Eukaryotic translation initiation factor 5A

Overview
NameEukaryotic translation initiation factor 5A
Smed IDSMED30004020
Length (bp)1580
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Eukaryotic translation initiation factor 5A (SMED30004020) t-SNE clustered cells

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 5A (SMED30004020) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Eukaryotic translation initiation factor 5A (SMED30004020) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 5A (SMED30004020) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004020

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30004020h1SMcG0022532 Contig37486uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004020h1SMcG0022532 Contig37486newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004020h1SMcG0022532 Contig43778uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004020h1SMcG0022532 Contig43778newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30004020h1SMcG0022532 dd_Smed_v4_966_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004020h1SMcG0022532 dd_Smed_v4_966_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004020h1SMcG0022532 dd_Smed_v4_966_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004020h1SMcG0022532 dd_Smed_v4_966_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004020h1SMcG0022532 dd_Smed_v4_966_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Human
Match: EIF5A (eukaryotic translation initiation factor 5A [Source:HGNC Symbol;Acc:HGNC:3300])

HSP 1 Score: 179.104 bits (453), Expect = 1.961e-53
Identity = 85/148 (57.43%), Postives = 107/148 (72.30%), Query Frame = 1
Query:   82 FENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            FE  D+GAS T P Q SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+GKKYEDICPST N D P + R ++ LI I  D Y+SL+ D GE +ED++LPE +L  EI  K++ G+  L+T++SA  EE  V  K + 
Sbjct:    7 FETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQ-DGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMA 153          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Human
Match: EIF5A (eukaryotic translation initiation factor 5A [Source:HGNC Symbol;Acc:HGNC:3300])

HSP 1 Score: 179.104 bits (453), Expect = 1.961e-53
Identity = 85/148 (57.43%), Postives = 107/148 (72.30%), Query Frame = 1
Query:   82 FENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            FE  D+GAS T P Q SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+GKKYEDICPST N D P + R ++ LI I  D Y+SL+ D GE +ED++LPE +L  EI  K++ G+  L+T++SA  EE  V  K + 
Sbjct:    7 FETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQ-DGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMA 153          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Human
Match: EIF5A (eukaryotic translation initiation factor 5A [Source:HGNC Symbol;Acc:HGNC:3300])

HSP 1 Score: 179.104 bits (453), Expect = 1.961e-53
Identity = 85/148 (57.43%), Postives = 107/148 (72.30%), Query Frame = 1
Query:   82 FENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            FE  D+GAS T P Q SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+GKKYEDICPST N D P + R ++ LI I  D Y+SL+ D GE +ED++LPE +L  EI  K++ G+  L+T++SA  EE  V  K + 
Sbjct:    7 FETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQ-DGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMA 153          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Human
Match: EIF5A (eukaryotic translation initiation factor 5A [Source:HGNC Symbol;Acc:HGNC:3300])

HSP 1 Score: 179.104 bits (453), Expect = 1.961e-53
Identity = 85/148 (57.43%), Postives = 107/148 (72.30%), Query Frame = 1
Query:   82 FENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            FE  D+GAS T P Q SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+GKKYEDICPST N D P + R ++ LI I  D Y+SL+ D GE +ED++LPE +L  EI  K++ G+  L+T++SA  EE  V  K + 
Sbjct:    7 FETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQ-DGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMA 153          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Human
Match: EIF5A (eukaryotic translation initiation factor 5A [Source:HGNC Symbol;Acc:HGNC:3300])

HSP 1 Score: 179.104 bits (453), Expect = 1.961e-53
Identity = 85/148 (57.43%), Postives = 107/148 (72.30%), Query Frame = 1
Query:   82 FENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            FE  D+GAS T P Q SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+GKKYEDICPST N D P + R ++ LI I  D Y+SL+ D GE +ED++LPE +L  EI  K++ G+  L+T++SA  EE  V  K + 
Sbjct:    7 FETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQ-DGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMA 153          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Celegans
Match: iff-1 (Eukaryotic translation initiation factor 5A-1 [Source:UniProtKB/Swiss-Prot;Acc:P34563])

HSP 1 Score: 171.4 bits (433), Expect = 9.295e-51
Identity = 86/153 (56.21%), Postives = 114/153 (74.51%), Query Frame = 1
Query:   73 EDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKG-ETKEDVKLPENELADEIRAKFESGD-NCLVTIMSACGEEQIVGCKVLT 525
            E+ F++A+SGA+ T P+Q SA RKN+H+MI+ RPCKIVEMSTSKTGKHG AKVH+V IDIF+ KK EDICPST N D P+V R EY L+ I  D + SLM+ +  E K+D+K+PE +L + IR   E  + + LV +++ACGEE I+G K+ T
Sbjct:    8 EEQFDSAESGAAATFPKQCSALRKNEHVMIRGRPCKIVEMSTSKTGKHGHAKVHMVAIDIFTTKKLEDICPSTHNMDVPVVKRREYILMSIE-DGFCSLMDPESCELKDDLKMPEGDLGNTIREALEKDEGSVLVQVVAACGEEAILGYKIST 159          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Celegans
Match: iff-1 (Eukaryotic translation initiation factor 5A-1 [Source:UniProtKB/Swiss-Prot;Acc:P34563])

HSP 1 Score: 171.4 bits (433), Expect = 9.295e-51
Identity = 86/153 (56.21%), Postives = 114/153 (74.51%), Query Frame = 1
Query:   73 EDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKG-ETKEDVKLPENELADEIRAKFESGD-NCLVTIMSACGEEQIVGCKVLT 525
            E+ F++A+SGA+ T P+Q SA RKN+H+MI+ RPCKIVEMSTSKTGKHG AKVH+V IDIF+ KK EDICPST N D P+V R EY L+ I  D + SLM+ +  E K+D+K+PE +L + IR   E  + + LV +++ACGEE I+G K+ T
Sbjct:    8 EEQFDSAESGAAATFPKQCSALRKNEHVMIRGRPCKIVEMSTSKTGKHGHAKVHMVAIDIFTTKKLEDICPSTHNMDVPVVKRREYILMSIE-DGFCSLMDPESCELKDDLKMPEGDLGNTIREALEKDEGSVLVQVVAACGEEAILGYKIST 159          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Celegans
Match: iff-1 (Eukaryotic translation initiation factor 5A-1 [Source:UniProtKB/Swiss-Prot;Acc:P34563])

HSP 1 Score: 171.785 bits (434), Expect = 1.746e-50
Identity = 86/153 (56.21%), Postives = 114/153 (74.51%), Query Frame = 1
Query:   73 EDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKG-ETKEDVKLPENELADEIRAKFESGD-NCLVTIMSACGEEQIVGCKVLT 525
            E+ F++A+SGA+ T P+Q SA RKN+H+MI+ RPCKIVEMSTSKTGKHG AKVH+V IDIF+ KK EDICPST N D P+V R EY L+ I  D + SLM+ +  E K+D+K+PE +L + IR   E  + + LV +++ACGEE I+G K+ T
Sbjct:   42 EEQFDSAESGAAATFPKQCSALRKNEHVMIRGRPCKIVEMSTSKTGKHGHAKVHMVAIDIFTTKKLEDICPSTHNMDVPVVKRREYILMSIE-DGFCSLMDPESCELKDDLKMPEGDLGNTIREALEKDEGSVLVQVVAACGEEAILGYKIST 193          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Celegans
Match: iff-2 (Eukaryotic translation initiation factor 5A-2 [Source:UniProtKB/Swiss-Prot;Acc:Q20751])

HSP 1 Score: 169.088 bits (427), Expect = 7.423e-50
Identity = 88/148 (59.46%), Postives = 108/148 (72.97%), Query Frame = 1
Query:   88 NADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKG-ETKEDVKLPENELADEIRAKFESGD-NCLVTIMSACGEEQIVGCKVLT 525
              DSGA+ T P+Q SA RKN+H+MIK RPCKIVEMSTSKTGKHG AKVH+V IDIF+ KK EDICPST N D P+V R EY L+ I  D Y SLM+ +  E K+D+KLP+ EL  +IR  +E  + + LV ++SA GEE I+G KV T
Sbjct:   13 TGDSGAAATFPKQCSALRKNEHVMIKGRPCKIVEMSTSKTGKHGHAKVHMVAIDIFTSKKLEDICPSTHNMDVPVVKRREYLLMAID-DGYCSLMDPESCEQKDDLKLPDTELGQQIRDAYEKDEGSVLVQVVSAIGEEAILGWKVST 159          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Celegans
Match: iff-2 (Eukaryotic translation initiation factor 5A-2 [Source:UniProtKB/Swiss-Prot;Acc:Q20751])

HSP 1 Score: 169.088 bits (427), Expect = 7.423e-50
Identity = 88/148 (59.46%), Postives = 108/148 (72.97%), Query Frame = 1
Query:   88 NADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKG-ETKEDVKLPENELADEIRAKFESGD-NCLVTIMSACGEEQIVGCKVLT 525
              DSGA+ T P+Q SA RKN+H+MIK RPCKIVEMSTSKTGKHG AKVH+V IDIF+ KK EDICPST N D P+V R EY L+ I  D Y SLM+ +  E K+D+KLP+ EL  +IR  +E  + + LV ++SA GEE I+G KV T
Sbjct:   13 TGDSGAAATFPKQCSALRKNEHVMIKGRPCKIVEMSTSKTGKHGHAKVHMVAIDIFTSKKLEDICPSTHNMDVPVVKRREYLLMAID-DGYCSLMDPESCEQKDDLKLPDTELGQQIRDAYEKDEGSVLVQVVSAIGEEAILGWKVST 159          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Fly
Match: eEF5 (gene:FBgn0285952 transcript:FBtr0072172)

HSP 1 Score: 192.2 bits (487), Expect = 1.320e-58
Identity = 90/155 (58.06%), Postives = 116/155 (74.84%), Query Frame = 1
Query:   61 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            M++++D FE  DSGAS T P Q SA RKN  +M+K RPCKIVEMSTSKTGKHG AKVH+VGIDIFS KKYEDICPST N D P V R +  LI IS D++++LM + G+ +ED+K+PE EL +++R  F+SG + L T++ ACGEE ++  K  T
Sbjct:    1 MAELDDQFETTDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTGKHGHAKVHMVGIDIFSNKKYEDICPSTHNMDVPNVKREDLQLIAISDDSFLTLMTESGDLREDLKVPEGELGEQLRLDFDSGKDLLCTVLKACGEECVIAIKTNT 155          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Fly
Match: eEF5 (gene:FBgn0285952 transcript:FBtr0072173)

HSP 1 Score: 192.2 bits (487), Expect = 1.320e-58
Identity = 90/155 (58.06%), Postives = 116/155 (74.84%), Query Frame = 1
Query:   61 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            M++++D FE  DSGAS T P Q SA RKN  +M+K RPCKIVEMSTSKTGKHG AKVH+VGIDIFS KKYEDICPST N D P V R +  LI IS D++++LM + G+ +ED+K+PE EL +++R  F+SG + L T++ ACGEE ++  K  T
Sbjct:    1 MAELDDQFETTDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTGKHGHAKVHMVGIDIFSNKKYEDICPSTHNMDVPNVKREDLQLIAISDDSFLTLMTESGDLREDLKVPEGELGEQLRLDFDSGKDLLCTVLKACGEECVIAIKTNT 155          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Fly
Match: Cdlc2 (gene:FBgn0026141 transcript:FBtr0077924)

HSP 1 Score: 47.3654 bits (111), Expect = 1.098e-6
Identity = 25/82 (30.49%), Postives = 47/82 (57.32%), Query Frame = -1
Query:  657 IFSSDMSNGDQAHIIEICRDLLLEYDDQSDIAEELKNKLDEEFGKHWHVIVGIGRYGSNISNEESCLLHFKLSRFAFLIWKT 902
            I ++DMS   Q   ++     L +Y+ + DIA  +K + D+++   WH IVG   +GS +++E    ++F L + A L++K+
Sbjct:    8 IKNADMSEEMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKYNPTWHCIVG-RNFGSYVTHETRHFIYFYLGQVAILLFKS 88          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Fly
Match: Cdlc2 (gene:FBgn0026141 transcript:FBtr0305553)

HSP 1 Score: 47.3654 bits (111), Expect = 1.098e-6
Identity = 25/82 (30.49%), Postives = 47/82 (57.32%), Query Frame = -1
Query:  657 IFSSDMSNGDQAHIIEICRDLLLEYDDQSDIAEELKNKLDEEFGKHWHVIVGIGRYGSNISNEESCLLHFKLSRFAFLIWKT 902
            I ++DMS   Q   ++     L +Y+ + DIA  +K + D+++   WH IVG   +GS +++E    ++F L + A L++K+
Sbjct:    8 IKNADMSEEMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKYNPTWHCIVG-RNFGSYVTHETRHFIYFYLGQVAILLFKS 88          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Fly
Match: Cdlc2 (gene:FBgn0026141 transcript:FBtr0077925)

HSP 1 Score: 47.3654 bits (111), Expect = 1.098e-6
Identity = 25/82 (30.49%), Postives = 47/82 (57.32%), Query Frame = -1
Query:  657 IFSSDMSNGDQAHIIEICRDLLLEYDDQSDIAEELKNKLDEEFGKHWHVIVGIGRYGSNISNEESCLLHFKLSRFAFLIWKT 902
            I ++DMS   Q   ++     L +Y+ + DIA  +K + D+++   WH IVG   +GS +++E    ++F L + A L++K+
Sbjct:    8 IKNADMSEEMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKYNPTWHCIVG-RNFGSYVTHETRHFIYFYLGQVAILLFKS 88          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Zebrafish
Match: eif5a2 (eukaryotic translation initiation factor 5A2 [Source:ZFIN;Acc:ZDB-GENE-040426-2405])

HSP 1 Score: 183.341 bits (464), Expect = 4.042e-55
Identity = 88/156 (56.41%), Postives = 116/156 (74.36%), Query Frame = 1
Query:   61 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLTN 528
            M+D++  F + D+GAS T P Q SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+GKK EDICPST N D P + R +Y L+ I  D Y+SLM D G+ ++D+KLPE +L  EI +KFESGD  LV++++A GEE  +  K +++
Sbjct:    1 MADLDTDFTSGDAGASLTFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHMVGIDIFTGKKNEDICPSTHNMDVPNIKRQDYQLVGI-IDGYLSLMKDNGDLRDDLKLPEGDLGKEIESKFESGDEFLVSVLAAMGEECPIAIKPMSS 155          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Zebrafish
Match: eif5a2 (eukaryotic translation initiation factor 5A2 [Source:ZFIN;Acc:ZDB-GENE-040426-2405])

HSP 1 Score: 183.341 bits (464), Expect = 4.042e-55
Identity = 88/156 (56.41%), Postives = 116/156 (74.36%), Query Frame = 1
Query:   61 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLTN 528
            M+D++  F + D+GAS T P Q SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+GKK EDICPST N D P + R +Y L+ I  D Y+SLM D G+ ++D+KLPE +L  EI +KFESGD  LV++++A GEE  +  K +++
Sbjct:    1 MADLDTDFTSGDAGASLTFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHMVGIDIFTGKKNEDICPSTHNMDVPNIKRQDYQLVGI-IDGYLSLMKDNGDLRDDLKLPEGDLGKEIESKFESGDEFLVSVLAAMGEECPIAIKPMSS 155          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Zebrafish
Match: eif5a2 (eukaryotic translation initiation factor 5A2 [Source:ZFIN;Acc:ZDB-GENE-040426-2405])

HSP 1 Score: 183.341 bits (464), Expect = 4.042e-55
Identity = 88/156 (56.41%), Postives = 116/156 (74.36%), Query Frame = 1
Query:   61 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLTN 528
            M+D++  F + D+GAS T P Q SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+GKK EDICPST N D P + R +Y L+ I  D Y+SLM D G+ ++D+KLPE +L  EI +KFESGD  LV++++A GEE  +  K +++
Sbjct:    1 MADLDTDFTSGDAGASLTFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHMVGIDIFTGKKNEDICPSTHNMDVPNIKRQDYQLVGI-IDGYLSLMKDNGDLRDDLKLPEGDLGKEIESKFESGDEFLVSVLAAMGEECPIAIKPMSS 155          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Zebrafish
Match: eif5a2 (eukaryotic translation initiation factor 5A2 [Source:ZFIN;Acc:ZDB-GENE-040426-2405])

HSP 1 Score: 183.341 bits (464), Expect = 4.042e-55
Identity = 88/156 (56.41%), Postives = 116/156 (74.36%), Query Frame = 1
Query:   61 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLTN 528
            M+D++  F + D+GAS T P Q SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+GKK EDICPST N D P + R +Y L+ I  D Y+SLM D G+ ++D+KLPE +L  EI +KFESGD  LV++++A GEE  +  K +++
Sbjct:    1 MADLDTDFTSGDAGASLTFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHMVGIDIFTGKKNEDICPSTHNMDVPNIKRQDYQLVGI-IDGYLSLMKDNGDLRDDLKLPEGDLGKEIESKFESGDEFLVSVLAAMGEECPIAIKPMSS 155          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Zebrafish
Match: eif5a (eukaryotic translation initiation factor 5A [Source:ZFIN;Acc:ZDB-GENE-040426-2229])

HSP 1 Score: 181.03 bits (458), Expect = 2.357e-54
Identity = 87/155 (56.13%), Postives = 114/155 (73.55%), Query Frame = 1
Query:   61 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            M+D +  F + D+GAS T P Q SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+ KKYEDICPST N D P + R +Y L+DIS + ++SLM D G+ +ED+++P+ +L  EI  KF +G+  LVT++SA GEE  V  K +T
Sbjct:    1 MADPDLDFASGDAGASATYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTNKKYEDICPSTHNMDVPNIKRNDYQLVDIS-EGFLSLMMDNGDVREDLRVPDGDLGKEIENKFAAGEEMLVTVLSAMGEESAVALKPMT 154          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Xenopus
Match: ddo (D-aspartate oxidase [Source:Xenbase;Acc:XB-GENE-6258233])

HSP 1 Score: 179.489 bits (454), Expect = 1.455e-53
Identity = 86/148 (58.11%), Postives = 110/148 (74.32%), Query Frame = 1
Query:   82 FENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            F + D+GAS T P Q SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+GKKYEDICPST N D P + R +Y LI I+ DNY+SL++D G+ +ED+K+PE +L  EI  K + G+  LVT+++A  EE  V  K +T
Sbjct:    7 FTSGDAGASSTFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRCDYQLIGIN-DNYLSLLSDSGDVREDLKMPEGDLGREILMKHDGGEEILVTVLTAMNEECAVALKAMT 153          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Xenopus
Match: ddo (D-aspartate oxidase [Source:Xenbase;Acc:XB-GENE-6258233])

HSP 1 Score: 169.088 bits (427), Expect = 1.539e-49
Identity = 79/133 (59.40%), Postives = 101/133 (75.94%), Query Frame = 1
Query:   82 FENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIM 480
            F + D+GAS T P Q SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+GKKYEDICPST N D P + R +Y LI I+ DNY+SL++D G+ +ED+K+PE +L  EI  K + G+  LV ++
Sbjct:    7 FTSGDAGASSTFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRCDYQLIGIN-DNYLSLLSDSGDVREDLKMPEGDLGREILMKHDGGEEILVNLL 138          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Xenopus
Match: dynll2 (dynein light chain LC8-type 2 [Source:NCBI gene;Acc:100038056])

HSP 1 Score: 46.595 bits (109), Expect = 4.452e-6
Identity = 24/82 (29.27%), Postives = 47/82 (57.32%), Query Frame = -1
Query:  657 IFSSDMSNGDQAHIIEICRDLLLEYDDQSDIAEELKNKLDEEFGKHWHVIVGIGRYGSNISNEESCLLHFKLSRFAFLIWKT 902
            I ++DMS   Q   ++     + +Y+ + DIA  +K + D+++   WH IVG   +GS +++E    ++F L + A L++K+
Sbjct:    8 IKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVG-RNFGSYVTHETKHFIYFYLGQVAILLFKS 88          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Xenopus
Match: dynll1 (dynein light chain LC8-type 1 [Source:NCBI gene;Acc:448652])

HSP 1 Score: 45.8246 bits (107), Expect = 6.843e-6
Identity = 24/82 (29.27%), Postives = 47/82 (57.32%), Query Frame = -1
Query:  657 IFSSDMSNGDQAHIIEICRDLLLEYDDQSDIAEELKNKLDEEFGKHWHVIVGIGRYGSNISNEESCLLHFKLSRFAFLIWKT 902
            I ++DMS   Q   ++     L +++ + DIA  +K + D+++   WH IVG   +GS +++E    ++F L + A L++K+
Sbjct:    8 IKNADMSEEMQQDAVDCATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVG-RNFGSYVTHETKHFIYFYLGQVAILLFKS 88          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Mouse
Match: Eif5a (eukaryotic translation initiation factor 5A [Source:MGI Symbol;Acc:MGI:106248])

HSP 1 Score: 179.104 bits (453), Expect = 1.346e-53
Identity = 85/148 (57.43%), Postives = 107/148 (72.30%), Query Frame = 1
Query:   82 FENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            FE  D+GAS T P Q SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+GKKYEDICPST N D P + R ++ LI I  D Y+SL+ D GE +ED++LPE +L  EI  K++ G+  L+T++SA  EE  V  K + 
Sbjct:    7 FETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQ-DGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMA 153          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Mouse
Match: Eif5a (eukaryotic translation initiation factor 5A [Source:MGI Symbol;Acc:MGI:106248])

HSP 1 Score: 179.104 bits (453), Expect = 1.346e-53
Identity = 85/148 (57.43%), Postives = 107/148 (72.30%), Query Frame = 1
Query:   82 FENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            FE  D+GAS T P Q SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+GKKYEDICPST N D P + R ++ LI I  D Y+SL+ D GE +ED++LPE +L  EI  K++ G+  L+T++SA  EE  V  K + 
Sbjct:    7 FETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQ-DGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMA 153          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Mouse
Match: Eif5a (eukaryotic translation initiation factor 5A [Source:MGI Symbol;Acc:MGI:106248])

HSP 1 Score: 179.104 bits (453), Expect = 1.346e-53
Identity = 85/148 (57.43%), Postives = 107/148 (72.30%), Query Frame = 1
Query:   82 FENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            FE  D+GAS T P Q SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+GKKYEDICPST N D P + R ++ LI I  D Y+SL+ D GE +ED++LPE +L  EI  K++ G+  L+T++SA  EE  V  K + 
Sbjct:    7 FETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQ-DGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMA 153          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Mouse
Match: Eif5a (eukaryotic translation initiation factor 5A [Source:MGI Symbol;Acc:MGI:106248])

HSP 1 Score: 179.104 bits (453), Expect = 1.346e-53
Identity = 85/148 (57.43%), Postives = 107/148 (72.30%), Query Frame = 1
Query:   82 FENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            FE  D+GAS T P Q SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+GKKYEDICPST N D P + R ++ LI I  D Y+SL+ D GE +ED++LPE +L  EI  K++ G+  L+T++SA  EE  V  K + 
Sbjct:    7 FETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQ-DGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMA 153          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Mouse
Match: Eif5a (eukaryotic translation initiation factor 5A [Source:MGI Symbol;Acc:MGI:106248])

HSP 1 Score: 179.104 bits (453), Expect = 1.346e-53
Identity = 85/148 (57.43%), Postives = 107/148 (72.30%), Query Frame = 1
Query:   82 FENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            FE  D+GAS T P Q SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+GKKYEDICPST N D P + R ++ LI I  D Y+SL+ D GE +ED++LPE +L  EI  K++ G+  L+T++SA  EE  V  K + 
Sbjct:    7 FETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQ-DGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMA 153          
BLAST of Eukaryotic translation initiation factor 5A vs. UniProt/SwissProt
Match: sp|P62925|IF5A_SPOFR (Eukaryotic translation initiation factor 5A OS=Spodoptera frugiperda OX=7108 GN=eIF-5A PE=1 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 1.016e-59
Identity = 94/156 (60.26%), Postives = 117/156 (75.00%), Query Frame = 1
Query:   61 MSDIEDT-FENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            M+DIEDT FE  DSGAS T P Q SA RKN  +M+K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+GKKYEDICPST N D P V R +Y L DIS D Y++LM D G+ +ED+K+P+ +L  ++R+ F+SG   L T++ +CGEE ++  K  T
Sbjct:    1 MADIEDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFNGKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLRSDFDSGKELLCTVLKSCGEECVIAVKANT 156          
BLAST of Eukaryotic translation initiation factor 5A vs. UniProt/SwissProt
Match: sp|P62924|IF5A_SPOEX (Eukaryotic translation initiation factor 5A OS=Spodoptera exigua OX=7107 GN=eIF-5A PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 1.016e-59
Identity = 94/156 (60.26%), Postives = 117/156 (75.00%), Query Frame = 1
Query:   61 MSDIEDT-FENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            M+DIEDT FE  DSGAS T P Q SA RKN  +M+K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+GKKYEDICPST N D P V R +Y L DIS D Y++LM D G+ +ED+K+P+ +L  ++R+ F+SG   L T++ +CGEE ++  K  T
Sbjct:    1 MADIEDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFNGKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLRSDFDSGKELLCTVLKSCGEECVIAVKANT 156          
BLAST of Eukaryotic translation initiation factor 5A vs. UniProt/SwissProt
Match: sp|Q9GU68|IF5A_DROME (Eukaryotic translation initiation factor 5A OS=Drosophila melanogaster OX=7227 GN=eEF5 PE=2 SV=2)

HSP 1 Score: 192.2 bits (487), Expect = 1.323e-57
Identity = 90/155 (58.06%), Postives = 116/155 (74.84%), Query Frame = 1
Query:   61 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            M++++D FE  DSGAS T P Q SA RKN  +M+K RPCKIVEMSTSKTGKHG AKVH+VGIDIFS KKYEDICPST N D P V R +  LI IS D++++LM + G+ +ED+K+PE EL +++R  F+SG + L T++ ACGEE ++  K  T
Sbjct:    1 MAELDDQFETTDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTGKHGHAKVHMVGIDIFSNKKYEDICPSTHNMDVPNVKREDLQLIAISDDSFLTLMTESGDLREDLKVPEGELGEQLRLDFDSGKDLLCTVLKACGEECVIAIKTNT 155          
BLAST of Eukaryotic translation initiation factor 5A vs. UniProt/SwissProt
Match: sp|P19211|IF5A2_YEAST (Eukaryotic translation initiation factor 5A-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANB1 PE=1 SV=3)

HSP 1 Score: 187.193 bits (474), Expect = 9.429e-56
Identity = 93/152 (61.18%), Postives = 112/152 (73.68%), Query Frame = 1
Query:   61 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCK 516
            MSD E TFENAD+GAS T P Q SA RKN  ++IK RPCKIV+MSTSKTGKHG AKVH+V +DIF+GKK ED+ PST N + P V R EY L+DI  D Y+SLM   GETK+DVK PE EL D ++A F+ G + +VTI+SA GEE  +  K
Sbjct:    1 MSDEEHTFENADAGASATYPMQCSALRKNGFVVIKGRPCKIVDMSTSKTGKHGHAKVHLVTLDIFTGKKLEDLSPSTHNLEVPFVKRSEYQLLDID-DGYLSLMTMDGETKDDVKAPEGELGDSMQAAFDEGKDLMVTIISAMGEEAAISFK 151          
BLAST of Eukaryotic translation initiation factor 5A vs. UniProt/SwissProt
Match: sp|P23301|IF5A1_YEAST (Eukaryotic translation initiation factor 5A-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HYP2 PE=1 SV=3)

HSP 1 Score: 183.341 bits (464), Expect = 3.086e-54
Identity = 90/152 (59.21%), Postives = 112/152 (73.68%), Query Frame = 1
Query:   61 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCK 516
            MSD E TFE AD+G+S T P Q SA RKN  ++IK RPCKIV+MSTSKTGKHG AKVH+V IDIF+GKK ED+ PST N + P+V R EY L+DI  D ++SLMN  G+TK+DVK PE EL D ++  F+ G + +VTI+SA GEE  +  K
Sbjct:    1 MSDEEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDID-DGFLSLMNMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFK 151          
BLAST of Eukaryotic translation initiation factor 5A vs. TrEMBL
Match: D5JG61 (Eukaryotic translation initiation factor 5A (Fragment) OS=Dugesia japonica OX=6161 GN=eIF5A PE=2 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 7.785e-90
Identity = 130/149 (87.25%), Postives = 141/149 (94.63%), Query Frame = 1
Query:   79 TFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            TFEN DSGAS TVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVH+V IDIFSGKKYEDICPSTANKDKP+VNR+EY LIDIS DN+ SL+NDKG+TKED+KLPENELADEIR KF +GD+C+VT+MSACGEEQIVGCKVLT
Sbjct:    2 TFENTDSGASSTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHIVAIDIFSGKKYEDICPSTANKDKPIVNRIEYQLIDISNDNFTSLLNDKGDTKEDIKLPENELADEIRTKFSNGDSCVVTVMSACGEEQIVGCKVLT 150          
BLAST of Eukaryotic translation initiation factor 5A vs. TrEMBL
Match: E9GL78 (Eukaryotic translation initiation factor 5A OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_231006 PE=3 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 2.440e-59
Identity = 96/156 (61.54%), Postives = 122/156 (78.21%), Query Frame = 1
Query:   61 MSDIEDT-FENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            M+++EDT FE+ DSGAS T P Q SA RKN  +M+K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+GKK EDICPST N D P+V R ++TLIDIS D ++S+MND G+ +ED+K+PE +L ++IRA FE+G   L T++ ACGEE ++  K  T
Sbjct:    1 MAELEDTQFESGDSGASATFPMQCSALRKNGFVMLKARPCKIVEMSTSKTGKHGHAKVHMVGIDIFNGKKLEDICPSTHNMDVPVVKREDFTLIDISGDGFLSMMNDNGDLREDLKVPEGDLGNQIRADFENGRELLCTVLKACGEECVIAVKANT 156          
BLAST of Eukaryotic translation initiation factor 5A vs. TrEMBL
Match: A0A194AMN0 (Eukaryotic translation initiation factor 5A OS=Pinctada fucata OX=50426 PE=3 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 5.695e-59
Identity = 98/153 (64.05%), Postives = 120/153 (78.43%), Query Frame = 1
Query:   67 DIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            D +D F+  DSGAS T PQQ SA RKN H+++K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+GKKYEDICPST N + P V+R EY L+DI  D ++SLM D GETK+D+KLP+N+L  EI+ KF+ GD+ +VT+ SA GEE  V CK +T
Sbjct:    4 DHDDDFQQTDSGASATYPQQCSALRKNGHVLLKGRPCKIVEMSTSKTGKHGHAKVHMVGIDIFTGKKYEDICPSTHNMEVPNVSRKEYQLVDID-DGFLSLMLDNGETKDDLKLPDNDLGTEIKKKFDDGDSIMVTVQSAMGEEVPVSCKNMT 155          
BLAST of Eukaryotic translation initiation factor 5A vs. TrEMBL
Match: A0A158NEM2 (Eukaryotic translation initiation factor 5A OS=Atta cephalotes OX=12957 GN=105619061 PE=3 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 1.004e-58
Identity = 96/153 (62.75%), Postives = 115/153 (75.16%), Query Frame = 1
Query:   61 MSDIEDT-FENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCK 516
            M+DIEDT FE  DSGAS T PQQ SA RKN  +M+K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+ KKYEDICPST N D P V R +Y L DIS D Y+ LM D GE +ED+K+P+ +L  ++RA +ESG   L T++ ACGEE ++  K
Sbjct:    1 MADIEDTHFETGDSGASVTYPQQCSALRKNGFVMLKSRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTSKKYEDICPSTHNMDVPFVKREDYQLTDISDDGYLCLMADNGELREDLKIPDGDLGTQLRADYESGKELLCTVLKACGEEVVIAVK 153          
BLAST of Eukaryotic translation initiation factor 5A vs. TrEMBL
Match: F4WRT8 (Eukaryotic translation initiation factor 5A OS=Acromyrmex echinatior OX=103372 GN=G5I_08542 PE=3 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 1.004e-58
Identity = 96/153 (62.75%), Postives = 115/153 (75.16%), Query Frame = 1
Query:   61 MSDIEDT-FENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCK 516
            M+DIEDT FE  DSGAS T PQQ SA RKN  +M+K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+ KKYEDICPST N D P V R +Y L DIS D Y+ LM D GE +ED+K+P+ +L  ++RA +ESG   L T++ ACGEE ++  K
Sbjct:    1 MADIEDTHFETGDSGASVTYPQQCSALRKNGFVMLKSRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTSKKYEDICPSTHNMDVPFVKREDYQLTDISDDGYLCLMADNGELREDLKIPDGDLGTQLRADYESGKELLCTVLKACGEEVVIAVK 153          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Cavefish
Match: eif5a2 (eukaryotic translation initiation factor 5A-1-like [Source:NCBI gene;Acc:103022137])

HSP 1 Score: 190.274 bits (482), Expect = 7.345e-58
Identity = 90/156 (57.69%), Postives = 119/156 (76.28%), Query Frame = 1
Query:   61 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLTN 528
            MSD +  F + D+GAS T P Q SA RKN H+++K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+GKK EDICPST N D P + R++Y L+ + T+ Y+SLM D GE +ED+KLP++EL  EI +KF++G+  L++++SA GEE  V  K +T+
Sbjct:    1 MSDPDVDFTSGDAGASMTYPMQCSALRKNGHVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKNEDICPSTHNMDVPNIKRLDYQLVGV-TEGYLSLMKDNGEIREDLKLPDSELGKEIESKFDAGEEILISVLSAMGEECAVAIKAMTS 155          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Cavefish
Match: EIF5AL1 (eukaryotic translation initiation factor 5A [Source:NCBI gene;Acc:103038290])

HSP 1 Score: 187.963 bits (476), Expect = 5.910e-57
Identity = 89/155 (57.42%), Postives = 112/155 (72.26%), Query Frame = 1
Query:   61 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            M+D +  F   D+GAS T P Q SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIFSGKKYEDICPST N D P + R++Y LI I  D Y+SL+ D GE +ED+K+PE +L  EI  KF++G+  L+T++SA  EE  V  K + 
Sbjct:    1 MADADLDFTTGDAGASATYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHMVGIDIFSGKKYEDICPSTHNMDVPNIKRMDYQLIGIQ-DGYLSLLQDSGEVREDLKMPEGDLGKEIEGKFDAGEEILITVLSAMNEEAAVAIKAMA 154          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Cavefish
Match: EIF5AL1 (eukaryotic translation initiation factor 5A [Source:NCBI gene;Acc:103038290])

HSP 1 Score: 187.963 bits (476), Expect = 5.910e-57
Identity = 89/155 (57.42%), Postives = 112/155 (72.26%), Query Frame = 1
Query:   61 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            M+D +  F   D+GAS T P Q SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIFSGKKYEDICPST N D P + R++Y LI I  D Y+SL+ D GE +ED+K+PE +L  EI  KF++G+  L+T++SA  EE  V  K + 
Sbjct:    1 MADADLDFTTGDAGASATYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHMVGIDIFSGKKYEDICPSTHNMDVPNIKRMDYQLIGIQ-DGYLSLLQDSGEVREDLKMPEGDLGKEIEGKFDAGEEILITVLSAMNEEAAVAIKAMA 154          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Cavefish
Match: EIF5AL1 (eukaryotic translation initiation factor 5A [Source:NCBI gene;Acc:103038290])

HSP 1 Score: 187.963 bits (476), Expect = 1.198e-56
Identity = 89/155 (57.42%), Postives = 112/155 (72.26%), Query Frame = 1
Query:   61 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            M+D +  F   D+GAS T P Q SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIFSGKKYEDICPST N D P + R++Y LI I  D Y+SL+ D GE +ED+K+PE +L  EI  KF++G+  L+T++SA  EE  V  K + 
Sbjct:   29 MADADLDFTTGDAGASATYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHMVGIDIFSGKKYEDICPSTHNMDVPNIKRMDYQLIGIQ-DGYLSLLQDSGEVREDLKMPEGDLGKEIEGKFDAGEEILITVLSAMNEEAAVAIKAMA 182          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Cavefish
Match: eif5a (eukaryotic translation initiation factor 5A-1 [Source:NCBI gene;Acc:103024997])

HSP 1 Score: 178.718 bits (452), Expect = 1.579e-53
Identity = 84/155 (54.19%), Postives = 116/155 (74.84%), Query Frame = 1
Query:   61 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLT 525
            M+D +  F + D+GAS T PQQ SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIF+ KKYEDICPST N D P + R ++ L+DI+ + ++SLM D G+ +ED+++P+ +L  EI +K  +G++ ++T++SA GEE  VG K  T
Sbjct:    1 MADPDLDFTSGDAGASVTYPQQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTNKKYEDICPSTHNMDVPNIKRNDFQLVDIN-EGFLSLMMDNGDVREDLRVPDGDLGKEIESKHGAGEDMMITVLSAMGEEAAVGIKAFT 154          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Yeast
Match: ANB1 (Translation elongation factor eIF-5A; previously thought to function in translation initiation; undergoes an essential hypusination modification; expressed under anaerobic conditions; ANB1 has a paralog, HYP2, that arose from the whole genome duplication; human EIF5A complements the inviability of the yeast hyp2 anb1 double null mutant [Source:SGD;Acc:S000003808])

HSP 1 Score: 187.193 bits (474), Expect = 1.358e-57
Identity = 93/152 (61.18%), Postives = 112/152 (73.68%), Query Frame = 1
Query:   61 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCK 516
            MSD E TFENAD+GAS T P Q SA RKN  ++IK RPCKIV+MSTSKTGKHG AKVH+V +DIF+GKK ED+ PST N + P V R EY L+DI  D Y+SLM   GETK+DVK PE EL D ++A F+ G + +VTI+SA GEE  +  K
Sbjct:    1 MSDEEHTFENADAGASATYPMQCSALRKNGFVVIKGRPCKIVDMSTSKTGKHGHAKVHLVTLDIFTGKKLEDLSPSTHNLEVPFVKRSEYQLLDID-DGYLSLMTMDGETKDDVKAPEGELGDSMQAAFDEGKDLMVTIISAMGEEAAISFK 151          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Yeast
Match: HYP2 (Translation elongation factor eIF-5A; required for translation of proteins containing polyproline stretches, including Bni1p, and this leads to a requirement for mating projection formation; structural homolog of bacterial EF-P; undergoes an essential hypusination modification; HYP2 has a paralog, ANB1, that arose from the whole genome duplication; human EIF5A complements the inviability of the yeast hyp2 anb1 double null mutant [Source:SGD;Acc:S000000760])

HSP 1 Score: 183.341 bits (464), Expect = 4.444e-56
Identity = 90/152 (59.21%), Postives = 112/152 (73.68%), Query Frame = 1
Query:   61 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCK 516
            MSD E TFE AD+G+S T P Q SA RKN  ++IK RPCKIV+MSTSKTGKHG AKVH+V IDIF+GKK ED+ PST N + P+V R EY L+DI  D ++SLMN  G+TK+DVK PE EL D ++  F+ G + +VTI+SA GEE  +  K
Sbjct:    1 MSDEEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDID-DGFLSLMNMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFK 151          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Yeast
Match: DYN2 (Cytoplasmic light chain dynein, microtubule motor protein; required for intracellular transport and cell division; involved in mitotic spindle positioning; forms complex with dynein intermediate chain Pac11p that promotes Dyn1p homodimerization, potentiates motor processivity; Dyn2p-Pac11p complex important for interaction of dynein motor complex with dynactin complex; acts as molecular glue to dimerize, stabilize Nup82-Nsp1-Nup159 complex module of cytoplasmic pore filaments [Source:SGD;Acc:S000002832])

HSP 1 Score: 57.3806 bits (137), Expect = 4.941e-11
Identity = 29/80 (36.25%), Postives = 52/80 (65.00%), Query Frame = -1
Query:  657 SSDMSNGDQAHIIEICRDLLLEYDDQSDIAEELKNKLDEEFGKHWHVIVGIGRYGSNISNEESCLLHFKLSRFAFLIWKT 896
            +SD+++  +  I+ I +D L +Y  + DIA  +K +LD ++G  WHVIVG   +GS +++E+   ++F +   AFL++KT
Sbjct:   13 ASDITDKLKEDILTISKDALDKYQLERDIAGTVKKQLDVKYGNTWHVIVG-KNFGSYVTHEKGHFVYFYIGPLAFLVFKT 91          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Nematostella
Match: EDO30482 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0N1])

HSP 1 Score: 189.504 bits (480), Expect = 5.579e-58
Identity = 87/155 (56.13%), Postives = 120/155 (77.42%), Query Frame = 1
Query:   67 DIEDT-FENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLTN 528
            ++ DT F + +SGAS T P Q S+ RKN H++IK RPCKIVEMSTSKTGKHG AKVH+V +DIF+ KKYEDICPST N + P V+R ++ + +I  D Y+ LM+D G+T+ D+KL +N++A EIRAKFE+ +N +VT++ A GEE +VG KV+++
Sbjct:    4 ELADTEFHSGESGASDTYPAQCSSLRKNGHVVIKGRPCKIVEMSTSKTGKHGHAKVHLVALDIFTNKKYEDICPSTHNMNVPHVSRADFQVTNIEEDGYLELMDDNGDTRADIKLQDNDIAKEIRAKFEASENFMVTVLKAMGEETVVGVKVMSD 158          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Nematostella
Match: EDO44582 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVI5])

HSP 1 Score: 47.7506 bits (112), Expect = 3.859e-7
Identity = 25/82 (30.49%), Postives = 47/82 (57.32%), Query Frame = -1
Query:  657 IFSSDMSNGDQAHIIEICRDLLLEYDDQSDIAEELKNKLDEEFGKHWHVIVGIGRYGSNISNEESCLLHFKLSRFAFLIWKT 902
            I ++DM+   Q   IE     L +++ + DIA  +K + D+++   WH IVG   +GS +++E    ++F L + A L++K+
Sbjct:    8 IKNADMAEDMQTDAIECATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVG-RNFGSYVTHETKHFIYFYLGQVAILLFKS 88          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Medaka
Match: EIF5AL1 (eukaryotic translation initiation factor 5A [Source:NCBI gene;Acc:101159469])

HSP 1 Score: 191.815 bits (486), Expect = 1.521e-58
Identity = 91/154 (59.09%), Postives = 115/154 (74.68%), Query Frame = 1
Query:   61 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVL 522
            M+D E  F+  D+GAS T P Q SA RKN  +++K RPCKIVEMSTSKTGKHG AKVH+VGIDIFSGKKYEDICPST N D P + R++Y LI I  D Y+SL+ D GE +ED+K+PE +L  EI +K+E+G+  LVT+++A  EE  +G K L
Sbjct:    1 MADAELDFQTGDAGASATYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFSGKKYEDICPSTHNMDVPNIKRMDYQLIGIQ-DGYLSLLQDSGEVREDLKIPEGDLGKEIESKYEAGEEILVTVLNAMDEEAAIGIKAL 153          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Medaka
Match: ENSORLT00000028460.1 (eukaryotic translation initiation factor 5A-1 [Source:NCBI gene;Acc:101154812])

HSP 1 Score: 187.193 bits (474), Expect = 6.130e-56
Identity = 89/156 (57.05%), Postives = 121/156 (77.56%), Query Frame = 1
Query:   61 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLTN 528
            M+D +  F   +SGAS T P Q SA RKN ++++K RPCKIVEMSTSKTGKHG AKV++VGIDIF+ KKYED+CPST N D P + R++Y L++I+ +NY+SLM+D G+ +ED+++PENE+  EI AKFE+G+  +VT++SA GEE  V  KVL +
Sbjct:   61 MADPDLDFTTGESGASATYPMQCSALRKNGYVVLKGRPCKIVEMSTSKTGKHGHAKVNLVGIDIFTNKKYEDMCPSTHNMDVPSIKRIDYQLVNIN-ENYMSLMSDNGDIREDLRVPENEVGKEIEAKFEAGEEFMVTVISAMGEECAVATKVLAS 215          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Medaka
Match: ENSORLT00000044399.1 (eukaryotic translation initiation factor 5A-1 [Source:NCBI gene;Acc:101166426])

HSP 1 Score: 180.259 bits (456), Expect = 1.934e-53
Identity = 92/171 (53.80%), Postives = 118/171 (69.01%), Query Frame = 1
Query:   46 GYFFNMSDI----------EDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLTN 528
            G+FF    I          +D F  AD+GAS T P Q SA RKN  +M+K RPCKIVEM+TSKTGKHG AKVH+ G+DIF+ KKYEDICPST N D P V R +Y  ID+S D ++SLM+D GET+ED+K+PE +L  EI  K  +G+  +V+++ A  EEQIVG K +T+
Sbjct:   28 GFFFGSCFIILSSPWHIMADDDFSTADAGASTTFPMQCSALRKNGFVMLKGRPCKIVEMTTSKTGKHGHAKVHLTGLDIFTQKKYEDICPSTHNMDVPNVIRKDYQAIDVS-DGFLSLMDDNGETREDLKVPEGDLGKEIIKKISNGELFMVSVLKAVDEEQIVGTKNMTS 197          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Medaka
Match: dynll1 (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:101171417])

HSP 1 Score: 48.521 bits (114), Expect = 4.809e-7
Identity = 26/82 (31.71%), Postives = 47/82 (57.32%), Query Frame = -1
Query:  657 IFSSDMSNGDQAHIIEICRDLLLEYDDQSDIAEELKNKLDEEFGKHWHVIVGIGRYGSNISNEESCLLHFKLSRFAFLIWKT 902
            I ++DMS   Q   +E     L +Y+ + DIA  +K + D+++   WH IVG   +GS +++E    ++F L + A L++K+
Sbjct:    8 IKNADMSEDMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVG-RNFGSYVTHETKHFIYFYLGQVAILLFKS 88          
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Medaka
Match: ENSORLT00000005747.2 (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:101162462])

HSP 1 Score: 46.595 bits (109), Expect = 2.295e-6
Identity = 27/89 (30.34%), Postives = 51/89 (57.30%), Query Frame = -1
Query:  657 TDCKDIEIFSSDMSNGDQAHIIEICRDLLLEYDDQSDIAEELKNKLDEEFGKHWHVIVGIGRYGSNISNEESCLLHFKLSRFAFLIWKT 923
            TD K + I ++DMS   Q   ++     + +Y+ + DIA  +K + D+++   WH IVG   +GS +++E    ++F L + A L++K+
Sbjct:    2 TDRKAV-IKNADMSEEMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVG-RNFGSYVTHETKHFIYFYLGQVAILLFKS 88          
BLAST of Eukaryotic translation initiation factor 5A vs. Planmine SMEST
Match: SMESG000016245.1 (SMESG000016245.1)

HSP 1 Score: 323.168 bits (827), Expect = 1.254e-109
Identity = 156/156 (100.00%), Postives = 156/156 (100.00%), Query Frame = 1
Query:   61 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLTN 528
            MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLTN
Sbjct:    1 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLTN 156          
BLAST of Eukaryotic translation initiation factor 5A vs. Planmine SMEST
Match: SMESG000016244.1 (SMESG000016244.1)

HSP 1 Score: 225.328 bits (573), Expect = 3.266e-71
Identity = 109/109 (100.00%), Postives = 109/109 (100.00%), Query Frame = -1
Query:  651 LLRRASRLNAAFLNTTGHTDCKDIEIFSSDMSNGDQAHIIEICRDLLLEYDDQSDIAEELKNKLDEEFGKHWHVIVGIGRYGSNISNEESCLLHFKLSRFAFLIWKTNE 977
            LLRRASRLNAAFLNTTGHTDCKDIEIFSSDMSNGDQAHIIEICRDLLLEYDDQSDIAEELKNKLDEEFGKHWHVIVGIGRYGSNISNEESCLLHFKLSRFAFLIWKTNE
Sbjct:   68 LLRRASRLNAAFLNTTGHTDCKDIEIFSSDMSNGDQAHIIEICRDLLLEYDDQSDIAEELKNKLDEEFGKHWHVIVGIGRYGSNISNEESCLLHFKLSRFAFLIWKTNE 176          

HSP 2 Score: 73.1738 bits (178), Expect = 6.387e-15
Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = -2
Query: 1178 MAFDDIDRKGTGVISMEDVKNYTSKENYHKNFIQ 1279
            MAFDDIDRKGTGVISMEDVKNYTSKENYHKNFIQ
Sbjct:    1 MAFDDIDRKGTGVISMEDVKNYTSKENYHKNFIQ 34          

HSP 3 Score: 51.2174 bits (121), Expect = 2.559e-7
Identity = 30/58 (51.72%), Postives = 35/58 (60.34%), Query Frame = -3
Query: 1033 KKTTTKTSYRFCRIQLAFLIYKXXXXXXXXXXNSDGIITLDEYCTALGINDKTKDKMF 1206
            K  T+K +Y    IQ  F ++            SDGIITLDEYCTALGINDKTKDK+ 
Sbjct:   20 KNYTSKENYHKNFIQNFFNLFDLN---------SDGIITLDEYCTALGINDKTKDKIL 68          
BLAST of Eukaryotic translation initiation factor 5A vs. Planmine SMEST
Match: SMESG000016244.1 (SMESG000016244.1)

HSP 1 Score: 225.328 bits (573), Expect = 3.614e-71
Identity = 109/109 (100.00%), Postives = 109/109 (100.00%), Query Frame = -1
Query:  651 LLRRASRLNAAFLNTTGHTDCKDIEIFSSDMSNGDQAHIIEICRDLLLEYDDQSDIAEELKNKLDEEFGKHWHVIVGIGRYGSNISNEESCLLHFKLSRFAFLIWKTNE 977
            LLRRASRLNAAFLNTTGHTDCKDIEIFSSDMSNGDQAHIIEICRDLLLEYDDQSDIAEELKNKLDEEFGKHWHVIVGIGRYGSNISNEESCLLHFKLSRFAFLIWKTNE
Sbjct:   73 LLRRASRLNAAFLNTTGHTDCKDIEIFSSDMSNGDQAHIIEICRDLLLEYDDQSDIAEELKNKLDEEFGKHWHVIVGIGRYGSNISNEESCLLHFKLSRFAFLIWKTNE 181          

HSP 2 Score: 83.9593 bits (206), Expect = 1.212e-18
Identity = 39/39 (100.00%), Postives = 39/39 (100.00%), Query Frame = -2
Query: 1178 MAHFLMAFDDIDRKGTGVISMEDVKNYTSKENYHKNFIQ 1294
            MAHFLMAFDDIDRKGTGVISMEDVKNYTSKENYHKNFIQ
Sbjct:    1 MAHFLMAFDDIDRKGTGVISMEDVKNYTSKENYHKNFIQ 39          

HSP 3 Score: 51.2174 bits (121), Expect = 2.639e-7
Identity = 30/58 (51.72%), Postives = 35/58 (60.34%), Query Frame = -3
Query: 1033 KKTTTKTSYRFCRIQLAFLIYKXXXXXXXXXXNSDGIITLDEYCTALGINDKTKDKMF 1206
            K  T+K +Y    IQ  F ++            SDGIITLDEYCTALGINDKTKDK+ 
Sbjct:   25 KNYTSKENYHKNFIQNFFNLFDLN---------SDGIITLDEYCTALGINDKTKDKIL 73          
BLAST of Eukaryotic translation initiation factor 5A vs. Planmine SMEST
Match: SMESG000023224.1 (SMESG000023224.1)

HSP 1 Score: 222.246 bits (565), Expect = 2.837e-70
Identity = 103/156 (66.03%), Postives = 127/156 (81.41%), Query Frame = 1
Query:   61 MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLTN 528
            MSD E+TF+N DSGAS TVP+QMSAFRK Q+IMIKD+PCKI +MST KTGKHGSAKV VV  DIF+ K+ ED+ PSTAN++ P+V R+E+ LIDIS DNY SLM+++G+ KEDV+LP  EL  EIRA+FE GD  +VT+MSAC EE+IV  K +TN
Sbjct:    1 MSDYEETFDNVDSGASLTVPKQMSAFRKGQYIMIKDKPCKITDMSTCKTGKHGSAKVQVVATDIFTEKRLEDVSPSTANRETPIVKRIEFQLIDISGDNYTSLMSERGDIKEDVQLPGGELEAEIRARFEKGDQVVVTVMSACNEEKIVSVKTVTN 156          
BLAST of Eukaryotic translation initiation factor 5A vs. Planmine SMEST
Match: SMESG000023236.1 (SMESG000023236.1)

HSP 1 Score: 223.787 bits (569), Expect = 4.091e-70
Identity = 103/157 (65.61%), Postives = 128/157 (81.53%), Query Frame = 1
Query:   58 NMSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTGKHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNYVSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVGCKVLTN 528
            N SD E+TF+N DSGAS TVP+QMSAFRK Q+IMIKDRPCKI +MST KTGKHGSAKV V   DIF+ K+ ED+ PSTAN++ P+V R+E+ LIDIS DNY SLM++KG+ KEDV+LP  EL  +IRA+FE GD+ +VT+MSAC EE++V CK +TN
Sbjct:   51 NDSDYEETFDNVDSGASLTVPKQMSAFRKGQYIMIKDRPCKITDMSTCKTGKHGSAKVQVTATDIFTDKRLEDVSPSTANRETPIVKRIEFQLIDISGDNYTSLMSEKGDVKEDVQLPGGELEADIRARFEKGDHVMVTVMSACNEEKVVACKTITN 207          
The following BLAST results are available for this feature:
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EIF5A1.961e-5357.43eukaryotic translation initiation factor 5A [Sourc... [more]
EIF5A1.961e-5357.43eukaryotic translation initiation factor 5A [Sourc... [more]
EIF5A1.961e-5357.43eukaryotic translation initiation factor 5A [Sourc... [more]
EIF5A1.961e-5357.43eukaryotic translation initiation factor 5A [Sourc... [more]
EIF5A1.961e-5357.43eukaryotic translation initiation factor 5A [Sourc... [more]
back to top
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
iff-19.295e-5156.21Eukaryotic translation initiation factor 5A-1 [So... [more]
iff-19.295e-5156.21Eukaryotic translation initiation factor 5A-1 [So... [more]
iff-11.746e-5056.21Eukaryotic translation initiation factor 5A-1 [So... [more]
iff-27.423e-5059.46Eukaryotic translation initiation factor 5A-2 [So... [more]
iff-27.423e-5059.46Eukaryotic translation initiation factor 5A-2 [So... [more]
back to top
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eEF51.320e-5858.06gene:FBgn0285952 transcript:FBtr0072172[more]
eEF51.320e-5858.06gene:FBgn0285952 transcript:FBtr0072173[more]
Cdlc21.098e-630.49gene:FBgn0026141 transcript:FBtr0077924[more]
Cdlc21.098e-630.49gene:FBgn0026141 transcript:FBtr0305553[more]
Cdlc21.098e-630.49gene:FBgn0026141 transcript:FBtr0077925[more]
back to top
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif5a24.042e-5556.41eukaryotic translation initiation factor 5A2 [Sour... [more]
eif5a24.042e-5556.41eukaryotic translation initiation factor 5A2 [Sour... [more]
eif5a24.042e-5556.41eukaryotic translation initiation factor 5A2 [Sour... [more]
eif5a24.042e-5556.41eukaryotic translation initiation factor 5A2 [Sour... [more]
eif5a2.357e-5456.13eukaryotic translation initiation factor 5A [Sourc... [more]
back to top
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ddo1.455e-5358.11D-aspartate oxidase [Source:Xenbase;Acc:XB-GENE-62... [more]
ddo1.539e-4959.40D-aspartate oxidase [Source:Xenbase;Acc:XB-GENE-62... [more]
dynll24.452e-629.27dynein light chain LC8-type 2 [Source:NCBI gene;Ac... [more]
dynll16.843e-629.27dynein light chain LC8-type 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eif5a1.346e-5357.43eukaryotic translation initiation factor 5A [Sourc... [more]
Eif5a1.346e-5357.43eukaryotic translation initiation factor 5A [Sourc... [more]
Eif5a1.346e-5357.43eukaryotic translation initiation factor 5A [Sourc... [more]
Eif5a1.346e-5357.43eukaryotic translation initiation factor 5A [Sourc... [more]
Eif5a1.346e-5357.43eukaryotic translation initiation factor 5A [Sourc... [more]
back to top
BLAST of Eukaryotic translation initiation factor 5A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P62925|IF5A_SPOFR1.016e-5960.26Eukaryotic translation initiation factor 5A OS=Spo... [more]
sp|P62924|IF5A_SPOEX1.016e-5960.26Eukaryotic translation initiation factor 5A OS=Spo... [more]
sp|Q9GU68|IF5A_DROME1.323e-5758.06Eukaryotic translation initiation factor 5A OS=Dro... [more]
sp|P19211|IF5A2_YEAST9.429e-5661.18Eukaryotic translation initiation factor 5A-2 OS=S... [more]
sp|P23301|IF5A1_YEAST3.086e-5459.21Eukaryotic translation initiation factor 5A-1 OS=S... [more]
back to top
BLAST of Eukaryotic translation initiation factor 5A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5JG617.785e-9087.25Eukaryotic translation initiation factor 5A (Fragm... [more]
E9GL782.440e-5961.54Eukaryotic translation initiation factor 5A OS=Dap... [more]
A0A194AMN05.695e-5964.05Eukaryotic translation initiation factor 5A OS=Pin... [more]
A0A158NEM21.004e-5862.75Eukaryotic translation initiation factor 5A OS=Att... [more]
F4WRT81.004e-5862.75Eukaryotic translation initiation factor 5A OS=Acr... [more]
back to top
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif5a27.345e-5857.69eukaryotic translation initiation factor 5A-1-like... [more]
EIF5AL15.910e-5757.42eukaryotic translation initiation factor 5A [Sourc... [more]
EIF5AL15.910e-5757.42eukaryotic translation initiation factor 5A [Sourc... [more]
EIF5AL11.198e-5657.42eukaryotic translation initiation factor 5A [Sourc... [more]
eif5a1.579e-5354.19eukaryotic translation initiation factor 5A-1 [Sou... [more]
back to top
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ANB11.358e-5761.18Translation elongation factor eIF-5A; previously t... [more]
HYP24.444e-5659.21Translation elongation factor eIF-5A; required for... [more]
DYN24.941e-1136.25Cytoplasmic light chain dynein, microtubule motor ... [more]
back to top
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO304825.579e-5856.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445823.859e-730.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Eukaryotic translation initiation factor 5A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EIF5AL11.521e-5859.09eukaryotic translation initiation factor 5A [Sourc... [more]
ENSORLT00000028460.16.130e-5657.05eukaryotic translation initiation factor 5A-1 [Sou... [more]
ENSORLT00000044399.11.934e-5353.80eukaryotic translation initiation factor 5A-1 [Sou... [more]
dynll14.809e-731.71dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
ENSORLT00000005747.22.295e-630.34dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
back to top
BLAST of Eukaryotic translation initiation factor 5A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016245.11.254e-109100.00SMESG000016245.1[more]
SMESG000016244.13.266e-71100.00SMESG000016244.1[more]
SMESG000016244.13.614e-71100.00SMESG000016244.1[more]
SMESG000023224.12.837e-7066.03SMESG000023224.1[more]
SMESG000023236.14.091e-7065.61SMESG000023236.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004020 ID=SMED30004020|Name=Eukaryotic translation initiation factor 5A|organism=Schmidtea mediterranea sexual|type=transcript|length=1580bp
ATTTGTTTAAATTGTTGAGCTATTTTAACATACAAAACACGTTTTGGATA
TTTTTTTAACATGTCCGATATTGAAGACACATTTGAAAATGCTGATTCCG
GTGCTTCACAAACTGTTCCCCAACAAATGAGTGCTTTCCGCAAGAACCAA
CATATAATGATCAAAGATAGACCTTGTAAAATTGTTGAAATGAGTACTTC
AAAAACCGGTAAACATGGTAGTGCTAAAGTTCATGTAGTAGGAATAGATA
TATTTTCTGGAAAAAAATATGAAGATATCTGTCCAAGTACTGCTAATAAA
GACAAGCCACTTGTAAATCGTGTTGAATATACACTTATTGATATTTCAAC
TGACAATTATGTTAGCTTAATGAATGATAAAGGCGAAACTAAAGAAGATG
TTAAATTACCAGAAAATGAATTGGCTGATGAAATAAGAGCAAAATTTGAA
AGTGGAGATAATTGCCTCGTGACAATTATGTCTGCATGCGGAGAAGAACA
AATAGTTGGATGCAAGGTTCTGACCAATTAGCAGTTTTATATTCAAGACT
TTACTAGTCGAATGGTTAAATCAATAATTAATGATTTCATGTTGATTAAT
CATACGCATAAAACTAAATGTAGTTTTTGGATGTTTATTTTATACAATCA
TTCATTTGTTTTCCAAATTAAAAATGCAAATCGACTCAATTTAAAATGTA
AAAGGCATGATTCTTCATTAGATATGTTAGACCCGTATCTACCGATGCCC
ACAATTACATGCCAATGTTTTCCGAATTCTTCGTCTAGTTTGTTTTTTAA
TTCTTCTGCAATGTCAGATTGGTCATCATATTCCAACAGCAAATCTCGGC
ATATTTCAATAATATGCGCTTGATCTCCATTGCTCATGTCGCTAGAAAAT
ATTTCTATATCTTTACAGTCGGTGTGACCTGTTGTGTTTAGGAATGCCGC
ATTCAATCGACTTGCTCTTCTTAACAAACTGAAAAGCATATTTATTGAAT
TTATTTTTTAAAAAATGAATCTAGAAATTATCAAACATTTTATCTTTCGT
TTTGTCATTGATTCCCAGAGCGGTACAATATTCGTCGAGTGTTATTATGC
CATCAGAATTCAAATCGAATAAATTGAAAAAGTTCTAAAATTTATATATT
AAAAATGCCAGCTGAATACGACAAAACCTGTATGAAGTTTTTGTGGTAGT
TTTCTTTTGATGTATAATTCTTTACGTCTTCCATTGAAATTACTCCAGTT
CCTTTTCTATCGATATCATCGAAAGCCATTAAAAAATGCGCCATTTTGAA
TTATCTATAGAAGTTATTGAGTTTTAAAAATTTTGCGCGATAATTCAAAA
TTTTTTATCAGTTATCGCGTGGTGAAATTTTTTGCTAACTGGAATTTTGC
AGAAAGTATTTATTGAAATGGGCTTATTCTAATTTAATTTTTAATCGGTG
ATTGTATTTCCTTTTTTATCGGTTCCTTTACTTTTGCTTAGAAATTGCGA
TTCTTCGTTCGCATAAAAAGTTGATTTTTTGCATATTTTGGGGTTGTGGT
GATGCTTTTTGCATTCCGGTAGGTCTCAGA
back to top

protein sequence of SMED30004020-orf-1

>SMED30004020-orf-1 ID=SMED30004020-orf-1|Name=SMED30004020-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=157bp
MSDIEDTFENADSGASQTVPQQMSAFRKNQHIMIKDRPCKIVEMSTSKTG
KHGSAKVHVVGIDIFSGKKYEDICPSTANKDKPLVNRVEYTLIDISTDNY
VSLMNDKGETKEDVKLPENELADEIRAKFESGDNCLVTIMSACGEEQIVG
CKVLTN*
back to top

protein sequence of SMED30004020-orf-2

>SMED30004020-orf-2 ID=SMED30004020-orf-2|Name=SMED30004020-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=114bp
MLFSLLRRASRLNAAFLNTTGHTDCKDIEIFSSDMSNGDQAHIIEICRDL
LLEYDDQSDIAEELKNKLDEEFGKHWHVIVGIGRYGSNISNEESCLLHFK
LSRFAFLIWKTNE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002048EF_hand_dom
IPR001372Dynein_light_chain_typ-1/2
IPR020189Transl_elong_IF5A_C
IPR014722Rib_L2_dom2
IPR001884IF5A-like
IPR013185Transl_elong_KOW-like
IPR012340NA-bd_OB-fold
IPR019769Trans_elong_IF5A_hypusine_site
IPR008991Translation_prot_SH3-like_sf
IPR000651Ras-like_Gua-exchang_fac_N
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0043022ribosome binding
GO:0003723RNA binding
GO:0003746translation elongation factor activity
GO:0003743translation initiation factor activity
Vocabulary: cellular component
TermDefinition
GO:0030286dynein complex
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
GO:0006452translational frameshifting
GO:0045901positive regulation of translational elongation
GO:0045905positive regulation of translational termination
GO:0006412translation
GO:0006413translational initiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020189Translation elongation factor, IF5A C-terminalSMARTSM01376eIF_5a_2coord: 84..152
e-value: 1.7E-33
score: 127.2
IPR020189Translation elongation factor, IF5A C-terminalPFAMPF01287eIF-5acoord: 85..152
e-value: 6.8E-30
score: 103.0
IPR001884Translation elongation factor IF5A-likePIRSFPIRSF003025Transl_init_eIF5Acoord: 1..156
e-value: 5.8E-63
score: 208.8
IPR001884Translation elongation factor IF5A-likeTIGRFAMTIGR00037TIGR00037coord: 17..150
e-value: 2.3E-42
score: 141.9
IPR001884Translation elongation factor IF5A-likePANTHERPTHR11673TRANSLATION INITIATION FACTOR 5A-RELATEDcoord: 1..153
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 85..156
e-value: 4.0E-30
score: 105.8
NoneNo IPR availableCDDcd04468S1_eIF5Acoord: 85..153
e-value: 5.96844E-33
score: 109.549
IPR014722Ribosomal protein L2, domain 2GENE3DG3DSA:2.30.30.30coord: 1..83
e-value: 6.4E-40
score: 136.9
IPR013185Translation elongation factor, KOW-likePFAMPF08207EFP_Ncoord: 23..72
e-value: 1.5E-4
score: 21.7
IPR019769Translation elongation factor, IF5A, hypusine sitePROSITEPS00302IF5A_HYPUSINEcoord: 49..56
IPR008991Translation protein SH3-like domain superfamilySUPERFAMILYSSF50104Translation proteins SH3-like domaincoord: 14..92
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 85..152