG  I ID I   +++ E +V+IF  V  LR  R  MVQ + Q+ F+H+ I
Sbjct:  909 QHITQMKRGQGYGFKEEYEAL----PEGQTASWDTAKEDENRNK---NRYGNIISYDHSRVRLQQIEGDPHSDYINANYV--DGYHRPRYYIATQGPMQETVKDFWRMIWQENSVSVVMVTNLVEVGRVKCVRYWPDETEVYGDIK-VSLIETEPLAE--YVIRTFTVQKKGSHDIR-EIRQFHFTSWPDHGVPCYATGLLGFIRQVKFLNPPDAGPITVHCSAGAGRTGCLIAID-IMLDMAENEGVVDIFNCVRELRAQRVNMVQTEEQYVFVHDAI 1173          

HSP 2 Score: 74.7146 bits (182), Expect = 9.574e-13
Identity = 58/242 (23.97%), Postives = 115/242 (47.52%), Query Frame = 3
Query: 2724 KNRFVNIIPYDQN-RVKVGEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNN--VQYWPDKTG---DHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTW--LDECAPNIEYFNKFLFRFHKVAS--NASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKY 3419
            KNR ++++P D+     +  +    NYINA+ +  D+      ++ TQ P  NT+ +FW++++  N   I+ML ++D     +QYWP+KT      + VE  S  + +D+     + R   ++   D  + +       W    +  P+     K + R  K     +      +VHC +G  ++GTF  I  +   + + + I+++F TV  LR  +  MV+   Q+ ++++    +L+ +
Sbjct: 1238 KNRALDVLPLDRCLPFLISMDGETSNYINATLM--DSHKKPAAFLVTQHPLPNTVPDFWRLVFDYNCSSIVMLNEMDSTQLCLQYWPEKTSCCYGPVQVEFVSADIDEDI--ISRIFRICNMARPQDGYRIVQHLQYIGWPAYRDTPPSKRSILKVVQRLEKWQEKYDGREGRTVVHCLNGGGRSGTFCAICSVCEMIQQ-QNIIDVFHTVKTLRNNKANMVETLEQYKYVYDVALEYLSSF 1474          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Mouse
Match: Ptprj (protein tyrosine phosphatase, receptor type, J [Source:MGI Symbol;Acc:MGI:104574])

HSP 1 Score: 141.354 bits (355), Expect = 2.225e-33
Identity = 88/252 (34.92%), Postives = 138/252 (54.76%), Query Frame = 3
Query: 2679 LHLTTSKGENANKFKKNRFVNIIPYDQNRVKVGEEEYP-GNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKT----GDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPNIEYFNKFLFRFHKVASN-----ASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHE 3392
            + L     E A    KNR+ N++PYD +RVK+  + +   +YINA+Y+P     +K ++IATQGP  NTLK+FW+M+W++NV  I+MLTK  +       +YWP K     GD ++V   S ++L +      V + M  S+    R    QFH  +W D   P+       L  F  +  +         P LVHCS+G+ +TGTFI IDR+  ++ + E  V+++  V +LR  R +MVQ + Q+ F+++
Sbjct:  880 ISLPKYTAEIAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMP--GYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQAQDYGD-ITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLR----QFHFTSWPDHGVPDT---TDLLINFRYLVRDYMKQIPPESPILVHCSAGVGRTGTFIAIDRLIYQI-ENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQ 1120          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Mouse
Match: Ptprj (protein tyrosine phosphatase, receptor type, J [Source:MGI Symbol;Acc:MGI:104574])

HSP 1 Score: 141.354 bits (355), Expect = 2.926e-33
Identity = 88/254 (34.65%), Postives = 139/254 (54.72%), Query Frame = 3
Query: 2679 LHLTTSKGENANKFKKNRFVNIIPYDQNRVKVGEEEYP-GNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKT----GDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPNIEYFNKFLFRFHKVASN-----ASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYI 3398
            + L     E A    KNR+ N++PYD +RVK+  + +   +YINA+Y+P     +K ++IATQGP  NTLK+FW+M+W++NV  I+MLTK  +       +YWP K     GD ++V   S ++L +      V + M  S+    R    QFH  +W D   P+       L  F  +  +         P LVHCS+G+ +TGTFI IDR+  ++ + E  V+++  V +LR  R +MVQ + Q+ F+++ +
Sbjct: 1066 ISLPKYTAEIAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMP--GYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQAQDYGD-ITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLR----QFHFTSWPDHGVPDT---TDLLINFRYLVRDYMKQIPPESPILVHCSAGVGRTGTFIAIDRLIYQI-ENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV 1308          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Mouse
Match: Ptprj (protein tyrosine phosphatase, receptor type, J [Source:MGI Symbol;Acc:MGI:104574])

HSP 1 Score: 140.584 bits (353), Expect = 4.189e-33
Identity = 88/254 (34.65%), Postives = 139/254 (54.72%), Query Frame = 3
Query: 2679 LHLTTSKGENANKFKKNRFVNIIPYDQNRVKVGEEEYP-GNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKT----GDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPNIEYFNKFLFRFHKVASN-----ASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYI 3398
            + L     E A    KNR+ N++PYD +RVK+  + +   +YINA+Y+P     +K ++IATQGP  NTLK+FW+M+W++NV  I+MLTK  +       +YWP K     GD ++V   S ++L +      V + M  S+    R    QFH  +W D   P+       L  F  +  +         P LVHCS+G+ +TGTFI IDR+  ++ + E  V+++  V +LR  R +MVQ + Q+ F+++ +
Sbjct:  973 ISLPKYTAEIAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMP--GYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQAQDYGD-ITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLR----QFHFTSWPDHGVPDT---TDLLINFRYLVRDYMKQIPPESPILVHCSAGVGRTGTFIAIDRLIYQI-ENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV 1215          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Mouse
Match: Ptprf (protein tyrosine phosphatase, receptor type, F [Source:MGI Symbol;Acc:MGI:102695])

HSP 1 Score: 137.887 bits (346), Expect = 2.654e-32
Identity = 92/275 (33.45%), Postives = 145/275 (52.73%), Query Frame = 3
Query: 2625 LSDQFEKL-----MKESKDQESLLHLTTSKGENANKF---KKNRFVNIIPYDQNRVKVGE-EEYPG-NYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKL-DKNNV---QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDC-RKEITQFHMNTWLDECAPNIEYFNKFL--FRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYI 3398
            L+D  E+L     +K S++ ES+        EN+N      KNR+ N+I YD +RV +   +  PG +YINA+YI  D    +  YIATQGP   T+ +FW+M+W++    ++M+T+L +K+ V   QYWP +  +   +    + L+D ++   +  R   +       ++E+ QF    W D   P  EY    L   R  K  +     P +VHCS+G+ +TG FI ID +  ++ K EK V+I+  V  +R  R  MVQ + Q+ FIHE +
Sbjct:  721 LADNIERLKANDGLKFSQEYESIDPGQQFTWENSNSEVNKPKNRYANVIAYDHSRVLLTSIDGVPGSDYINANYI--DGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPVRGTETYGL--IQVTLVDTVELATYTMRTFALHKSGSSEKRELRQFQFMAWPDHGVP--EYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERM-KHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEAL 988          

HSP 2 Score: 127.487 bits (319), Expect = 4.303e-29
Identity = 80/247 (32.39%), Postives = 128/247 (51.82%), Query Frame = 3
Query: 2712 NKFKKNRFVNIIPYDQNRVKV----GEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCR-KEITQFHMNTWLDECAPNI-EYFNKFLFRFHKVASN-ASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKY 3419
            NKFK NR VNI+PY+  RV +    G E    +YINAS++  D    +  YIATQGP   + ++FW+M+W+ N   I+MLTKL +       QYWP +         F +  + +     ++ R+  ++D  D + + I QF    W ++  P   E F  F+ + HK       + P  VHCS+G+ +TG FI +  +  ++ + E +V++F+TV  LR  R  MVQ + Q+   +     +L  +
Sbjct: 1048 NKFK-NRLVNIMPYELTRVCLQPIRGVEG--SDYINASFL--DGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPAERSARYQY--FVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERM-RYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSF 1286          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Mouse
Match: Ptprc (protein tyrosine phosphatase, receptor type, C [Source:MGI Symbol;Acc:MGI:97810])

HSP 1 Score: 137.887 bits (346), Expect = 2.845e-32
Identity = 77/236 (32.63%), Postives = 129/236 (54.66%), Query Frame = 3
Query: 2724 KNRFVNIIPYDQNRVKVGE--EEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNN----VQYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIIS--DECDCRKEITQFHMNTWLDECAPNIEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHF 3407
            KNR+V+I+PYD NRV++ E   +    YINASYI  D      +YIA QGP + T+ +FW+MIW++    I+M+T+ ++ N     +YWP       + +   + + D  +   ++ +K+ ++   E    +E+T     +W D   P   +    L R     SN  + P +VHCS+G+ +TGT+I ID +   L + E  V+++  V+ LRR R +MVQ + Q+  IH+ +  +
Sbjct:  669 KNRYVDILPYDYNRVELSEINGDAGSTYINASYI--DGFKEPRKYIAAQGPRDETVDDFWRMIWEQKATVIVMVTRCEEGNRNKCAEYWPSMEEGTRAFKDIVVTINDHKRCPDYIIQKLNVAHKKEKATGREVTHIQFTSWPDHGVPEDPHLLLKLRRRVNAFSNFFSGPIVVHCSAGVGRTGTYIGIDAMLEGL-EAEGKVDVYGYVVKLRRQRCLMVQVEAQYILIHQALVEY 901          

HSP 2 Score: 82.4185 bits (202), Expect = 3.352e-15
Identity = 79/270 (29.26%), Postives = 121/270 (44.81%), Query Frame = 3
Query: 2721 KKNRFVNIIPYDQNRVKVGEE---------------------EYPGNYINASYIPYDNDANKYEY-IATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNN----VQYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKE---ITQFHMNTWLDECAPN--------IEYFNKFL-------FRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYI 3398
            KKNR  N++PYD NRV +  E                     E    YINAS++       K E  IA QGP + T+ +FWQMI+Q  VK I+MLT+L   +     QYW +    +  +E   + + D  +   +  R   +      RKE   + Q+   TW  E  P         I+   + L        ++HK AS       LVHC  G  QTG F  +  +    ++ E +V++F+ V +LR+ R  +V +  Q+ F+++ I
Sbjct:  959 KKNRNSNVVPYDFNRVPLKHELEMSKESEPESDESSDDDSDSEETSKYINASFV---MSYWKPEMMIAAQGPLKETIGDFWQMIFQRKVKVIVMLTELVNGDQEVCAQYWGEGKQTYGDME---VEMKDTNRASAYTLRTFELRH--SKRKEPRTVYQYQCTTWKGEELPAEPKDLVSMIQDLKQKLPKASPEGMKYHKHAS------ILVHCRDGSQQTGLFCALFNLLES-AETEDVVDVFQVVKSLRKARPGVVCSYEQYQFLYDII 1213          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. UniProt/SwissProt
Match: sp|Q9W6V5|PTPRJ_CHICK (Receptor-type tyrosine-protein phosphatase eta OS=Gallus gallus OX=9031 GN=PTPRJ PE=2 SV=2)

HSP 1 Score: 145.206 bits (365), Expect = 1.324e-33
Identity = 89/273 (32.60%), Postives = 149/273 (54.58%), Query Frame = 3
Query: 2625 LSDQFEKLMKESKDQESLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVGEEE-YPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNN----VQYWPDKT----GDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAP-NIEYFNKFLFRFHKVAS-NASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFL 3410
             ++++E+L      + + +H      E A    KNR+ N++PYD +RVK+        +YINA+Y+P    ++K  +IA QGP  NT+++FW+MIW++N+  I+MLTK  +       QYWPDK     GD +      ++L +    D +VE     +D  +    + QFH  +W D   P   +    F    H+ +S N  + P LVHCS+G+ +TGTFI IDR+ +++   E  V+++  V +LR  R +MVQ + Q+ F+++ +   +
Sbjct: 1110 FAEEYEEL------KSAGVHQPKFAAEIAENRGKNRYNNVLPYDISRVKLSNPSCTTDDYINANYMP--GYSSKKAFIAAQGPLPNTIEDFWRMIWEKNIYSIVMLTKCVEQARTKCEQYWPDKQSKSYGDIIVTMVSEVVLPEWTIRDFNVEN----ADTMESHT-VRQFHFTSWPDHGVPETTDLLINFRHLVHEYSSQNPIDSPILVHCSAGVGRTGTFIAIDRLIQQIEM-ENTVDVYGVVYDLRMHRPLMVQTEDQYVFLNQCVMDII 1368          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. UniProt/SwissProt
Match: sp|F1NWE3|PTPRS_CHICK (Receptor-type tyrosine-protein phosphatase S OS=Gallus gallus OX=9031 GN=PTPRS PE=1 SV=3)

HSP 1 Score: 143.28 bits (360), Expect = 4.707e-33
Identity = 108/348 (31.03%), Postives = 171/348 (49.14%), Query Frame = 3
Query: 2448 LDNTVFTLNHGMDSWSLYSDNSMYFNTQTSKNEILESPVTSSDINEQSITTNKRKMVETLSDQFEKL-----MKESKDQESLLHLTTSKGENAN---KFKKNRFVNIIPYDQNRVKVGEEE--YPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDC-RKEITQFHMNTWLDECAPNIEYFNKFL--FRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYLTCGQNQ 3440
            L+N   T +H  D   +   N   F T  S    L SP++  + + +S+ ++    V  L++  E L     +K S++ ES+        E++N      KNR+ N+I YD +RV +   E     +YINA+YI  D    +  YIATQGP   T  +FW+M+W++    I+M+TKL++ +     QYWP +  D   +    + LLD ++      R   +       ++E+ QF    W D   P  EY   FL   R  K  +     P +VHCS+G+ +TG FI ID +  ++ K EK V+I+  V  +R  R  MVQ + Q++FIH+     L + + CG  +
Sbjct:  893 LNNAEITPHHPKDPVEMRRIN---FQTPDSG---LSSPLSDPEFDFESMLSHPPIPVSELAEHTEHLKANDNLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILLPIEGIVGSDYINANYI--DGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTKLEEKSRIKCDQYWPGRGTDTYGM--IQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVP--EYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERI-KHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDA----LLEAVACGNTE 1223          

HSP 2 Score: 128.642 bits (322), Expect = 1.668e-28
Identity = 81/247 (32.79%), Postives = 131/247 (53.04%), Query Frame = 3
Query: 2712 NKFKKNRFVNIIPYDQNRVKV----GEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCR-KEITQFHMNTWLDECAP-NIEYFNKFLFRFHKVASN-ASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKY 3419
            NKFK NR VNI+PY+  RV +    G E    +YINAS+I  D    +  YIATQGP   T ++FW+M+W+ N   ++MLTKL +       QYWP +         F +  + +     ++ R+  ++D  D + + + QF    W ++  P + E F  F+ + HK       + P  VHCS+G+ +TG FI +  +  ++ + E +V+IF+TV  LR  R  MVQ + ++ F ++    +L  +
Sbjct: 1273 NKFK-NRLVNIMPYETTRVCLQPIRGVEG--SDYINASFI--DGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQY--FVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERM-RYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSF 1511          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. UniProt/SwissProt
Match: sp|Q64455|PTPRJ_MOUSE (Receptor-type tyrosine-protein phosphatase eta OS=Mus musculus OX=10090 GN=Ptprj PE=1 SV=2)

HSP 1 Score: 140.969 bits (354), Expect = 1.923e-32
Identity = 88/254 (34.65%), Postives = 139/254 (54.72%), Query Frame = 3
Query: 2679 LHLTTSKGENANKFKKNRFVNIIPYDQNRVKVGEEEYP-GNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKT----GDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPNIEYFNKFLFRFHKVASN-----ASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYI 3398
            + L     E A    KNR+ N++PYD +RVK+  + +   +YINA+Y+P     +K ++IATQGP  NTLK+FW+M+W++NV  I+MLTK  +       +YWP K     GD ++V   S ++L +      V + M  S+    R    QFH  +W D   P+       L  F  +  +         P LVHCS+G+ +TGTFI IDR+  ++ + E  V+++  V +LR  R +MVQ + Q+ F+++ +
Sbjct:  954 ISLPKYTAEIAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMP--GYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQAQDYGD-ITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLR----QFHFTSWPDHGVPDT---TDLLINFRYLVRDYMKQIPPESPILVHCSAGVGRTGTFIAIDRLIYQI-ENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV 1196          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. UniProt/SwissProt
Match: sp|P04157|PTPRC_RAT (Receptor-type tyrosine-protein phosphatase C OS=Rattus norvegicus OX=10116 GN=Ptprc PE=1 SV=2)

HSP 1 Score: 140.198 bits (352), Expect = 3.653e-32
Identity = 82/245 (33.47%), Postives = 133/245 (54.29%), Query Frame = 3
Query: 2697 KGENANKFKKNRFVNIIPYDQNRVKVGE--EEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNN----VQYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIIS--DECDCRKEITQFHMNTWLDECAPNIEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHF 3407
            K +N NK   NR+V+I+PYD NRV++ E   +    YINASYI  D      +YIA QGP + T+ +FW+MIW++    I+M+T+ ++ N     +YWP       +     + + D  +   ++ +K+ I+   E    +E+T     +W D   P   +    L R     SN  + P +VHCS+G+ +TGT+I ID +   L + E  V+++  V+NLRR R +MVQ + Q+  IH+ +  +
Sbjct:  643 KSQNQNK---NRYVDILPYDYNRVELSEINGDAGSTYINASYI--DGFKEPRKYIAAQGPRDETVDDFWKMIWEQKATVIVMVTRCEEGNRNKCAEYWPCMEEGTRTFRDVVVTINDHKRCPDYIIQKLSIAHKKEKATGREVTHIQFTSWPDHGVPEDPHLLLKLRRRVNAFSNFFSGPIVVHCSAGVGRTGTYIGIDAMLESL-EAEGKVDVYGYVVNLRRQRCLMVQVEAQYILIHQALVEY 881          

HSP 2 Score: 88.5817 bits (218), Expect = 2.561e-16
Identity = 87/298 (29.19%), Postives = 136/298 (45.64%), Query Frame = 3
Query: 2721 KKNRFVNIIPYDQNRVKVGEE---------------------EYPGNYINASYIPYDNDANKYEY-IATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNN----VQYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKE---ITQFHMNTWLDECAPN--------IEYFNKFL-------FRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEY---IHHFLNKYLTCGQNQEEMYF-NEI*G 3470
            KKNR  N++PYD NRV +  E                     E    YINAS++       K E  IA QGP + T+ +FWQMI+Q  VK I+MLT+L   +     QYW +    +  +E   ++L D  +   ++ R   +      RKE   + Q+   TW  E  P         I+   + L        ++HK AS       LVHC  G  QTG F  +  +    ++ E +V++F+ V +LR+ R  MV +  Q+ F+++    I+   N  +    +Q+++ F NE+ G
Sbjct:  939 KKNRSSNVVPYDFNRVPLKHELEMSKESEAESDESSDEDSDSEETSKYINASFV---MSYWKPEMMIAAQGPLKETIGDFWQMIFQRKVKVIVMLTELMSGDQEVCAQYWGEGKQTYGDME---VMLKDTNKSSAYILRAFELRH--SKRKEPRTVYQYQCTTWKGEELPAEPKDLVTLIQNIKQKLPKSGSEGMKYHKHAS------ILVHCRDGSQQTGLFCALFNLLES-AETEDVVDVFQVVKSLRKARPGMVGSFEQYQFLYDIMASIYPTQNGQVKKANSQDKIEFHNEVDG 1221          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. UniProt/SwissProt
Match: sp|Q12913|PTPRJ_HUMAN (Receptor-type tyrosine-protein phosphatase eta OS=Homo sapiens OX=9606 GN=PTPRJ PE=1 SV=3)

HSP 1 Score: 140.198 bits (352), Expect = 4.017e-32
Identity = 87/245 (35.51%), Postives = 139/245 (56.73%), Query Frame = 3
Query: 2700 GENANKFKKNRFVNIIPYDQNRVKVGEEEYP-GNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKT----GDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPNIEYFN---KFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYI 3398
             E A    KNR+ N++PYD +RVK+  + +   +YINA+Y+P     +K ++IATQGP  NTLK+FW+M+W++NV  IIMLTK  +       +YWP K     GD ++V   S I+L +        + +  S+    R    QFH  +W D   P+        ++L R + +  +    P LVHCS+G+ +TGTFI IDR+  ++ + E  V+++  V +LR  R +MVQ + Q+ F+++ +
Sbjct: 1060 AELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMP--GYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGD-ITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLR----QFHFTSWPDHGVPDTTDLLINFRYLVRDY-MKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQI-ENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV 1295          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. TrEMBL
Match: A0A267DB45 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029524g1 PE=4 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 2.715e-42
Identity = 96/281 (34.16%), Postives = 159/281 (56.58%), Query Frame = 3
Query: 2625 LSDQFEKLMKESKDQESLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVGEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTK-LDKNNV---QYWPDKTGDHLSVE-GFSIILLDDLQHDGHVERKMIISDECDCRK----------EITQFHMNTWLDECAPNIEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLS--KGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNK 3416
            LSDQ   LMK++  +++    +T  G  +   +KNR++NI+P+D NRVK+  +    +YINASY+  D  A+   +IA QGP   T+ + W+MIW++ V   +MLT  ++K      QYWPD  G+ L ++ G ++ LL       ++ RK+ +    D +           E+ Q+    W D   PN++   +FL R H+   N      ++HCS+G+ +TGTFI +D + R+L   +  + V+++ETVL LRR R  MVQ + Q+ FI++++ +F+ K
Sbjct:  229 LSDQQYSLMKQAAIEQTK-SFSTEDGLASGNREKNRYINILPFDNNRVKLSGDN---DYINASYVSEDATASSAPFIACQGPKPATVSDHWRMIWEQMVPVTVMLTTCVEKGRTKCEQYWPDSEGESLELDCGLTVTLLSAENCGSYIVRKLRLMPNTDNKTTDGRASGMDTELLQYM--EWEDHAVPNLDNLAEFLGRVHRSQRNGGGGRIVLHCSAGVGRTGTFIALDLLARRLQDCQERQEVSVYETVLQLRRCRVDMVQTKHQYAFIYKFLLNFVQK 503          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. TrEMBL
Match: A0A1I8IFK8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 1.006e-41
Identity = 92/274 (33.58%), Postives = 155/274 (56.57%), Query Frame = 3
Query: 2646 LMKESKDQESLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVGEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTK-LDKNNV---QYWPDKTGDHLSVE-GFSIILLDDLQHDGHVERKMIISDECDCRK----------EITQFHMNTWLDECAPNIEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGE--KIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNK 3416
            LMK++  +++    +T  G  +   +KNR++NI+P+D NRVK+  +    +YINASY+  D  A+   +IA QGP   T+ + W+MIW++ V   +MLT  ++K      QYWPD  G+ L ++ G ++ LL       ++ RK+ +    D +           E+ Q+    W D   PN++   +FL R H+   N      ++HCS+G+ +TGTFI +D + R+L   +  + V+++ETVL LRR R  MVQ + Q+ FI++++ +F+ K
Sbjct:   26 LMKQAAIEQTK-SFSTEDGLASGNREKNRYINILPFDNNRVKLSGDN---DYINASYVSEDATASSAPFIACQGPKPATVSDHWRMIWEQMVPVTVMLTTCVEKGRTKCEQYWPDSEGESLELDCGLTVTLLSAENCGSYIVRKLRLMPNTDNKTTDGRASGMDTELLQYM--EWEDHAVPNLDNLAEFLGRVHRSQRNGGGGRIVLHCSAGVGRTGTFIALDLLARRLQDCQERQEVSVYETVLQLRRCRVDMVQTKHQYAFIYKFLLNFVQK 293          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. TrEMBL
Match: A0A1I8HPY0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.996e-41
Identity = 92/274 (33.58%), Postives = 155/274 (56.57%), Query Frame = 3
Query: 2646 LMKESKDQESLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVGEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTK-LDKNNV---QYWPDKTGDHLSVE-GFSIILLDDLQHDGHVERKMIISDECDCRK----------EITQFHMNTWLDECAPNIEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLS--KGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNK 3416
            LMK++  +++    +T  G  +   +KNR++NI+P+D NRVK+  +    +YINASY+  D  A+   +IA QGP   T+ + W+MIW++ V   +MLT  ++K      QYWPD  G+ L ++ G ++ LL       ++ RK+ +    D +           E+ Q+    W D   PN++   +FL R H+   N      ++HCS+G+ +TGTFI +D + R+L   +  + V+++ETVL LRR R  MVQ + Q+ FI++++ +F+ K
Sbjct:   85 LMKQAAIEQTK-SFSTEDGLASGNREKNRYINILPFDNNRVKLSGDN---DYINASYVSEDATASSAPFIACQGPKPATVSDHWRMIWEQMVPVTVMLTTCVEKGRTKCEQYWPDSEGESLELDCGLTVTLLSAENCGSYIVRKLRLMPNTDNKTTDGRASGMDTELLQYM--EWEDHAVPNLDNLAEFLGRVHRSQRNGGGGRIVLHCSAGVGRTGTFIALDLLARRLQDCQERQEVSVYETVLQLRRCRVDMVQTKHQYAFIYKFLLNFVQK 352          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. TrEMBL
Match: H2XQT4 (Uncharacterized protein OS=Ciona intestinalis OX=7719 PE=4 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 8.232e-41
Identity = 103/265 (38.87%), Postives = 144/265 (54.34%), Query Frame = 3
Query: 2622 TLSDQFEKLMKESKDQESLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVGEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLT----KLDKNNVQYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAP----NIEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHE 3392
            +L +QF+KL+      + L   T S  EN  K   NRF NI+PY+  RV + E E  G+YINA+YI   N   K  YIATQGP   T K+FW+MIW+   + I+MLT    K  K   +YWPD        + F+I  + +     +  R +II+   D  + ITQFH  TW D   P     +  F K +    +V     N P +VHCS+G  +TGTFI  D +T ++ K +  +N+FETV+NLR+ R  MVQN  Q+  +H+
Sbjct:    2 SLKEQFQKLLNSYTRLQGLKTTTASMPENKTK---NRFKNILPYEHTRVVLTENEDGGDYINANYIDCFNVPGK--YIATQGPLPKTEKDFWRMIWETESQVIVMLTNPFEKGKKKCQKYWPD-YNQQKKYQSFNITCVHEEVLGCYTRRSLIIAYN-DNTRNITQFHYTTWPDHSVPLTTSGLHRFKKAVLEQQQVTK--KNKPIIVHCSAGAGRTGTFIAFDSLTMEMQK-KTCINVFETVMNLRKQRMDMVQNVKQYMLLHK 256          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. TrEMBL
Match: A0A267G4Z6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029524g2 PE=4 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 1.348e-40
Identity = 96/281 (34.16%), Postives = 159/281 (56.58%), Query Frame = 3
Query: 2625 LSDQFEKLMKESKDQESLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVGEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTK-LDKNNV---QYWPDKTGDHLSVE-GFSIILLDDLQHDGHVERKMIISDECDCRK----------EITQFHMNTWLDECAPNIEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLS--KGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNK 3416
            LSDQ   LMK++  +++    +T  G  +   +KNR++NI+P+D NRVK+  +    +YINASY+  D  A+   +IA QGP   T+ + W+MIW++ V   +MLT  ++K      QYWPD  G+ L ++ G ++ LL       ++ RK+ +    D +           E+ Q+    W D   PN++   +FL R H+   N      ++HCS+G+ +TGTFI +D + R+L   +  + V+++ETVL LRR R  MVQ + Q+ FI++++ +F+ K
Sbjct:  920 LSDQQYSLMKQAAIEQTK-SFSTEDGLASGNREKNRYINILPFDNNRVKLSGDN---DYINASYVSEDATASSAPFIACQGPKPATVSDHWRMIWEQMVPVTVMLTTCVEKGRTKCEQYWPDSEGESLELDCGLTVTLLSAENCGSYIVRKLRLMPNTDNKTTDGRASGMDTELLQYM--EWEDHAVPNLDNLAEFLGRVHRSQRNGGGGRIVLHCSAGVGRTGTFIALDLLARRLQDCQERQEVSVYETVLQLRRCRVDMVQTKHQYAFIYKFLLNFVQK 1194          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Cavefish
Match: ENSAMXT00000013855.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000961.1:187509:263844:-1 gene:ENSAMXG00000013469.2 transcript:ENSAMXT00000013855.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.739 bits (356), Expect = 1.768e-33
Identity = 93/290 (32.07%), Postives = 153/290 (52.76%), Query Frame = 3
Query: 2625 LSDQFEKLMKESKDQE-SLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVG--EEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTK-LDKNNVQ---YWPDKTGDHLSVEGFSIILLDD--LQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPNIEYFNKFLFRFHKVASNASNH-----PYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYLTCGQNQEEMY 3452
            LS ++E L    ++Q   +  L  ++G       KNR+ NI+PYD  RVK+   +++   +YINASYIP +N   + EYI TQGP   T  +FW+M+W++NV  I+M+T+ ++K  V+   YWP    D L  E   + +L +  L      E K+   D+ +  + +  FH   W D   P      + L +F +   +  N      P +VHCS+G+ +TGTFI +DRI ++L   +  V+++  V +LR  R  MVQ + Q+T++H+ +   L       + +  +Y
Sbjct: 1409 LSQEYEDLKDVGRNQPLDVALLPENRG-------KNRYNNILPYDSTRVKLSCVDDDLCSDYINASYIPGNN--FRREYIGTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPFDQ-DPLYYEDLIVQMLSESVLPEWTIREFKICSEDQLNHSRIVRHFHYTVWPDHGVPET---TQSLIQFVRTTRDYINRTPGSGPTVVHCSAGVGRTGTFIGLDRILQQLDTRDT-VDVYGAVFDLRLHRSHMVQTERQYTYLHQCVRDVLRARKLRNEQENPLY 1684          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Cavefish
Match: ENSAMXT00000031392.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000961.1:187509:307650:-1 gene:ENSAMXG00000013469.2 transcript:ENSAMXT00000031392.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.739 bits (356), Expect = 1.817e-33
Identity = 93/290 (32.07%), Postives = 153/290 (52.76%), Query Frame = 3
Query: 2625 LSDQFEKLMKESKDQE-SLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVG--EEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTK-LDKNNVQ---YWPDKTGDHLSVEGFSIILLDD--LQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPNIEYFNKFLFRFHKVASNASNH-----PYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYLTCGQNQEEMY 3452
            LS ++E L    ++Q   +  L  ++G       KNR+ NI+PYD  RVK+   +++   +YINASYIP +N   + EYI TQGP   T  +FW+M+W++NV  I+M+T+ ++K  V+   YWP    D L  E   + +L +  L      E K+   D+ +  + +  FH   W D   P      + L +F +   +  N      P +VHCS+G+ +TGTFI +DRI ++L   +  V+++  V +LR  R  MVQ + Q+T++H+ +   L       + +  +Y
Sbjct: 1525 LSQEYEDLKDVGRNQPLDVALLPENRG-------KNRYNNILPYDSTRVKLSCVDDDLCSDYINASYIPGNN--FRREYIGTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPFDQ-DPLYYEDLIVQMLSESVLPEWTIREFKICSEDQLNHSRIVRHFHYTVWPDHGVPET---TQSLIQFVRTTRDYINRTPGSGPTVVHCSAGVGRTGTFIGLDRILQQLDTRDT-VDVYGAVFDLRLHRSHMVQTERQYTYLHQCVRDVLRARKLRNEQENPLY 1800          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Cavefish
Match: ptprt (protein tyrosine phosphatase receptor type T [Source:ZFIN;Acc:ZDB-GENE-101028-4])

HSP 1 Score: 139.043 bits (349), Expect = 1.145e-32
Identity = 91/244 (37.30%), Postives = 130/244 (53.28%), Query Frame = 3
Query: 2688 TTSKGENANKFKKNRFVNIIPYDQNRVKVG--EEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNN----VQYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCR-KEITQFHMNTWLDECAPNIEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYI 3398
            T  K EN NK   NR+ NII YD  RV++   E +   +YINA+YI  D       YIATQGP + T+++FW+MIWQEN   I+M+T L +      V+YWPD+T  +  V+  ++I  D L    +V R   +  +     +EI QFH  +W D   P          R  K  +     P  VHCS+G  +TG FI +D I   +++ E +V+IF  +  LR  R  MVQ + Q+ F+H+ I
Sbjct:  873 TAKKEENRNK---NRYGNIIAYDHTRVRLQLLEGDPHSDYINANYI--DGYHRPRHYIATQGPMQETVRDFWRMIWQENSASIVMVTNLVEVGRVKCVRYWPDETEVYGDVK-VTLIETDPLAE--YVIRTFTVQKKGHHEIREIRQFHFTSWPDHGVPCYATGLLGFVRQVKFLNPPDAGPIAVHCSAGAGRTGCFIAVD-IMLDMAENEGVVDIFNCIRELRSQRVNMVQTEEQYVFVHDAI 1107          

HSP 2 Score: 52.7582 bits (125), Expect = 2.716e-6
Identity = 30/92 (32.61%), Postives = 52/92 (56.52%), Query Frame = 3
Query: 2724 KNRFVNIIPYDQNR---VKVGEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV--QYWPDKT 2984
            KNR ++++  D+     + V  E    NYINA+ +  D+      +I TQ P  NT+ +FW++++  N   I+ML ++D   +  QYWP+K+
Sbjct: 1172 KNRSMDVLALDRCLPFLISVDGES--SNYINAALM--DSHKQPAAFIVTQHPLPNTVADFWRLVFDYNCSSIVMLNEMDAAQLCMQYWPEKS 1259          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Cavefish
Match: ptprfb (protein tyrosine phosphatase receptor type Fb [Source:NCBI gene;Acc:799867])

HSP 1 Score: 137.887 bits (346), Expect = 2.868e-32
Identity = 101/313 (32.27%), Postives = 157/313 (50.16%), Query Frame = 3
Query: 2559 PVTSSDINEQSITTNKRKM--VETLSDQFEKL-----MKESKDQESLLHLTTSKGENAN---KFKKNRFVNIIPYDQNRVKVGE-EEYPG-NYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKM-IISDECDCRKEITQFHMNTWLDECAPNIEYFNKFL--FRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYLTCGQNQ 3440
            PV    IN Q+    +     V  L+D  E+L     ++ S++ ES+        EN+N      KNR+ N+I YD +RV +   +  PG +YINA+YI  D    +  YIATQGP   TL +FW+M+W++    I+M+T+L++ +     QYWP +  +   +    + +LD ++   +  R   +  +    ++EI QF    W D   P  EY    L   R  K  +     P +VHCS+G+ +TG  I ID +  ++ K EK V+I+  V  +R  R  MVQ + Q+ FIHE     L +  TCG  +
Sbjct: 1217 PVEMRRINYQTPGMREHPPIPVSDLADHIERLKANDGLRFSQEYESIDPGQQFTWENSNMEVNKPKNRYANVIAYDHSRVILTSVDAVPGSDYINANYI--DGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWPIRGTETYGM--IQVTMLDTVELATYSVRTFALYKNGSSEKREIRQFQFMAWPDHGVP--EYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCLIVIDAMLERM-KHEKSVDIYGHVTCMRSQRNYMVQTEDQYVFIHEA----LLEAATCGNTE 1518          

HSP 2 Score: 122.865 bits (307), Expect = 1.206e-27
Identity = 80/247 (32.39%), Postives = 129/247 (52.23%), Query Frame = 3
Query: 2712 NKFKKNRFVNIIPYDQNRVKV----GEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCR-KEITQFHMNTWLDECAPNI-EYFNKFLFRFHKVASN-ASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKY 3419
            NKFK NR VNI+P++ +RV +    G E    +YINAS I  D    +  YIATQGP   T ++FW+M+W+ N   ++MLTKL +       QYWP +       + F +  + +     ++ R+  ++D  D + + I QF    W ++  P   E F  F+ + HK       + P  VHCS+G+ +TG FI +  +  ++ + E +V++F+TV  LR  R  MVQ + Q+   +     +L  +
Sbjct: 1568 NKFK-NRLVNIMPFETSRVCLQPIRGVEG--SDYINASCI--DGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARY--QYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERM-RYEGVVDLFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSF 1806          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Cavefish
Match: ENSAMXT00000012844.2 (receptor-type tyrosine-protein phosphatase S-like [Source:NCBI gene;Acc:103032152])

HSP 1 Score: 137.502 bits (345), Expect = 3.058e-32
Identity = 84/248 (33.87%), Postives = 128/248 (51.61%), Query Frame = 3
Query: 2724 KNRFVNIIPYDQNRVKVGEEE--YPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDE-CDCRKEITQFHMNTWLDECAPNIEYFNKFL--FRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYLTCGQNQ 3440
            KNR+ N+I YD  RV +   +     +YINA+YI  D    +  YIATQGP   T  +FW+M+W++    ++M+TKL++ +     QYWP +  D   +    + LLD ++      R   +    C+ R+E+ QF    W D   P  EY   FL   R  K  +     P  VHCS+G+ +TG FI ID +  ++ + E+ V+I+  V  +R  R  MVQ + Q+ FIHE     L + + CG  +
Sbjct:  942 KNRYANVIAYDHTRVILAPVDGIMGSDYINANYI--DGYRKQNAYIATQGPLPETFGDFWRMVWEQRAASVVMMTKLEEKSRIKCDQYWPSRGTDTYGL--VQVTLLDTMELATFCVRTFSLHKSGCNERREVRQFQFTAWPDHGVP--EYPTPFLAFLRRVKACNPPDAGPVAVHCSAGVGRTGCFIVIDAMLERI-RHERTVDIYGHVTLMRSQRNYMVQTEDQYGFIHEA----LLEAVACGNTE 1178          

HSP 2 Score: 124.405 bits (311), Expect = 3.959e-28
Identity = 81/247 (32.79%), Postives = 130/247 (52.63%), Query Frame = 3
Query: 2712 NKFKKNRFVNIIPYDQNRVKV----GEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCR-KEITQFHMNTWLDECAPNI-EYFNKFLFRFHKVASN-ASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKY 3419
            NKFK NR VNI+PY+  RV +    G E    +YINAS+I  D    +  YIATQGP   T ++FW+M+W+ N   ++MLTKL +       QYWP +       + F +  + +     ++ R+  ++D  D + + + QF    W ++  P   E F  F+ + HK       + P  VHCS+G+ +TG FI +  +  ++ + E  V+IF+TV  LR  R  MVQ + ++ F ++    +L  +
Sbjct: 1228 NKFK-NRLVNIMPYETTRVCLQPIRGLEG--SDYINASFI--DGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARY--QYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERM-RYEGAVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSF 1466          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008162.1 (pep scaffold:Pmarinus_7.0:GL477877:143952:159832:-1 gene:ENSPMAG00000007379.1 transcript:ENSPMAT00000008162.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.265 bits (334), Expect = 9.913e-34
Identity = 91/264 (34.47%), Postives = 140/264 (53.03%), Query Frame = 3
Query: 2631 DQFEKLMKESKDQESLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVGE-EEYPG-NYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNN----VQYWPDK-----TGDHLSVEGFSIILLDDLQHDGHVERKMIIS--DECDCRKE---ITQFHMNTWLDECAPNIEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQ 3374
            D+F  L  E      L+    S+ EN +K   NR++NI+PYDQ+RV++   E  PG +YINASYI    + NK+  IA QGP E T+ +FW+MIW++N   I+M+T L +       QYWPDK         +SVE  ++++        +  RK  +    E   + +   +TQFH  +W D   P          +  K ++ + + P +VHCS+G+ +TGTFI ID +   + + E+ V++F  V  +R  R  MVQ  +Q
Sbjct:   37 DEFNGLPSE---HPQLMCEAASQEENKDK---NRYINILPYDQSRVQLSPIESVPGSDYINASYINGYREKNKF--IAAQGPKEETINDFWRMIWEQNTSTIVMVTNLQERKHTKCSQYWPDKGCWTYGSVRVSVEDITVLV-------DYTIRKFCVQLVGEGPGKHQARLVTQFHFTSWPDFGVPFTPIGMLKFLKKVKTSNPSYSGPIVVHCSAGVGRTGTFIVIDAML-DMIQAEQRVDVFGFVSRIRAQRCQMVQTDLQ 284          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003525.1 (pep scaffold:Pmarinus_7.0:GL477320:686:22463:-1 gene:ENSPMAG00000003196.1 transcript:ENSPMAT00000003525.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.88 bits (333), Expect = 3.818e-32
Identity = 91/271 (33.58%), Postives = 139/271 (51.29%), Query Frame = 3
Query: 2607 RKMVETLSDQFEKLMKE--SKDQESLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKV-GEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNN----VQYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECD---CRKEITQFHMNTWLDECAPNIEYFNKFLFRFHKVAS--NASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTF 3383
            R+ V+T S    KL +E  S     +   +  +       KKNR+ +I+PYD NRVK+ GE E   +YINASY+  D   +   YIA QGP ENT  +FWQMIW++    I+M+TK ++       QYWP    D  +    ++ ++D+  +   V R + IS           +T   + +W D   P  E  N  L    +V S   A     +VHCS+G+ ++GT+I +D + R+L + E  V+++  V  LR  R +MVQ +V+F  
Sbjct:  391 RQTVQTKSASGSKLFQEEFSNFPRKINKYSQQEATQEYNTKKNRYSDILPYDHNRVKLSGEGE--SDYINASYV--DGYKSSIRYIAAQGPLENTAGDFWQMIWEKKSSVIVMVTKCEEMGKVKCFQYWPHPDEDKRAYGDVTVTIMDEKPYADIVIRTLSISHSKHRGFGAHWVTHVQLVSWPDHGVP--EDPNLLLKLRRRVNSFNGAGCTAVVVHCSAGVGRSGTYIGLDCLVRQL-ENEGHVDVYGCVFRLRHQRPLMVQVEVRFAI 654          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Sea Lamprey
Match: ptpra (protein tyrosine phosphatase receptor type A [Source:ZFIN;Acc:ZDB-GENE-020107-1])

HSP 1 Score: 131.339 bits (329), Expect = 1.963e-31
Identity = 88/275 (32.00%), Postives = 141/275 (51.27%), Query Frame = 3
Query: 2625 LSDQFEKLMKESKDQESLLHLTTSKGENANKFKKNRFVNIIPYDQNRV----KVGEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNN----VQYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCR-KEITQFHMNTWLDECAP-NIEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKY 3419
            L D+F+KL       E +       G      KKNR + IIPYD NRV    K GEE    +YIN S+I  D    K  ++A QGP + T+++FW+M+W+     I+MLT+L++       +YWP  T   ++     I L  +  HD +  R   +S+  + + ++I QFH + W +   P + +     +    K   +  NHP  VHCS+G  +TGTF  +  I  ++ K E I+++F+TV +LR  R  MVQ   Q+ F ++ +  ++  +
Sbjct:  481 LEDEFKKLTTVKIQNEKM-----RTGNLPANMKKNRVLQIIPYDFNRVIIPMKRGEEFT--DYINGSFI--DGYRQKDAFLAGQGPLQQTVEDFWRMVWEWRSCSIVMLTELEERGQEKCARYWP--TEGTITYGDIIIELKQENSHDSYTVRDFSVSNTRENKSRQIRQFHFHGWPEIGIPEDGKGMISLIAAVQKQQQHTGNHPITVHCSAGAGRTGTFCALCTILERV-KTEGILDVFQTVKSLRTQRPHMVQTLEQYEFCYKVVQEYIEAF 743          

HSP 2 Score: 129.413 bits (324), Expect = 8.964e-31
Identity = 88/254 (34.65%), Postives = 130/254 (51.18%), Query Frame = 3
Query: 2688 TTSKGENANKFKKNRFVNIIPYDQNRVKVGE-EEYP-GNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNN----VQYWPDK---TGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKE-----ITQFHMNTWLDECAPNIEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHF 3407
              SK EN    +KNR+VNI+PYD  RV +   E  P  +YINASY+    + NK+     +GP E TL ++W+MIW+ N   I+M+T L +       QYWPD+   T  +L V    + +L D     +  RK +I    D   +     ITQFH  +W D   P          +  K  +     P +VHCS+G+ +TGTFI ID +   + + E+ V++F  V  +R  R  MVQ  +Q+ FI++ +  F
Sbjct:  205 AASKEENK---EKNRYVNILPYDNFRVHLTSLEGVPDSDYINASYVNGYQEKNKFIAAQGKGPKEETLNDYWRMIWELNTATIVMVTNLKERKECKCAQYWPDQGCWTYGNLRVSVEDVTVLVD-----YTIRKFLIQVVGDIPNKKPPRLITQFHFTSWPDFGVPFAPIGMLKFLKKVKTCNPPYAGPIVVHCSAGVGRTGTFIVIDAML-DMIQTERKVDVFGFVTRIRAQRCQMVQTDMQYVFIYQALLEF 449          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Sea Lamprey
Match: ptprk (protein tyrosine phosphatase receptor type K [Source:ZFIN;Acc:ZDB-GENE-030131-9834])

HSP 1 Score: 126.716 bits (317), Expect = 1.323e-29
Identity = 86/235 (36.60%), Postives = 125/235 (53.19%), Query Frame = 3
Query: 2724 KNRFVNIIPYDQNRV--KVGEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDK----NNVQYWPDKT---GDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPNIEYFNKFLFRF-HKVASNASNH--PYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHE 3392
            KNR+ NII YD +RV   V +EE   +YINA+Y+  D     + YIATQGP  +T+  FW+MIWQE    IIM+T L +       +YWPD +   GD       + +L + +     VER    + + D R E+ QFH   W D   P   Y    L  F  ++ +    H  P +VHCS+G  +TG ++ ID I   +++ E +++I+  V  LR  R  MVQ + Q+ FIH+
Sbjct:  944 KNRYGNIIAYDHSRVMLNVLDEEQNSDYINANYV--DGYYRTHHYIATQGPLPDTVGGFWRMIWQERSASIIMVTNLVEVGRIKCCKYWPDGSDVYGDIKVTLADTEMLSEYIIRTFRVER----AGQEDIR-EVRQFHFTGWPDHGVP---YHATGLLAFIRRIKALDPPHAGPLVVHCSAGAGRTGCYMVID-IMLDMAESEGVIDIYNCVRELRTRRVNMVQTEEQYVFIHD 1167          

HSP 2 Score: 56.6102 bits (135), Expect = 3.516e-8
Identity = 30/92 (32.61%), Postives = 54/92 (58.70%), Query Frame = 3
Query: 2721 KKNRFVNIIPYDQNR---VKVGEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV--QYWPDK 2981
            +KNR+ +++P D+     + +  +    NYINA+ +  D+      +I TQ P  NT+K+FW++++  +   I+ML +LD N    QYWP++
Sbjct: 1233 EKNRYHDVLPPDRCLPFLITINGDS--SNYINAALM--DSYRQPSAFIVTQHPLPNTVKDFWRLVFDYHCTSIVMLNELDSNKYCPQYWPEE 1320          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000174.1 (pep scaffold:Pmarinus_7.0:GL479793:24808:47889:1 gene:ENSPMAG00000000154.1 transcript:ENSPMAT00000000174.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.331 bits (316), Expect = 1.851e-29
Identity = 88/271 (32.47%), Postives = 142/271 (52.40%), Query Frame = 3
Query: 2709 ANKFKKNRFVNIIPYDQNRVKVGE-EEYP-GNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTK-LDKNNVQ---YWP-DKT----GDHLSVEGFSIILLDDLQHDGHVERKMIISDE--CDCRKEITQFHMNTWLDECAPN-IEYFNKF--LFRFHKVASNASNHPYLVHC----SSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYLTCGQNQEEMYFNE 3461
            A    KNR+ NI+P+D  RVK+   E+ P  +YINA+YI     ++  EYIA QGP   T ++FW+M+W++ V  I+MLT  +++   +   YWP D T    GD        +++  D        R +++  +   D ++ +  FH   W D   P+  +    F  LFR H   +N    P +VHC    S+G+ +TGTFI +D + + + K  +I +I+  V ++R  R +MVQ ++Q+ FIH+ I   L +      + E +Y NE
Sbjct: 1158 AENRTKNRYTNILPFDVTRVKLASVEDIPHSDYINANYI--KGHSSSREYIAAQGPLAGTREDFWRMVWEQKVNQIVMLTNCVERGQPKCECYWPMDITPVRYGD------IGLVMEWDKPSPEWTIRHLVVKAQHKTDEKRSLYHFHFTAWPDHGVPDTTDSLTNFVRLFRTHVNTTNKGG-PIVVHCRCGSSAGVGRTGTFISLDHLLQDIDKKPEI-DIYGIVHDMRMSRVLMVQTEMQYIFIHKCILKVLEEEKKKDSDYEVIYSNE 1418          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Yeast
Match: PTP1 (Phosphotyrosine-specific protein phosphatase; dephosphorylates a broad range of substrates in vivo, including Fpr3p; localized to the cytoplasm and the mitochondria; proposed to be a negative regulator of filamentation [Source:SGD;Acc:S000002389])

HSP 1 Score: 92.4337 bits (228), Expect = 1.675e-20
Identity = 82/272 (30.15%), Postives = 122/272 (44.85%), Query Frame = 3
Query: 2724 KNRFVNIIPYDQNRVKVGEEEYPGN-YINASYIPYDNDANKYE---YIATQGPTENTLKEFWQMIWQ----ENVKFIIMLTKLDKNN----VQYWP--------------DKTGDHLSVEGFSIILLDDLQHDGHVERKMIISD--------ECDCRKEITQFHMNTWLDECAPNIEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDR----------ITRKLSKGEKIVN------IFETVLNLRRFRKMMVQNQVQFTFIH 3389
            +NR+VNI+PY++NRV +  +   GN YINASY+  +      E   YIATQGPT  T  +FWQM +     +N+  I+M+T L + N     QYWP              +  G    +  F   L  +  +   V+    ++D             K +  F+ + W D   P  E         H  + N+  +P +VHCS+G+ +TGTFI +D           IT +    ++         I + VL LR  R  MVQ + QF FI+
Sbjct:   55 RNRYVNIMPYERNRVHL--KTLSGNDYINASYVKVNVPGQSIEPGYYIATQGPTRKTWDQFWQMCYHNCPLDNI-VIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDYYTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPE-EVVPIMELCAHSHSLNSRGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIEQIVLQLRSQRMKMVQTKDQFLFIY 322          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Yeast
Match: PTP2 (Nuclear phosphotyrosine-specific phosphatase involved in osmosensing; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; with Msg5p co-regulates the calcium signaling pathway [Source:SGD;Acc:S000005734])

HSP 1 Score: 82.8037 bits (203), Expect = 1.703e-16
Identity = 84/340 (24.71%), Postives = 132/340 (38.82%), Query Frame = 3
Query: 2703 ENANKFKKNRFVNIIPYDQNRVKVG------------------EEEYP-------------GNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNVQYWPDKTGDHLSVEGFSIILLDDLQH----DGHVERKMI----------ISDECDCRKE---------------ITQFHMNTWLDECAPNIEYFNKFLFRFHKVASN---------------------------------ASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVN-----------IFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFL 3410
            E    F KNR+ NI+PY+ +RVK+                   ++ YP              +YINA+Y+        ++YIATQ P  +T+ +FW++I    VK II L   D+ N++ W D   ++LS    +I L +  ++    +G V R             IS +CD                   + Q     WLD C  ++      + + HKV ++                                 A++ P LVHCS+G  +TG F+ +D +   LS      N           IF  V  LR+ R  MVQN  Q+   +E + ++ 
Sbjct:  404 EGIQSFTKNRYSNILPYEHSRVKLPHSPKPPAVSEASTTETKTDKSYPMCPVDAKNHSCKPNDYINANYLKLTQINPDFKYIATQAPLPSTMDDFWKVITLNKVKVIISLNSDDELNLRKW-DIYWNNLSYSNHTIKLQNTWENICNINGCVLRVFQVKKTAPQNDNISQDCDLPHNGDLTSITMAVSEPFIVYQLQYKNWLDSCGVDMND----IIKLHKVKNSLLFNPQSFITSLEKDVCKPDLIDDNNSELHLDTANSSPLLVHCSAGCGRTGVFVTLDFLLSILSPTTNHSNKIDVWNMTQDLIFIIVNELRKQRISMVQNLTQYIACYEALLNYF 738          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Nematostella
Match: EDO48187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK45])

HSP 1 Score: 153.68 bits (387), Expect = 5.227e-39
Identity = 90/247 (36.44%), Postives = 139/247 (56.28%), Query Frame = 3
Query: 2682 HLTTSKGENANKFKKNRFVNIIPYDQNRVKVGE-EEYPG-NYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKN----NVQYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDE-CDCRKEITQFHMNTWLDECAPNIEYFNKFLF-RFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYI 3398
            H+T +   +     KNR++NI+ YD +RVK+ + E+ PG +YINA+++P     N Y  IA QGP   T ++FW+M+W++N + IIMLT L +       QYWP +    LS E  ++ L    +   ++ R + +  E CD  +++ QFH  +W D   P     N   F R    A      P +VHCS+G+ +TGTFI ID + +++ + EK V+I   V  LRR R +MVQ + Q+ FIH+ +
Sbjct:   33 HVTATHSLDPVNQHKNRYINIVAYDHSRVKLQDFEDEPGSDYINANFLPGYRRDNAY--IAAQGPLAETCRDFWRMVWEQNSRTIIMLTNLKERCRDKCAQYWPSRGS--LSYEDITVTLDSVTELTPYIVRTLSVQREGCDDVRQVKQFHFTSWPDHGVPT-SVCNLLAFVRDSTRADPPGAGPMVVHCSAGVGRTGTFIVIDVMLQQIHE-EKTVDILGFVSTLRRHRNLMVQTEQQYIFIHDAL 273          

HSP 2 Score: 126.331 bits (316), Expect = 5.685e-30
Identity = 85/304 (27.96%), Postives = 153/304 (50.33%), Query Frame = 3
Query: 2553 ESPVTSSDINEQSITTNKRKMVETLSDQFEKLMKESKDQESLLHLTTSKGENANKFKKNRFVNIIPYDQNRVK----VGEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTK-LDKNNV---QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKM--IISDECDCRKEITQFHMNTWLDECAPNIEYFNK-----FLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKY 3419
            E+  ++SD+        ++      +  F +  K S+   S L L  +     NK +KNR+ N++PYD  RV+    VG E    +YINA+YI  D    K  +IATQ P   T+ +FW+M+W++N   I+ L + +++      +YWP   G      G  ++ + D    GH+  ++  + + E    +++ QFH  +W +E  P  +  ++      + +     + +  HP +VHCS+G+ +TG F  +  +  +L K E +V++F+TV  LR  R  MVQ + Q+ F ++ +  +L  +
Sbjct:  281 ETETSASDLRSHIRRLQEQDPESGYTPMFTEFQKLSRCINSSLSLNAAT-HPVNK-RKNRYANVLPYDVTRVRLSMQVGVEG--SDYINANYI--DGYMAKRTFIATQAPIPETIPDFWRMVWEQNCCTIVTLAQEVEQAKAKMHRYWP---GKQPITFGSLVVEMQDKVKSGHLVVRIFKLTNTEVSASRDVRQFHYTSWTEE-NPLEDGLSRCQLIDLIGQVQYWQAESGRHPIIVHCSAGVGRTGVFCAVSILIERL-KAEAMVDVFQTVKQLREQRPAMVQTKGQYDFCYQVVLEYLASF 573          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Nematostella
Match: EDO38304 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDC7])

HSP 1 Score: 137.117 bits (344), Expect = 1.289e-35
Identity = 85/241 (35.27%), Postives = 132/241 (54.77%), Query Frame = 3
Query: 2700 GENANKFKKNRFVNIIPYDQNRVKVGEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV-----QYWPDKTGDHLSVEG-FSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMN--TWLDECAPN--IEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHE 3392
            G+N     KNR+ N++PY+  RV++       +YINA++I    D + Y YIATQGP  NT K+FWQMIW++ V+ + M+T LDK        +YWPD T   L + G F + LL    +D  V+R + +       K I   H+N   W D   P   +E   +F+     +A+  S  P +VHCS+GI +TG  I +D +   L + +K  +I +T+ +LR  R+ M+Q + Q+ F ++
Sbjct:   51 GKNQANTDKNRYRNVLPYEATRVRLSGSSGE-DYINANHIRVLVDDDTYHYIATQGPLPNTTKDFWQMIWEQGVEVVAMVT-LDKEGGKVKCHRYWPDNTNQPLKLGGRFEVSLLKQTNYDSFVQRDIAVK-HLQSGKSIEIAHLNFVKWPDHGVPRSPVEMV-QFVAYMRSLAT--SQAPVVVHCSAGIGRTGALIAVD-VALGLMERDKPFDINQTIRDLREQRQGMIQTKDQYIFCYK 284          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Nematostella
Match: EDO47893 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL98])

HSP 1 Score: 130.954 bits (328), Expect = 9.384e-34
Identity = 81/250 (32.40%), Postives = 131/250 (52.40%), Query Frame = 3
Query: 2685 LTTSKGENANKFKKNRFVNIIPYDQNRVKVGEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEG-FSIILLDDLQHDGHVERKMIISDECDCR--KEITQFHMNTWLDECAPNIEYFNKFLFRFHKVASNASNH-----PYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYI 3398
             T+   + ++   KNR+ NI  YD +RV +       +YINA+YI  D D     YIA QGP E++  +FWQM+WQE    I+MLT L + N     QYWP  + D  +  G  ++ L    +   +  R +++S +   +  + I Q+   +W     P        L RF K   N S H     P+++HCS+G+ +TG F+ ID + R+ +K +K+V+I+  V ++   R  ++Q + Q+ FIH+ I
Sbjct:    7 FTSHAAKLSHNRAKNRYGNIQAYDHSRVMLRGAGSGCDYINATYIK-DFDGTPKTYIAAQGPLESSCNDFWQMVWQEKCSVIVMLTGLIERNELKCHQYWP--STDQPAAYGVLTVSLKKKEEFSDYTVRSLLLSKQGTLKEVRLIHQYQFTSWPHRGVPQ---QTAALLRFRKNIINRSPHVSESGPWIIHCSAGVGRTGIFLVIDAMLRQ-AKEKKVVDIYNYVHSIEEDRPYIIQTKDQYVFIHQTI 249          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Nematostella
Match: EDO48949 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI09])

HSP 1 Score: 131.339 bits (329), Expect = 1.297e-33
Identity = 79/239 (33.05%), Postives = 129/239 (53.97%), Query Frame = 3
Query: 2700 GENANKFKKNRFVNIIPYDQNRVKVGE--EEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDD-LQHDGHVERKMIISD-ECDCRKEITQFHMNTWLDECAPNIEYFNKFLFRFHKVAS---NASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTF 3383
            G+     +KNR+ +++PYD NRV + E       +YINAS+I  D+D     YIATQGP  +T+ +FWQM+W++ V  I+ LT+L    +    +YWP+    H +   + + L+ + +  D ++ R   + + +    + +TQFH  +W D   P      K L  F +  +      + P +VHCS G+ +TG +I ID +  K+ +G K ++I  TV +LR  R  MV+ + QF F
Sbjct:   51 GKQDKNVRKNRYSDVLPYDHNRVSLRETANATGSDYINASFI-TDHDPRNPAYIATQGPLAHTVSDFWQMVWEQGVVVIVNLTRLSDLGLPQCHRYWPED--GHETYHIYEVHLVSEHIWCDDYLVRSFYLKNLQTSETRTVTQFHFLSWPDLNVPTTP---KPLLEFRRKVNKCFRGRSCPIVVHCSGGVGRTGCYILIDLVLNKMMRGAKEIDIAATVEHLRDQRPHMVKTKAQFEF 283          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Nematostella
Match: EDO30982 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ92])

HSP 1 Score: 129.028 bits (323), Expect = 2.167e-33
Identity = 80/232 (34.48%), Postives = 124/232 (53.45%), Query Frame = 3
Query: 2724 KNRFVNIIPYDQNRV---KVGEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKL----DKNNVQYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKE-ITQFHMNTWLDECAPNIEYFNKFLFRFHKVASNA--SNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIH 3389
            KNR+ NI+ YD +RV   K+  + +  +YINASY+  D D +   YIATQG  E +  +FW+M+WQE    I+MLT L     K   QYWPD T  + ++    + L        ++ R  ++S      +  + Q+H   W D+  P  +Y    L    K+  ++     P+++HCS+G+ +TG F+ ID + R+ +K +K V+IF  V  +R  R  MVQ   Q+ FIH
Sbjct:   13 KNRYANIVTYDHSRVVLEKLSNDPH-SDYINASYL-RDYDGSPKAYIATQGCVEPSSGDFWRMMWQERRCVIVMLTGLIEGHKKKCHQYWPDSTSKYCNLR---VTLRKTEVFADYIIRTFVMSQVGQTEERYVYQYHFTVWPDKGVP--QYATAVLGLRRKITKDSLPGARPWVIHCSAGVGRTGAFLVIDAMLRQ-AKKQKTVDIFNYVKAIREDRPHMVQTSEQYVFIH 236          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Medaka
Match: ptprfa (protein tyrosine phosphatase receptor type F [Source:NCBI gene;Acc:101157606])

HSP 1 Score: 148.673 bits (374), Expect = 1.520e-35
Identity = 98/275 (35.64%), Postives = 150/275 (54.55%), Query Frame = 3
Query: 2625 LSDQFEKL-----MKESKDQESLLHLTTSKGENAN---KFKKNRFVNIIPYDQNRVKV-GEEEYPG-NYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIIS-DECDCRKEITQFHMNTWLDECAPNIEYFNKFLFRFHKV-ASNASNH-PYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYI 3398
            L++  E+L     ++ S++ ES+        EN+N      KNR+ N+I YD +RV +   +  PG +YINA+YI  D    +  YIATQGP   TL +FW+M+W++    I+M+T+L++ +     QYWP +  +   +    + LLD ++   HV R   IS +    ++E+ QF    W D   P  EY   FL   H+V A N     P +VHCS+G+ +TG FI ID +  +L K EK V+I+  V  +R  R  MVQ + Q+ FIH+ +
Sbjct: 1232 LAEHVERLKAHECLRFSQEYESIDPGQQFTWENSNLDVNKAKNRYANVIAYDHSRVTLTAVDGVPGSDYINANYI--DGYRRQNAYIATQGPLPETLADFWRMVWEQKTCTIVMMTRLEEKSRVKCDQYWPSRGTETYGM--IQVTLLDTVELAAHVIRTFTISKNNSSDKREVRQFQFLAWPDHGVP--EYPTPFLAFVHRVKACNPQRAGPMVVHCSAGVGRTGCFIVIDAMLDRL-KREKSVDIYGQVTCMRAQRNYMVQTEDQYVFIHDVL 1499          

HSP 2 Score: 122.865 bits (307), Expect = 1.227e-27
Identity = 77/247 (31.17%), Postives = 130/247 (52.63%), Query Frame = 3
Query: 2712 NKFKKNRFVNIIPYDQNRVKV----GEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNV----QYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCR-KEITQFHMNTWLDECAPN-IEYFNKFLFRFHKVASN-ASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKY 3419
            NKFK NR +NI+P++  RV +    G E    +YINAS+I  D    +  YIATQGP   T ++ W+M+W+ N   ++MLTKL +       QYWP +       + F++  + +     ++ R+  +++  D + K I QF    W ++  P  +E F  F+ + HK       + P  VHCS+G+ +TG FI +  +  ++ + E ++++F+TV  LR  R  MVQ + Q+   +     +L  +
Sbjct: 1559 NKFK-NRLMNILPFESTRVCLHPIRGLEG--SDYINASFI--DGYRKQKAYIATQGPLPETTEDLWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARY--QYFTVDPMAEYNMPEYILREFKVTNSRDGQSKTIRQFQFTGWPEQGVPQRVEGFIDFIGQVHKTKEQFGQDGPITVHCSTGVGRTGVFITLSIVLERIRQ-EGVIDVFQTVKVLRTQRPAMVQTEEQYQLCYRAALEYLGSF 1797          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Medaka
Match: PTPRB (protein tyrosine phosphatase receptor type B [Source:NCBI gene;Acc:101171375])

HSP 1 Score: 147.517 bits (371), Expect = 3.405e-35
Identity = 105/342 (30.70%), Postives = 173/342 (50.58%), Query Frame = 3
Query: 2481 MDSWSLYSDNSMYFNTQTSKNEILESPVTSSDINEQSITTNKRKMVETLSDQFEKLMKESKDQE-SLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVG--EEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTK-LDKNNV---QYWPDKT-----GDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPNIEYFNKFLFRFHK-----VASNASNHPYLVHCSSGICQTGTFICIDRITRKL-SKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYLTCGQNQEEMY 3452
            M  W     + +Y   ++  N  + SP+ +    E  +   +      LS++FE L    ++Q   +  L  ++G       KNR+ NI+PYD  R+K+   E++   ++INASYIP +N   + EYIATQGP   T  +FW+M+W+ NV  I+M+T+ ++K  V   QYWP  T     GD L ++  S  +L +       E K+I    C   + +  FH   W D   P      + L +F +     V  + S    +VHCS+G+ +TGTFI +DR+ ++L SKG   ++++  V +LR  R+ MVQ + Q+ F+H+ +   L       + +  +Y
Sbjct: 1608 MSMWKEVPASGLYMGVRS--NRRVTSPIKACHF-ESHLAKLQADSNYLLSEEFEDLKDVGRNQTMDVARLPENRG-------KNRYNNILPYDSTRLKLSYLEDDPCSDFINASYIPGNN--YRREYIATQGPLPGTKDDFWRMVWEHNVYNIVMVTQCVEKGRVKCDQYWPADTEPLYYGD-LVIQMLSESVLPEWTIR---EFKVISESSCSYPRMLRHFHYTVWPDHGVPET---TQSLIQFVRTVRDYVDRSPSTGATVVHCSAGVGRTGTFIALDRVLQQLDSKG--TIDLYGIVFDLRLHRQHMVQTECQYAFLHQCVRDVLRARKHRSEQENPLY 1928          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Medaka
Match: PTPRB (protein tyrosine phosphatase receptor type B [Source:NCBI gene;Acc:101171375])

HSP 1 Score: 147.517 bits (371), Expect = 3.479e-35
Identity = 105/342 (30.70%), Postives = 173/342 (50.58%), Query Frame = 3
Query: 2481 MDSWSLYSDNSMYFNTQTSKNEILESPVTSSDINEQSITTNKRKMVETLSDQFEKLMKESKDQE-SLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVG--EEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTK-LDKNNV---QYWPDKT-----GDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPNIEYFNKFLFRFHK-----VASNASNHPYLVHCSSGICQTGTFICIDRITRKL-SKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYLTCGQNQEEMY 3452
            M  W     + +Y   ++  N  + SP+ +    E  +   +      LS++FE L    ++Q   +  L  ++G       KNR+ NI+PYD  R+K+   E++   ++INASYIP +N   + EYIATQGP   T  +FW+M+W+ NV  I+M+T+ ++K  V   QYWP  T     GD L ++  S  +L +       E K+I    C   + +  FH   W D   P      + L +F +     V  + S    +VHCS+G+ +TGTFI +DR+ ++L SKG   ++++  V +LR  R+ MVQ + Q+ F+H+ +   L       + +  +Y
Sbjct: 1697 MSMWKEVPASGLYMGVRS--NRRVTSPIKACHF-ESHLAKLQADSNYLLSEEFEDLKDVGRNQTMDVARLPENRG-------KNRYNNILPYDSTRLKLSYLEDDPCSDFINASYIPGNN--YRREYIATQGPLPGTKDDFWRMVWEHNVYNIVMVTQCVEKGRVKCDQYWPADTEPLYYGD-LVIQMLSESVLPEWTIR---EFKVISESSCSYPRMLRHFHYTVWPDHGVPET---TQSLIQFVRTVRDYVDRSPSTGATVVHCSAGVGRTGTFIALDRVLQQLDSKG--TIDLYGIVFDLRLHRQHMVQTECQYAFLHQCVRDVLRARKHRSEQENPLY 2017          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Medaka
Match: PTPRB (protein tyrosine phosphatase receptor type B [Source:NCBI gene;Acc:101171375])

HSP 1 Score: 147.517 bits (371), Expect = 3.495e-35
Identity = 105/342 (30.70%), Postives = 173/342 (50.58%), Query Frame = 3
Query: 2481 MDSWSLYSDNSMYFNTQTSKNEILESPVTSSDINEQSITTNKRKMVETLSDQFEKLMKESKDQE-SLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVG--EEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTK-LDKNNV---QYWPDKT-----GDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPNIEYFNKFLFRFHK-----VASNASNHPYLVHCSSGICQTGTFICIDRITRKL-SKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYLTCGQNQEEMY 3452
            M  W     + +Y   ++  N  + SP+ +    E  +   +      LS++FE L    ++Q   +  L  ++G       KNR+ NI+PYD  R+K+   E++   ++INASYIP +N   + EYIATQGP   T  +FW+M+W+ NV  I+M+T+ ++K  V   QYWP  T     GD L ++  S  +L +       E K+I    C   + +  FH   W D   P      + L +F +     V  + S    +VHCS+G+ +TGTFI +DR+ ++L SKG   ++++  V +LR  R+ MVQ + Q+ F+H+ +   L       + +  +Y
Sbjct: 1717 MSMWKEVPASGLYMGVRS--NRRVTSPIKACHF-ESHLAKLQADSNYLLSEEFEDLKDVGRNQTMDVARLPENRG-------KNRYNNILPYDSTRLKLSYLEDDPCSDFINASYIPGNN--YRREYIATQGPLPGTKDDFWRMVWEHNVYNIVMVTQCVEKGRVKCDQYWPADTEPLYYGD-LVIQMLSESVLPEWTIR---EFKVISESSCSYPRMLRHFHYTVWPDHGVPET---TQSLIQFVRTVRDYVDRSPSTGATVVHCSAGVGRTGTFIALDRVLQQLDSKG--TIDLYGIVFDLRLHRQHMVQTECQYAFLHQCVRDVLRARKHRSEQENPLY 2037          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Medaka
Match: ptpra (protein tyrosine phosphatase receptor type A [Source:NCBI gene;Acc:100125803])

HSP 1 Score: 139.043 bits (349), Expect = 4.968e-33
Identity = 83/245 (33.88%), Postives = 140/245 (57.14%), Query Frame = 3
Query: 2718 FKKNRFVNIIPYDQNRV----KVGEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNN----VQYWPDKTGDHLSVEG-FSIILLDDLQHDGHVERKMIISDECDCR-KEITQFHMNTWLDECAP-NIEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKY 3419
             KKNR + IIPY+ NRV    K GEE    +Y+NAS+I  D    K  YIA+QGP ++T+++FW+MIW+     I+MLT+L++       QYWP   GD + V G  SI L  + +++ +  R +++++  + + + + QFH + W +   P + +     +    K    + NHP  VHCS+G  +TGTF  +  +  ++ K E I+++F+TV +LR  R  MVQ   Q+ F ++ +  +++ +
Sbjct:  589 MKKNRVLQIIPYEFNRVIIPVKRGEENT--DYVNASFI--DGYRQKDAYIASQGPLQHTMEDFWRMIWEWRSCSIVMLTELEERGQEKCAQYWP---GDGVVVYGDLSIELKREEENESYTVRDLLVTNNRENKARSVRQFHFHGWPEVGIPADGKGMINIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLERV-KAEGILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYIDAF 825          

HSP 2 Score: 132.88 bits (333), Expect = 4.330e-31
Identity = 93/261 (35.63%), Postives = 143/261 (54.79%), Query Frame = 3
Query: 2688 TTSKGENANKFKKNRFVNIIPYDQNRVKV-GEEEYP-GNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNN----VQYWPDKT----GD-HLSVEGFSIILLDDLQHDGHVERKMIISDECDC-----RKEITQFHMNTWLDECAPNIEYFNKFLFRFHKVASNASNH---PYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHE-YIHHFL 3410
              SK EN    +KNR+VNI+PYD +RV +   E  P  ++INAS+I    + NK+  IA QGP E T+ +FW+MIW++N   I+M+T L +       QYWPD+     G+  +SVE  +++L+D      +  RK  I    D      ++ +TQFH  +W D   P   +    + +F K   N + H     +VHCS+G+ +TGTFI ID +   ++  E+ V++F  V  +R  R  MVQ  +Q+ FI +  + H+L
Sbjct:  289 AASKEENK---EKNRYVNILPYDHSRVHLLSLEGVPDSDFINASFINGYQEKNKF--IAAQGPKEETVNDFWRMIWEQNTSTIVMVTNLKERKECKCAQYWPDQGCWTYGNIRVSVED-TVVLVD------YTVRKFCIQQVGDVSGKKPQRLLTQFHFTSWPDFGVP---FTPIGMLKFLKKVKNCNPHYAGAIVVHCSAGVGRTGTFIVIDAMLDMMN-AERKVDVFGFVTRIRAQRCQMVQTDMQYVFIFQALLEHYL 533          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Planmine SMEST
Match: SMESG000067957.1 (SMESG000067957.1)

HSP 1 Score: 1352.81 bits (3500), Expect = 0.000e+0
Identity = 686/758 (90.50%), Postives = 704/758 (92.88%), Query Frame = 3
Query: 1200 MYFLLLCFLFNPASPNKDNLIDFGGLDYFSSEDFMSAKIIFISKESRIQLKVFSSTDKWGECTGKDTVRCNIGQSVQFDLEVTKGTSKVAIPFTVFCTTDNKFKNANAIQNLEVTHDNKRIYSGWLQNKTGNFSHYFVICMSSARDIQMINMTDNVLILTGLKDQIWYQVCVAIVDNQNRKGMFNCSKVLFDQKKFNRNAMYNSYTNLATSNKMEAFSREDILKQKSSDKII---VDLNSFNVNVTVVANGERLNISWEINDGMQGTIFAYILLLKTGSNVCENAIYFVCSNCKAPLNSKYLSQNDIQKLKSLRKCGIESEEYFDIAKISFSVEKKFNRNLSNAITTFYAINLQGVHQIRIREIVNYKFXXXXXXXXXXXXXXXXXXXXMKKRNLSFICRSKRKSPKCQMPTRVLDTDSLDNTVFTLNHGMDSWSLYSDNSMYFNTQTSKNEILESPVTSSDINEQSITTNKRKMVETLSDQFEKLMKESKDQESLLHLTTSKGENANKFKKNRFVNIIPYDQNRVKVGEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNVQYWPDKTGDHLSVEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPNIEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYLTCGQNQEEMYFNEI 3464
            MYF+LLCFLFNPASPNKDNLID G LDYF SED +SAKI FISKES IQLKV     K  +CTG   V C+  +S+Q DLEVTKG SKVAIPFTVFCTTDNKFKNANAIQNLEVTHDNKRIYSGWLQNKTGNFSHYFVICMSS RDIQMINMTDNVLILTGLKDQ WYQVC A VD++N    F C KVLF      R  MY SYTNL TS  M++FSREDILK KS+D+II   VDL+S NVN+TVV N ERLNISWEINDGM+G+IFAYILL+K  SNVCENAIYFVCSNCKAPLNSKYLSQNDIQKLKSLRKCGIESEEYFDIAKISFSVEKKFNRNLSNAITTFYAINLQGVHQIRIREIVNYKFILIPYLPIVLSISIILFLIYMKKRNLSFICRSKRKSPKCQMPTRVLDTDSLDNTVFTLNHGMDSWSLYSDNSMYFNTQTSKNEILESPVTSSDINEQSITTNKRKMVETLSDQFEKLMKESKDQESLLHLT SKGENANKFKKNRFVNIIPYDQNRVKVGEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNVQYWPDKTGDHLSVEGFSI+LLDDLQHDGHVERKMIISDE DCRKEITQFHMNTWLDECAPNIEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYLTCGQNQEEMYFNEI
Sbjct:    1 MYFILLCFLFNPASPNKDNLIDLGALDYFFSEDLISAKITFISKESGIQLKV--KCPKHVKCTGNVIVECSKSKSMQLDLEVTKGISKVAIPFTVFCTTDNKFKNANAIQNLEVTHDNKRIYSGWLQNKTGNFSHYFVICMSSTRDIQMINMTDNVLILTGLKDQTWYQVCAANVDSRNTISRFLCKKVLFI-----RTTMYTSYTNLTTSYNMKSFSREDILKHKSTDEIISELVDLDSSNVNITVVPNVERLNISWEINDGMRGSIFAYILLIKMRSNVCENAIYFVCSNCKAPLNSKYLSQNDIQKLKSLRKCGIESEEYFDIAKISFSVEKKFNRNLSNAITTFYAINLQGVHQIRIREIVNYKFILIPYLPIVLSISIILFLIYMKKRNLSFICRSKRKSPKCQMPTRVLDTDSLDNTVFTLNHGMDSWSLYSDNSMYFNTQTSKNEILESPVTSSDINEQSITTNKRKMVETLSDQFEKLMKESKDQESLLHLTMSKGENANKFKKNRFVNIIPYDQNRVKVGEEEYPGNYINASYIPYDNDANKYEYIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNVQYWPDKTGDHLSVEGFSILLLDDLQHDGHVERKMIISDEYDCRKEITQFHMNTWLDECAPNIEYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGEKIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYLTCGQNQEEMYFNEI 751          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Planmine SMEST
Match: SMESG000049236.1 (SMESG000049236.1)

HSP 1 Score: 507.679 bits (1306), Expect = 3.162e-172
Identity = 253/253 (100.00%), Postives = 253/253 (100.00%), Query Frame = 1
Query:  124 MTIRRPKASVVIDAYETITDSSIRKWKVSEVTTPVLTERFALKILSENSNNKSYGSLNETFEKNIHLNFQNSFTSSFIESHSKNMSISAIPIFKIMSPIKCEPVTEKRIIHVINESANEDTQEAIALTSDHVKSSLESQITEENINVINETQEFNSLIQSSGIPQIIPEEKSMEILEDIDYAQLSSSDDGDSELPKIENLKIGRQTKLTEKENISKQCYQVNRFRLHVDIDATQISESPEIIIPKRLLKNLRF 882
            MTIRRPKASVVIDAYETITDSSIRKWKVSEVTTPVLTERFALKILSENSNNKSYGSLNETFEKNIHLNFQNSFTSSFIESHSKNMSISAIPIFKIMSPIKCEPVTEKRIIHVINESANEDTQEAIALTSDHVKSSLESQITEENINVINETQEFNSLIQSSGIPQIIPEEKSMEILEDIDYAQLSSSDDGDSELPKIENLKIGRQTKLTEKENISKQCYQVNRFRLHVDIDATQISESPEIIIPKRLLKNLRF
Sbjct:    1 MTIRRPKASVVIDAYETITDSSIRKWKVSEVTTPVLTERFALKILSENSNNKSYGSLNETFEKNIHLNFQNSFTSSFIESHSKNMSISAIPIFKIMSPIKCEPVTEKRIIHVINESANEDTQEAIALTSDHVKSSLESQITEENINVINETQEFNSLIQSSGIPQIIPEEKSMEILEDIDYAQLSSSDDGDSELPKIENLKIGRQTKLTEKENISKQCYQVNRFRLHVDIDATQISESPEIIIPKRLLKNLRF 253          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Planmine SMEST
Match: SMESG000049225.1 (SMESG000049225.1)

HSP 1 Score: 512.686 bits (1319), Expect = 1.559e-171
Identity = 277/418 (66.27%), Postives = 296/418 (70.81%), Query Frame = 3
Query: 1200 MYFLLLCFLFNPASPNKDNLIDFGGLDYFSSEDFMSAKIIFISKESRIQLKVFSSTDKWGECTGKDTVRCNIGQSVQFDLEVTKGTSKVAIPFTVFCTTDNKFKNANAIQNLEVTHDNKRIYSGWLQNKTGNFSHYFVICMSSARDIQMINM----TDNVLILTGLK-----------------------------------------DQIWYQVCVAIVDNQ----NRKGMFNCSKV--------------LFDQKKFNRNAMYNSYTNLATSNKMEAFSREDILKQKSSDKIIVDLNSFNVNVTVVANGERLNISWEINDGMQGTIFAYILLLKTGSNVCENAIYFVCSNCKAPLNSKYLSQNDIQKLKSLRKCGIESEEYFDIAKISFSVEKKFNRNLSNAITTFYAINLQGVHQ 2264
            MYFLLLCFLFNPASPNKDNLIDFGGLDYFSSEDFMSAKIIFISKESRIQLKVFSSTDKWGECTGKDTVRCNIGQSVQFDLEVTKGTSKVAIPFTVFCT DNKFKNAN IQNLEVTHDNKRIYSGWLQNKTGNFSHYFVICMS  R IQ I       D++ I T +K                                         D   Y++C      +     R  + N  KV              LFDQKKFNRNAMYNSYTNLATSNKMEAFSREDILKQKSSDKIIVDLNS NV VTVVANGERLNISWEINDGMQG+IFAYILLLKTGSNVCENAIYFVCS+CKAPLNS YL   D + +   ++C  +  E FD+ ++ F   K  ++  SNA   FYAIN  G  Q
Sbjct:    1 MYFLLLCFLFNPASPNKDNLIDFGGLDYFSSEDFMSAKIIFISKESRIQLKVFSSTDKWGECTGKDTVRCNIGQSVQFDLEVTKGTSKVAIPFTVFCTADNKFKNANTIQNLEVTHDNKRIYSGWLQNKTGNFSHYFVICMS--RTIQSIGFYARYVDDIFITTEIKKEAEEIFHIFNEDHPEIKFEIEYPDINGSLNLLDLRIKIDVDTPTYELCKKSAGEEIFMHQRSALPNLQKVNFIKNDKQRIANRSLFDQKKFNRNAMYNSYTNLATSNKMEAFSREDILKQKSSDKIIVDLNSCNVKVTVVANGERLNISWEINDGMQGSIFAYILLLKTGSNVCENAIYFVCSDCKAPLNSAYLRGKDQEIISRYKECHNQFTERFDMNQMHFHYVKDLDKTQSNA-KEFYAINFLGPIQ 415          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Planmine SMEST
Match: SMESG000068005.1 (SMESG000068005.1)

HSP 1 Score: 503.827 bits (1296), Expect = 1.268e-170
Identity = 251/253 (99.21%), Postives = 252/253 (99.60%), Query Frame = 1
Query:  124 MTIRRPKASVVIDAYETITDSSIRKWKVSEVTTPVLTERFALKILSENSNNKSYGSLNETFEKNIHLNFQNSFTSSFIESHSKNMSISAIPIFKIMSPIKCEPVTEKRIIHVINESANEDTQEAIALTSDHVKSSLESQITEENINVINETQEFNSLIQSSGIPQIIPEEKSMEILEDIDYAQLSSSDDGDSELPKIENLKIGRQTKLTEKENISKQCYQVNRFRLHVDIDATQISESPEIIIPKRLLKNLRF 882
            MTIRRPKASVVIDAYET TDSSIRKWKVSEVTTPV+TERFALKILSENSNNKSYGSLNETFEKNIHLNFQNSFTSSFIESHSKNMSISAIPIFKIMSPIKCEPVTEKRIIHVINESANEDTQEAIALTSDHVKSSLESQITEENINVINETQEFNSLIQSSGIPQIIPEEKSMEILEDIDYAQLSSSDDGDSELPKIENLKIGRQTKLTEKENISKQCYQVNRFRLHVDIDATQISESPEIIIPKRLLKNLRF
Sbjct:    1 MTIRRPKASVVIDAYETKTDSSIRKWKVSEVTTPVVTERFALKILSENSNNKSYGSLNETFEKNIHLNFQNSFTSSFIESHSKNMSISAIPIFKIMSPIKCEPVTEKRIIHVINESANEDTQEAIALTSDHVKSSLESQITEENINVINETQEFNSLIQSSGIPQIIPEEKSMEILEDIDYAQLSSSDDGDSELPKIENLKIGRQTKLTEKENISKQCYQVNRFRLHVDIDATQISESPEIIIPKRLLKNLRF 253          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Planmine SMEST
Match: SMESG000067946.1 (SMESG000067946.1)

HSP 1 Score: 477.248 bits (1227), Expect = 5.383e-158
Identity = 242/363 (66.67%), Postives = 278/363 (76.58%), Query Frame = 3
Query: 1200 MYFLLLCFLFNPASPNKDNLIDFGGLDYFSSEDFMSAKIIFISKESRIQLKVFSSTDKWGECTGKDTVRCNIGQSVQFDLEVTKGTSKVAIPFTVFCTTDNKFKNANAIQNLEVTHDNKRIYSGWLQNKTGNFSHYFVICMSSARDIQMINMTDNVLILTGLKDQIWYQVCVAIVDNQNRKGMFNCSKVLFDQKKFNRNAMYNSYTNLATSNKMEAFSREDILKQKSSDKII---VDLNSFNVNVTVVANGERLNISWEINDGMQGTIFAYILLLKTGSNVCENAIYFVCSNCKAPLNSKYLSQNDIQKLKSLRKCGIESEEYFDIAKISFSVEKKFNRNLSNAITTFYAINLQGVHQIRIRE 2279
            MYF+LLCFLFNP   N DNLID G LDYF SEDF SAKI F SKES IQLKV     K  +CT KDTV CN G+SVQ DLEVTK  S V IPFTV CT   + KNA+ I NLEVTHDNKRIYSGWLQNKTGNFSHYFVICMSSA + ++INMT+N +ILTG+K+Q WYQVC A VDN+NR+ +F C  VLFDQKKFNR AMY SYTNL TS+ M++FSREDILK K +D+II   VDL+S NVNVTVVANGERLNISWEIN GM+G+IFAYILL KT SNVCENAIYFVCS+CKAPLNS YLS  D + +   ++C  +  E FD+ ++ F  EK FN+  SN +  FYAIN  G H I + +
Sbjct:    1 MYFILLCFLFNPTFSNDDNLIDLGALDYFFSEDFFSAKITFRSKESGIQLKV--KCPKHVKCTEKDTVECNKGESVQLDLEVTKVISTVVIPFTVLCTPYKRSKNADFIDNLEVTHDNKRIYSGWLQNKTGNFSHYFVICMSSAGESKIINMTNNAIILTGVKNQTWYQVCAASVDNRNRRSLFTCGNVLFDQKKFNRTAMYTSYTNLTTSSNMKSFSREDILKHKCTDEIISELVDLDSSNVNVTVVANGERLNISWEINYGMRGSIFAYILLFKTLSNVCENAIYFVCSDCKAPLNSTYLSGKDQEIISRHKECHNQLTERFDMNQMHFHYEKYFNKTQSN-VKEFYAINFLGAHSITLAQ 360          
The following BLAST results are available for this feature:
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPRF3.362e-3431.79protein tyrosine phosphatase receptor type F [Sour... [more]
PTPRF3.752e-3432.41protein tyrosine phosphatase receptor type F [Sour... [more]
PTPRF4.543e-3432.41protein tyrosine phosphatase receptor type F [Sour... [more]
PTPRJ8.020e-3335.66protein tyrosine phosphatase receptor type J [Sour... [more]
PTPRJ8.179e-3335.66protein tyrosine phosphatase receptor type J [Sour... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y41D4A.53.820e-3334.40Tyrosine-protein phosphatase [Source:UniProtKB/Tr... [more]
dep-11.030e-3236.55Receptor-type tyrosine-protein phosphatase dep-1 ... [more]
dep-11.722e-3136.48Receptor-type tyrosine-protein phosphatase dep-1 ... [more]
ptp-35.980e-3035.42Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-36.293e-3035.42Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptp4E9.471e-3334.57gene:FBgn0004368 transcript:FBtr0343528[more]
Ptp4E9.937e-3334.57gene:FBgn0004368 transcript:FBtr0070725[more]
Ptp4E1.038e-3234.57gene:FBgn0004368 transcript:FBtr0343529[more]
Ptp4E1.040e-3234.57gene:FBgn0004368 transcript:FBtr0070724[more]
Ptp4E1.040e-3234.57gene:FBgn0004368 transcript:FBtr0301796[more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprjb.19.354e-3535.78protein tyrosine phosphatase receptor type Jb, tan... [more]
ptprjb.27.878e-3433.90protein tyrosine phosphatase receptor type Jb, tan... [more]
ptprb3.995e-3332.00protein tyrosine phosphatase receptor type b [Sour... [more]
ptprb3.995e-3332.00protein tyrosine phosphatase receptor type b [Sour... [more]
ptpn184.554e-3328.17protein tyrosine phosphatase non-receptor type 18 ... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sema6d7.910e-3332.87semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070][more]
sema6d8.191e-3332.87semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070][more]
sema6d9.005e-3332.87semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070][more]
sema6d9.361e-3332.87semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070][more]
mtpn6.648e-3235.13myotrophin [Source:Xenbase;Acc:XB-GENE-1014016][more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptprj2.225e-3334.92protein tyrosine phosphatase, receptor type, J [So... [more]
Ptprj2.926e-3334.65protein tyrosine phosphatase, receptor type, J [So... [more]
Ptprj4.189e-3334.65protein tyrosine phosphatase, receptor type, J [So... [more]
Ptprf2.654e-3233.45protein tyrosine phosphatase, receptor type, F [So... [more]
Ptprc2.845e-3232.63protein tyrosine phosphatase, receptor type, C [So... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9W6V5|PTPRJ_CHICK1.324e-3332.60Receptor-type tyrosine-protein phosphatase eta OS=... [more]
sp|F1NWE3|PTPRS_CHICK4.707e-3331.03Receptor-type tyrosine-protein phosphatase S OS=Ga... [more]
sp|Q64455|PTPRJ_MOUSE1.923e-3234.65Receptor-type tyrosine-protein phosphatase eta OS=... [more]
sp|P04157|PTPRC_RAT3.653e-3233.47Receptor-type tyrosine-protein phosphatase C OS=Ra... [more]
sp|Q12913|PTPRJ_HUMAN4.017e-3235.51Receptor-type tyrosine-protein phosphatase eta OS=... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DB452.715e-4234.16Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8IFK81.006e-4133.58Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HPY01.996e-4133.58Uncharacterized protein OS=Macrostomum lignano OX=... [more]
H2XQT48.232e-4138.87Uncharacterized protein OS=Ciona intestinalis OX=7... [more]
A0A267G4Z61.348e-4034.16Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000013855.21.768e-3332.07pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000031392.11.817e-3332.07pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ptprt1.145e-3237.30protein tyrosine phosphatase receptor type T [Sour... [more]
ptprfb2.868e-3232.27protein tyrosine phosphatase receptor type Fb [Sou... [more]
ENSAMXT00000012844.23.058e-3233.87receptor-type tyrosine-protein phosphatase S-like ... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008162.19.913e-3434.47pep scaffold:Pmarinus_7.0:GL477877:143952:159832:-... [more]
ENSPMAT00000003525.13.818e-3233.58pep scaffold:Pmarinus_7.0:GL477320:686:22463:-1 ge... [more]
ptpra1.963e-3132.00protein tyrosine phosphatase receptor type A [Sour... [more]
ptprk1.323e-2936.60protein tyrosine phosphatase receptor type K [Sour... [more]
ENSPMAT00000000174.11.851e-2932.47pep scaffold:Pmarinus_7.0:GL479793:24808:47889:1 g... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PTP11.675e-2030.15Phosphotyrosine-specific protein phosphatase; deph... [more]
PTP21.703e-1624.71Nuclear phosphotyrosine-specific phosphatase invol... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO481875.227e-3936.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383041.289e-3535.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478939.384e-3432.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489491.297e-3333.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309822.167e-3334.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprfa1.520e-3535.64protein tyrosine phosphatase receptor type F [Sour... [more]
PTPRB3.405e-3530.70protein tyrosine phosphatase receptor type B [Sour... [more]
PTPRB3.479e-3530.70protein tyrosine phosphatase receptor type B [Sour... [more]
PTPRB3.495e-3530.70protein tyrosine phosphatase receptor type B [Sour... [more]
ptpra4.968e-3333.88protein tyrosine phosphatase receptor type A [Sour... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067957.10.000e+090.50SMESG000067957.1[more]
SMESG000049236.13.162e-172100.00SMESG000049236.1[more]
SMESG000049225.11.559e-17166.27SMESG000049225.1[more]
SMESG000068005.11.268e-17099.21SMESG000068005.1[more]
SMESG000067946.15.383e-15866.67SMESG000067946.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004027 ID=SMED30004027|Name=Receptor-type tyrosine-protein phosphatase eta|organism=Schmidtea mediterranea sexual|type=transcript|length=3530bp
AAAACTTCGTAACTTTAAAAAATGTTTTTACAACATACATTTTAAATGTA
AATTTCAATTTTATTACTATACTTGTATTTATTAAATCAGCAGTTCTTAA
TATTATCACCTATCAATTAGAATATGACCATAAGAAGGCCAAAAGCCTCA
GTTGTTATTGATGCATACGAAACTATAACAGATTCTTCAATTCGAAAGTG
GAAAGTATCTGAAGTAACCACTCCAGTTTTAACTGAAAGATTTGCATTAA
AAATTTTATCTGAAAATTCAAATAATAAATCCTATGGAAGTCTAAATGAA
ACATTTGAAAAAAATATACATTTAAATTTTCAAAATAGTTTTACATCAAG
TTTTATTGAATCTCATAGCAAGAATATGTCAATTTCAGCAATCCCAATTT
TCAAAATCATGAGTCCAATAAAGTGTGAACCAGTAACAGAGAAAAGAATT
ATCCATGTAATCAATGAATCAGCTAATGAAGACACCCAAGAAGCAATTGC
TTTAACATCTGATCATGTAAAATCGTCGTTGGAATCTCAAATTACGGAGG
AAAACATTAATGTTATAAATGAAACCCAGGAATTTAATTCACTAATTCAA
AGCTCGGGAATACCCCAAATCATACCAGAGGAAAAGTCGATGGAAATTTT
GGAAGATATTGATTATGCTCAGTTGTCAAGCAGTGACGATGGTGACAGCG
AATTACCAAAAATAGAAAACTTAAAAATAGGACGCCAAACTAAATTAACA
GAAAAAGAGAATATATCCAAACAATGCTATCAAGTTAATAGATTTCGCTT
ACATGTTGATATTGATGCTACTCAAATTTCCGAATCCCCTGAAATCATAA
TACCAAAGCGCCTGTTAAAAAATCTCAGATTTTGAAACGCCCCAGTCCAA
GTATTGTTGATGCGGACCAAACAATGTAAATAAATCGTTTTGCAAAAAAA
TGTAAATTTAATGAAAGATTAATTACACAAGAATTCATAAGTCGACAGGA
GGAACAAAATGCAAATTCTGCATTCAATTGAATGAACACGTGAAAAGTCA
ATTTTACTTTCTCATTCTAGAAATCAGATTTGTGCGCTAATATCAACATC
TAATTTGCCACGCAATCACTCATCCGTTTGCTATAAACACATTCCGCATG
CTATGAAAATGTCAGTAAATACAAATATTCATAAATCTGTCTTACTTGTA
TGTATTTTCTACTTTTATGTTTTCTGTTCAATCCGGCCTCCCCTAATAAA
GATAATTTGATCGACTTTGGTGGCTTAGATTACTTCAGCAGTGAAGACTT
CATGAGTGCAAAGATAATATTCATATCAAAGGAATCCAGAATACAACTGA
AGGTATTCTCCTCAACTGATAAATGGGGAGAATGCACAGGGAAAGATACA
GTCAGATGCAATATAGGCCAATCAGTGCAGTTTGACCTGGAAGTGACAAA
GGGAACCTCGAAAGTTGCGATACCATTTACTGTATTTTGCACCACCGATA
ACAAGTTTAAAAATGCGAATGCCATTCAAAACTTGGAAGTGACTCATGAT
AACAAAAGAATTTATTCTGGGTGGCTACAAAATAAAACCGGAAATTTCTC
CCATTATTTCGTGATTTGCATGAGCAGCGCAAGGGACATTCAAATGATTA
ATATGACAGACAACGTATTAATATTGACCGGCCTCAAGGACCAAATCTGG
TATCAAGTTTGTGTAGCAATCGTGGACAATCAAAATAGAAAAGGCATGTT
CAATTGTTCAAAAGTTTTATTTGATCAAAAGAAATTCAATCGGAATGCAA
TGTACAATTCCTACACAAACCTTGCAACCTCTAATAAAATGGAAGCATTC
AGCCGTGAAGACATTCTCAAACAAAAAAGTAGCGACAAAATAATAGTGGA
CCTCAATTCTTTCAATGTCAATGTCACAGTAGTTGCTAACGGAGAAAGAT
TAAATATTTCATGGGAAATAAATGATGGAATGCAGGGAACCATATTTGCA
TATATTTTGCTATTAAAAACCGGATCAAATGTCTGTGAAAATGCCATTTA
TTTTGTCTGCTCCAACTGTAAGGCGCCATTAAATTCGAAATATTTGAGCC
AAAATGATATACAAAAACTAAAAAGTTTGCGAAAATGTGGAATCGAAAGT
GAAGAATATTTTGATATTGCCAAGATTAGTTTCAGTGTCGAAAAGAAATT
TAATAGAAATTTATCTAATGCAATAACCACATTTTACGCCATCAATTTAC
AAGGGGTCCATCAAATCAGAATCAGAGAAATAGTAAATTATAAATTCATT
TTGATACCCTACTTGCCGATAGTTCTGTCAATTTCGATAATTTTATTCCT
GATTTACATGAAGAAAAGAAACTTGTCTTTCATTTGCAGATCAAAACGAA
AGTCTCCAAAGTGCCAAATGCCCACCCGAGTCCTGGACACTGATAGCTTG
GATAATACAGTTTTCACATTAAATCATGGAATGGATTCTTGGAGCCTCTA
CAGTGATAATTCAATGTATTTCAACACTCAAACATCAAAAAATGAGATAC
TCGAATCACCTGTAACATCTTCGGACATCAATGAGCAGTCTATTACAACT
AATAAAAGAAAAATGGTAGAAACACTATCAGATCAATTTGAGAAATTAAT
GAAAGAATCTAAAGATCAAGAATCGCTTCTACACTTGACGACGTCCAAAG
GAGAGAATGCAAATAAGTTTAAAAAAAATAGATTTGTCAATATAATTCCT
TATGACCAAAACCGGGTGAAAGTCGGGGAGGAGGAATATCCAGGAAATTA
TATAAATGCTAGCTACATTCCGTATGACAATGACGCGAATAAATACGAAT
ATATCGCCACTCAAGGACCGACTGAAAACACTTTGAAGGAATTTTGGCAA
ATGATCTGGCAGGAAAATGTCAAATTCATTATCATGCTTACAAAGCTGGA
TAAAAATAATGTTCAGTATTGGCCTGATAAAACTGGGGATCATTTGTCTG
TTGAAGGTTTCTCCATTATATTATTAGACGACCTGCAACATGACGGCCAT
GTAGAAAGGAAAATGATTATATCAGACGAATGTGATTGTCGGAAGGAAAT
AACCCAATTCCACATGAATACTTGGCTAGATGAATGCGCCCCAAATATTG
AATATTTTAATAAATTTTTGTTTCGGTTCCATAAAGTGGCTTCAAATGCT
TCTAATCACCCCTACCTAGTTCACTGCAGTTCCGGAATCTGCCAAACCGG
AACTTTTATTTGTATTGACAGAATAACAAGGAAATTGTCGAAGGGAGAAA
AAATTGTCAATATTTTTGAGACCGTTTTGAATTTGCGCCGGTTTCGAAAG
ATGATGGTGCAAAATCAAGTTCAATTTACATTCATTCACGAGTACATCCA
CCATTTCCTCAATAAGTACCTAACCTGTGGACAGAATCAAGAAGAAATGT
ATTTCAACGAAATCTAAGGGAAGTCGTAGATCTTACATTCTATTCAAACA
ATAATTTATTTTCAAGATATTTGATTGGTG
back to top

protein sequence of SMED30004027-orf-1

>SMED30004027-orf-1 ID=SMED30004027-orf-1|Name=SMED30004027-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=254bp
MTIRRPKASVVIDAYETITDSSIRKWKVSEVTTPVLTERFALKILSENSN
NKSYGSLNETFEKNIHLNFQNSFTSSFIESHSKNMSISAIPIFKIMSPIK
CEPVTEKRIIHVINESANEDTQEAIALTSDHVKSSLESQITEENINVINE
TQEFNSLIQSSGIPQIIPEEKSMEILEDIDYAQLSSSDDGDSELPKIENL
KIGRQTKLTEKENISKQCYQVNRFRLHVDIDATQISESPEIIIPKRLLKN
LRF*
back to top

protein sequence of SMED30004027-orf-2

>SMED30004027-orf-2 ID=SMED30004027-orf-2|Name=SMED30004027-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=756bp
MYFLLLCFLFNPASPNKDNLIDFGGLDYFSSEDFMSAKIIFISKESRIQL
KVFSSTDKWGECTGKDTVRCNIGQSVQFDLEVTKGTSKVAIPFTVFCTTD
NKFKNANAIQNLEVTHDNKRIYSGWLQNKTGNFSHYFVICMSSARDIQMI
NMTDNVLILTGLKDQIWYQVCVAIVDNQNRKGMFNCSKVLFDQKKFNRNA
MYNSYTNLATSNKMEAFSREDILKQKSSDKIIVDLNSFNVNVTVVANGER
LNISWEINDGMQGTIFAYILLLKTGSNVCENAIYFVCSNCKAPLNSKYLS
QNDIQKLKSLRKCGIESEEYFDIAKISFSVEKKFNRNLSNAITTFYAINL
QGVHQIRIREIVNYKFILIPYLPIVLSISIILFLIYMKKRNLSFICRSKR
KSPKCQMPTRVLDTDSLDNTVFTLNHGMDSWSLYSDNSMYFNTQTSKNEI
LESPVTSSDINEQSITTNKRKMVETLSDQFEKLMKESKDQESLLHLTTSK
GENANKFKKNRFVNIIPYDQNRVKVGEEEYPGNYINASYIPYDNDANKYE
YIATQGPTENTLKEFWQMIWQENVKFIIMLTKLDKNNVQYWPDKTGDHLS
VEGFSIILLDDLQHDGHVERKMIISDECDCRKEITQFHMNTWLDECAPNI
EYFNKFLFRFHKVASNASNHPYLVHCSSGICQTGTFICIDRITRKLSKGE
KIVNIFETVLNLRRFRKMMVQNQVQFTFIHEYIHHFLNKYLTCGQNQEEM
YFNEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000242PTPase_domain
IPR003595Tyr_Pase_cat
IPR029021Prot-tyrosine_phosphatase-like
IPR000387TYR_PHOSPHATASE_dom
Vocabulary: molecular function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
GO:0016791phosphatase activity
GO:0004721phosphoprotein phosphatase activity
GO:0005001transmembrane receptor protein tyrosine phosphatase activity
GO:0005515protein binding
GO:0016787hydrolase activity
GO:0019887protein kinase regulator activity
GO:0019901protein kinase binding
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0001915negative regulation of T cell mediated cytotoxicity
GO:0001960negative regulation of cytokine-mediated signaling pathway
GO:0006469negative regulation of protein kinase activity
GO:0010332response to gamma radiation
GO:0030217T cell differentiation
GO:0035335peptidyl-tyrosine dephosphorylation
GO:0042100B cell proliferation
GO:0042102positive regulation of T cell proliferation
GO:0050852T cell receptor signaling pathway
GO:0050853B cell receptor signaling pathway
GO:0050857positive regulation of antigen receptor-mediated signaling pathway
GO:0051209release of sequestered calcium ion into cytosol
GO:0051607defense response to virus
GO:0051726regulation of cell cycle
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0005925focal adhesion
GO:0009898cytoplasmic side of plasma membrane
GO:0009986cell surface
GO:0016020membrane
GO:0016021integral component of membrane
GO:0045121membrane raft
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 473..493
NoneNo IPR availablePANTHERPTHR19134:SF483PROTEIN TYROSINE PHOSPHATASE 4E, ISOFORM A-RELATEDcoord: 211..737
NoneNo IPR availablePANTHERPTHR19134PROTEIN-TYROSINE PHOSPHATASEcoord: 211..737
NoneNo IPR availableCDDcd00047PTPccoord: 534..731
e-value: 5.151E-59
score: 196.737
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..15
score: 0.523
NoneNo IPR availableTMHMMTMhelixcoord: 367..386
IPR000242PTP type protein phosphatasePRINTSPR00700PRTYPHPHTASEcoord: 632..649
score: 28.99
coord: 533..540
score: 68.01
coord: 719..729
score: 44.28
coord: 551..571
score: 56.55
coord: 671..689
score: 54.46
coord: 703..718
score: 30.48
IPR000242PTP type protein phosphataseSMARTSM00194PTPc_3coord: 475..738
e-value: 2.8E-66
score: 236.2
IPR000242PTP type protein phosphatasePFAMPF00102Y_phosphatasecoord: 507..733
e-value: 4.2E-59
score: 200.0
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 476..736
score: 39.701
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 633..735
e-value: 9.2E-19
score: 78.3
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 449..742
e-value: 1.7E-73
score: 249.6
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 462..742
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 651..727
score: 14.981