Rap-GAP domain-containing protein

Overview
NameRap-GAP domain-containing protein
Smed IDSMED30004017
Length (bp)4408
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rap-GAP domain-containing protein (SMED30004017) t-SNE clustered cells

Violin plots show distribution of expression levels for Rap-GAP domain-containing protein (SMED30004017) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rap-GAP domain-containing protein (SMED30004017) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rap-GAP domain-containing protein (SMED30004017) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004017

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30004017h1SMcG0012037 PL08001B1A12smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30004017h1SMcG0012037 dd_Smed_v4_6504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004017h1SMcG0012037 dd_Smed_v4_6504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004017h1SMcG0012037 dd_Smed_v4_6504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004017h1SMcG0012037 dd_Smed_v4_6504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004017h1SMcG0012037 dd_Smed_v4_6504_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rap-GAP domain-containing protein vs. Ensembl Human
Match: RALGAPA1 (Ral GTPase activating protein catalytic alpha subunit 1 [Source:HGNC Symbol;Acc:HGNC:17770])

HSP 1 Score: 449.514 bits (1155), Expect = 4.051e-146
Identity = 317/989 (32.05%), Postives = 488/989 (49.34%), Query Frame = 2
Query: 1256 RKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLH-CYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLS---VDPLVEYPYLFDVKPVEGVTQEVNSP-----EVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHK-------YENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYV-------DNLLVELTEMNPEIFSNQ-------FPKPSAVESGQTS--LESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSKGRDSV 4123
            R+ D+ P+ D L  FY ++H  +   ++  + T+I +    FF + L G+ +LI+DFI A   V  ++      +  P++E+  LLGS++ F +L         N   + +      K  I+  ++SSA+ EP   AR +++  + +  C  ++   E+    + +  N I + L   +F N  +A ++ +M+  LV+   ++Q   P  P KIIQ+L   I         S    DK+ + SL+  L+DW M LPL  LL+    H+ G         E+   +  ++N +       V   +            NP     + + L+    DP +    L + +P+     E +S      EV  + Q+  + +AAR  + HL+N++G YP +     L+S V E+HD    ++              +LS E+F +P +Q FV+N + LVS + + S+      ++ PGG         + S  S VR+I+RDL GKY WD A ++         E  + +   S +++   P           + +  SL  K  +   P  D +       D LL  L   +PE             P+P  +   Q +  + ++ K+   E+  VE +  D           L  K +    P    P+     + FY+CR +L+ LG  SW +R S  L++K+   L  L+N+D R+ RETHKIAV YVA GQEDK SIL NT GS  +  F++GLGW VNL NH GFMGGL+ +   G   PY+A ST+E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV+I+IYP++N +F I I  K E+  FGPLFDGA+V  K LP++VRATAINA R ++   P YQ F+ ERA YL+  ++   EP +FEDFA  ++  PA        A S  E+ P    S+    T    ++L S MS    +SK R S+
Sbjct: 1158 RRQDVSPNRDFLTHFYNIMHCGLLHIDQDIVNTIIKHCSPQFFSLGLPGATMLIMDFIVAAGRVASSA-----FLNAPRVEAQVLLGSLVCFPNLYCELPSLHPNIPDVAVSQFTDVKELIIKTVLSSARDEPSGPARCVALCSLGIWICEELVH--ESHHPQIKEALNVICVSL---KFTNKTVAHVACNMLHMLVHYVPRLQIYQPDSPLKIIQILIATITHLLPSTEASSYEMDKRLVVSLLLCLLDWIMALPLKTLLQP--FHATGA--------ESDKTEKSVLNCIYKVLHGCVYGAQ---------CFSNPRYFPMSLSDLASVDYDPFMHLESLKEPEPLHSPDSERSSKLQPVTEVKTQMQHGLISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSEST-------------ELSPELFESPNIQFFVLNNTTLVSCIQIRSE------ENMPGG----GLSAGLASANSNVRIIVRDLSGKYSWDSAILYGPPPVSGLSEPTSFMLSLSHQEKPEEPPTSNECLEDITVKDGLSLQFKRFRETVPTWDTIRDEEDVLDELLQYLGVTSPECLQRTGISLNIPAPQPVCISEKQENDVINAILKQHTEEKEFVEKHFND-----------LNMKAVEQDEPIPQKPQ-----SAFYYCRLLLSILGMNSWDKRRSFHLLKKNEKLLRELRNLDSRQCRETHKIAVFYVAEGQEDKHSILTNTGGSQAYEDFVAGLGWEVNLTNHCGFMGGLQKNKSTGLTTPYFATSTVEVIFHVSTRMPSDSDDSLTKKLRHLGNDEVHIVWSEHTRDYRRGIIPTEFGDVLIVIYPMKNHMFSIQIMKKPEVPFFGPLFDGAIVNGKVLPIMVRATAINASRALKSLIPLYQNFYEERARYLQTIVQHHLEPTTFEDFAAQVFS-PAPYHHLPSDAGSYPEILP----SETPTATQVDGADLASPMS--PRTSKSRMSM 2071          

HSP 2 Score: 91.6633 bits (226), Expect = 4.051e-146
Identity = 44/176 (25.00%), Postives = 88/176 (50.00%), Query Frame = 3
Query:  735 PAQDTLNDSSRTPTK------HSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            P    L   S+TP+       H  ++ +Q+ +++  + +   D++  S   ++  S             V+ GGT+ GW  +   ++W+R +G+LG++  I +P++   +  Y  EL  +  K+R+N+ I   N  +P+PP+  PP+  + PW+F+   L   +   KL A +++C
Sbjct:  991 PVHSPLGSRSQTPSPSTLNIDHMEQKDLQLDEKLHHSVLQTPDDLEISEFPSECCS-------------VMAGGTLTGWHADVATVMWRRMLGILGDVNSIMDPEIHAQVFDYLCELWQNLAKIRDNLGISTDNLTSPSPPVLIPPLRILTPWLFKATMLTDKYKQGKLHAYKLIC 1153          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Human
Match: RALGAPA1 (Ral GTPase activating protein catalytic alpha subunit 1 [Source:HGNC Symbol;Acc:HGNC:17770])

HSP 1 Score: 446.432 bits (1147), Expect = 2.285e-145
Identity = 300/933 (32.15%), Postives = 465/933 (49.84%), Query Frame = 2
Query: 1256 RKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLH-CYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNP---AIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSP-----EVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHK-------YENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYV-------DNLLVELTEMNPEIFSNQ-------FPKPSAVESGQTS--LESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            R+ D+ P+ D L  FY ++H  +   ++  + T+I +    FF + L G+ +LI+DFI A   V  ++      +  P++E+  LLGS++ F +L         N   + +      K  I+  ++SSA+ EP   AR +++  + +  C  ++   E+    + +  N I + L   +F N  +A ++ +M+  LV+   ++Q   P  P KIIQ+L   I         S    DK+ + SL+  L+DW M LPL  LL+    H+ G         E+   +  ++N +       V   +            NP    +   +   +  DP +    L + +P+     E +S      EV  + Q+  + +AAR  + HL+N++G YP +     L+S V E+HD    ++              +LS E+F +P +Q FV+N + LVS + + S+      ++ PGG         + S  S VR+I+RDL GKY WD A ++         E  + +   S +++   P           + +  SL  K  +   P  D +       D LL  L   +PE             P+P  +   Q +  + ++ K+   E+  VE +  D           L  K +    P    P+     + FY+CR +L+ LG  SW +R S  L++K+   L  L+N+D R+ RETHKIAV YVA GQEDK SIL NT GS  +  F++GLGW VNL NH GFMGGL+ +   G   PY+A ST+E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV+I+IYP++N +F I I  K E+  FGPLFDGA+V  K LP++VRATAINA R ++   P YQ F+ ERA YL+  ++   EP +FEDFA  ++
Sbjct: 1617 RRQDVSPNRDFLTHFYNIMHCGLLHIDQDIVNTIIKHCSPQFFSLGLPGATMLIMDFIVAAGRVASSA-----FLNAPRVEAQVLLGSLVCFPNLYCELPSLHPNIPDVAVSQFTDVKELIIKTVLSSARDEPSGPARCVALCSLGIWICEELVH--ESHHPQIKEALNVICVSL---KFTNKTVAHVACNMLHMLVHYVPRLQIYQPDSPLKIIQILIATITHLLPSTEASSYEMDKRLVVSLLLCLLDWIMALPLKTLLQP--FHATGA--------ESDKTEKSVLNCIYKVLHGCVYGAQ---------CFSNPRYFPMSLSDLASVDYDPFMHLESLKEPEPLHSPDSERSSKLQPVTEVKTQMQHGLISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSEST-------------ELSPELFESPNIQFFVLNNTTLVSCIQIRSE------ENMPGG----GLSAGLASANSNVRIIVRDLSGKYSWDSAILYGPPPVSGLSEPTSFMLSLSHQEKPEEPPTSNECLEDITVKDGLSLQFKRFRETVPTWDTIRDEEDVLDELLQYLGVTSPECLQRTGISLNIPAPQPVCISEKQENDVINAILKQHTEEKEFVEKHFND-----------LNMKAVEQDEPIPQKPQ-----SAFYYCRLLLSILGMNSWDKRRSFHLLKKNEKLLRELRNLDSRQCRETHKIAVFYVAEGQEDKHSILTNTGGSQAYEDFVAGLGWEVNLTNHCGFMGGLQKNKSTGLTTPYFATSTVEVIFHVSTRMPSDSDDSLTKKLRHLGNDEVHIVWSEHTRDYRRGIIPTEFGDVLIVIYPMKNHMFSIQIMKKPEVPFFGPLFDGAIVNGKVLPIMVRATAINASRALKSLIPLYQNFYEERARYLQTIVQHHLEPTTFEDFAAQVF 2481          

HSP 2 Score: 92.4337 bits (228), Expect = 2.285e-145
Identity = 44/176 (25.00%), Postives = 88/176 (50.00%), Query Frame = 3
Query:  735 PAQDTLNDSSRTPTK------HSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            P    L   S+TP+       H  ++ +Q+ +++  + +   D++  S   ++  S             V+ GGT+ GW  +   ++W+R +G+LG++  I +P++   +  Y  EL  +  K+R+N+ I   N  +P+PP+  PP+  + PW+F+   L   +   KL A +++C
Sbjct: 1450 PVHSPLGSRSQTPSPSTLNIDHMEQKDLQLDEKLHHSVLQTPDDLEISEFPSECCS-------------VMAGGTLTGWHADVATVMWRRMLGILGDVNSIMDPEIHAQVFDYLCELWQNLAKIRDNLGISTDNLTSPSPPVLIPPLRILTPWLFKATMLTDKYKQGKLHAYKLIC 1612          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Human
Match: RALGAPA1 (Ral GTPase activating protein catalytic alpha subunit 1 [Source:HGNC Symbol;Acc:HGNC:17770])

HSP 1 Score: 446.047 bits (1146), Expect = 4.755e-145
Identity = 300/930 (32.26%), Postives = 466/930 (50.11%), Query Frame = 2
Query: 1256 RKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLH-CYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSP-----EVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHK-------YENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYV-------DNLLVELTEMNPEIFSNQ-------FPKPSAVESGQTS--LESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            R+ D+ P+ D L  FY ++H  +   ++  + T+I +    FF + L G+ +LI+DFI A   V  ++      +  P++E+  LLGS++ F +L         N   + +      K  I+  ++SSA+ EP   AR +++  + +  C  ++   E+    + +  N I + L   +F N  +A ++ +M+  LV+   ++Q   P  P KIIQ+L   I         S    DK+ + SL+  L+DW M LPL  LL+    H+ G         E+   +  ++N +       V   +   F + R       +   +   +  DP +    L + +P+     E +S      EV  + Q+  + +AAR  + HL+N++G YP +     L+S V E+HD    ++              +LS E+F +P +Q FV+N + LVS + + S+      ++ PGG         + S  S VR+I+RDL GKY WD A ++         E  + +   S +++   P           + +  SL  K  +   P  D +       D LL  L   +PE             P+P  +   Q +  + ++ K+   E+  VE +  D           L  K +    P    P+     + FY+CR +L+ LG  SW +R S  L++K+   L  L+N+D R+ RETHKIAV YVA GQEDK SIL NT GS  +  F++GLGW VNL NH GFMGGL+ +   G   PY+A ST+E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV+I+IYP++N +F I I  K E+  FGPLFDGA+V  K LP++VRATAINA R ++   P YQ F+ ERA YL+  ++   EP +FEDFA  ++
Sbjct: 1205 RRQDVSPNRDFLTHFYNIMHCGLLHIDQDIVNTIIKHCSPQFFSLGLPGATMLIMDFIVAAGRVASSA-----FLNAPRVEAQVLLGSLVCFPNLYCELPSLHPNIPDVAVSQFTDVKELIIKTVLSSARDEPSGPARCVALCSLGIWICEELVH--ESHHPQIKEALNVICVSL---KFTNKTVAHVACNMLHMLVHYVPRLQIYQPDSPLKIIQILIATITHLLPSTEASSYEMDKRLVVSLLLCLLDWIMALPLKTLLQP--FHATGA--------ESDKTEKSVLNCIYKVLHGCVYGAQ--CFSNPRYF----PMSLSDLASVDYDPFMHLESLKEPEPLHSPDSERSSKLQPVTEVKTQMQHGLISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSEST-------------ELSPELFESPNIQFFVLNNTTLVSCIQIRSE------ENMPGG----GLSAGLASANSNVRIIVRDLSGKYSWDSAILYGPPPVSGLSEPTSFMLSLSHQEKPEEPPTSNECLEDITVKDGLSLQFKRFRETVPTWDTIRDEEDVLDELLQYLGVTSPECLQRTGISLNIPAPQPVCISEKQENDVINAILKQHTEEKEFVEKHFND-----------LNMKAVEQDEPIPQKPQ-----SAFYYCRLLLSILGMNSWDKRRSFHLLKKNEKLLRELRNLDSRQCRETHKIAVFYVAEGQEDKHSILTNTGGSQAYEDFVAGLGWEVNLTNHCGFMGGLQKNKSTGLTTPYFATSTVEVIFHVSTRMPSDSDDSLTKKLRHLGNDEVHIVWSEHTRDYRRGIIPTEFGDVLIVIYPMKNHMFSIQIMKKPEVPFFGPLFDGAIVNGKVLPIMVRATAINASRALKSLIPLYQNFYEERARYLQTIVQHHLEPTTFEDFAAQVF 2069          

HSP 2 Score: 91.6633 bits (226), Expect = 4.755e-145
Identity = 44/176 (25.00%), Postives = 88/176 (50.00%), Query Frame = 3
Query:  735 PAQDTLNDSSRTPTK------HSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            P    L   S+TP+       H  ++ +Q+ +++  + +   D++  S   ++  S             V+ GGT+ GW  +   ++W+R +G+LG++  I +P++   +  Y  EL  +  K+R+N+ I   N  +P+PP+  PP+  + PW+F+   L   +   KL A +++C
Sbjct: 1038 PVHSPLGSRSQTPSPSTLNIDHMEQKDLQLDEKLHHSVLQTPDDLEISEFPSECCS-------------VMAGGTLTGWHADVATVMWRRMLGILGDVNSIMDPEIHAQVFDYLCELWQNLAKIRDNLGISTDNLTSPSPPVLIPPLRILTPWLFKATMLTDKYKQGKLHAYKLIC 1200          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Human
Match: RALGAPA1 (Ral GTPase activating protein catalytic alpha subunit 1 [Source:HGNC Symbol;Acc:HGNC:17770])

HSP 1 Score: 446.047 bits (1146), Expect = 5.298e-145
Identity = 301/933 (32.26%), Postives = 466/933 (49.95%), Query Frame = 2
Query: 1256 RKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLH-CYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLS---VDPLVEYPYLFDVKPVEGVTQEVNSP-----EVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHK-------YENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYV-------DNLLVELTEMNPEIFSNQ-------FPKPSAVESGQTS--LESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            R+ D+ P+ D L  FY ++H  +   ++  + T+I +    FF + L G+ +LI+DFI A   V  ++      +  P++E+  LLGS++ F +L         N   + +      K  I+  ++SSA+ EP   AR +++  + +  C  ++   E+    + +  N I + L   +F N  +A ++ +M+  LV+   ++Q   P  P KIIQ+L   I         S    DK+ + SL+  L+DW M LPL  LL+    H+ G         E+   +  ++N +       V   +            NP     + + L+    DP +    L + +P+     E +S      EV  + Q+  + +AAR  + HL+N++G YP +     L+S V E+HD    ++              +LS E+F +P +Q FV+N + LVS + + S+      ++ PGG         + S  S VR+I+RDL GKY WD A ++         E  + +   S +++   P           + +  SL  K  +   P  D +       D LL  L   +PE             P+P  +   Q +  + ++ K+   E+  VE +  D           L  K +    P    P+     + FY+CR +L+ LG  SW +R S  L++K+   L  L+N+D R+ RETHKIAV YVA GQEDK SIL NT GS  +  F++GLGW VNL NH GFMGGL+ +   G   PY+A ST+E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV+I+IYP++N +F I I  K E+  FGPLFDGA+V  K LP++VRATAINA R ++   P YQ F+ ERA YL+  ++   EP +FEDFA  ++
Sbjct: 1158 RRQDVSPNRDFLTHFYNIMHCGLLHIDQDIVNTIIKHCSPQFFSLGLPGATMLIMDFIVAAGRVASSA-----FLNAPRVEAQVLLGSLVCFPNLYCELPSLHPNIPDVAVSQFTDVKELIIKTVLSSARDEPSGPARCVALCSLGIWICEELVH--ESHHPQIKEALNVICVSL---KFTNKTVAHVACNMLHMLVHYVPRLQIYQPDSPLKIIQILIATITHLLPSTEASSYEMDKRLVVSLLLCLLDWIMALPLKTLLQP--FHATGA--------ESDKTEKSVLNCIYKVLHGCVYGAQ---------CFSNPRYFPMSLSDLASVDYDPFMHLESLKEPEPLHSPDSERSSKLQPVTEVKTQMQHGLISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSEST-------------ELSPELFESPNIQFFVLNNTTLVSCIQIRSE------ENMPGG----GLSAGLASANSNVRIIVRDLSGKYSWDSAILYGPPPVSGLSEPTSFMLSLSHQEKPEEPPTSNECLEDITVKDGLSLQFKRFRETVPTWDTIRDEEDVLDELLQYLGVTSPECLQRTGISLNIPAPQPVCISEKQENDVINAILKQHTEEKEFVEKHFND-----------LNMKAVEQDEPIPQKPQ-----SAFYYCRLLLSILGMNSWDKRRSFHLLKKNEKLLRELRNLDSRQCRETHKIAVFYVAEGQEDKHSILTNTGGSQAYEDFVAGLGWEVNLTNHCGFMGGLQKNKSTGLTTPYFATSTVEVIFHVSTRMPSDSDDSLTKKLRHLGNDEVHIVWSEHTRDYRRGIIPTEFGDVLIVIYPMKNHMFSIQIMKKPEVPFFGPLFDGAIVNGKVLPIMVRATAINASRALKSLIPLYQNFYEERARYLQTIVQHHLEPTTFEDFAAQVF 2022          

HSP 2 Score: 91.6633 bits (226), Expect = 5.298e-145
Identity = 44/176 (25.00%), Postives = 88/176 (50.00%), Query Frame = 3
Query:  735 PAQDTLNDSSRTPTK------HSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            P    L   S+TP+       H  ++ +Q+ +++  + +   D++  S   ++  S             V+ GGT+ GW  +   ++W+R +G+LG++  I +P++   +  Y  EL  +  K+R+N+ I   N  +P+PP+  PP+  + PW+F+   L   +   KL A +++C
Sbjct:  991 PVHSPLGSRSQTPSPSTLNIDHMEQKDLQLDEKLHHSVLQTPDDLEISEFPSECCS-------------VMAGGTLTGWHADVATVMWRRMLGILGDVNSIMDPEIHAQVFDYLCELWQNLAKIRDNLGISTDNLTSPSPPVLIPPLRILTPWLFKATMLTDKYKQGKLHAYKLIC 1153          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Human
Match: RALGAPA1 (Ral GTPase activating protein catalytic alpha subunit 1 [Source:HGNC Symbol;Acc:HGNC:17770])

HSP 1 Score: 445.662 bits (1145), Expect = 6.310e-145
Identity = 301/933 (32.26%), Postives = 466/933 (49.95%), Query Frame = 2
Query: 1256 RKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLH-CYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLS---VDPLVEYPYLFDVKPVEGVTQEVNSP-----EVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHK-------YENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYV-------DNLLVELTEMNPEIFSNQ-------FPKPSAVESGQTS--LESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            R+ D+ P+ D L  FY ++H  +   ++  + T+I +    FF + L G+ +LI+DFI A   V  ++      +  P++E+  LLGS++ F +L         N   + +      K  I+  ++SSA+ EP   AR +++  + +  C  ++   E+    + +  N I + L   +F N  +A ++ +M+  LV+   ++Q   P  P KIIQ+L   I         S    DK+ + SL+  L+DW M LPL  LL+    H+ G         E+   +  ++N +       V   +            NP     + + L+    DP +    L + +P+     E +S      EV  + Q+  + +AAR  + HL+N++G YP +     L+S V E+HD    ++              +LS E+F +P +Q FV+N + LVS + + S+      ++ PGG         + S  S VR+I+RDL GKY WD A ++         E  + +   S +++   P           + +  SL  K  +   P  D +       D LL  L   +PE             P+P  +   Q +  + ++ K+   E+  VE +  D           L  K +    P    P+     + FY+CR +L+ LG  SW +R S  L++K+   L  L+N+D R+ RETHKIAV YVA GQEDK SIL NT GS  +  F++GLGW VNL NH GFMGGL+ +   G   PY+A ST+E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV+I+IYP++N +F I I  K E+  FGPLFDGA+V  K LP++VRATAINA R ++   P YQ F+ ERA YL+  ++   EP +FEDFA  ++
Sbjct: 1171 RRQDVSPNRDFLTHFYNIMHCGLLHIDQDIVNTIIKHCSPQFFSLGLPGATMLIMDFIVAAGRVASSA-----FLNAPRVEAQVLLGSLVCFPNLYCELPSLHPNIPDVAVSQFTDVKELIIKTVLSSARDEPSGPARCVALCSLGIWICEELVH--ESHHPQIKEALNVICVSL---KFTNKTVAHVACNMLHMLVHYVPRLQIYQPDSPLKIIQILIATITHLLPSTEASSYEMDKRLVVSLLLCLLDWIMALPLKTLLQP--FHATGA--------ESDKTEKSVLNCIYKVLHGCVYGAQ---------CFSNPRYFPMSLSDLASVDYDPFMHLESLKEPEPLHSPDSERSSKLQPVTEVKTQMQHGLISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSEST-------------ELSPELFESPNIQFFVLNNTTLVSCIQIRSE------ENMPGG----GLSAGLASANSNVRIIVRDLSGKYSWDSAILYGPPPVSGLSEPTSFMLSLSHQEKPEEPPTSNECLEDITVKDGLSLQFKRFRETVPTWDTIRDEEDVLDELLQYLGVTSPECLQRTGISLNIPAPQPVCISEKQENDVINAILKQHTEEKEFVEKHFND-----------LNMKAVEQDEPIPQKPQ-----SAFYYCRLLLSILGMNSWDKRRSFHLLKKNEKLLRELRNLDSRQCRETHKIAVFYVAEGQEDKHSILTNTGGSQAYEDFVAGLGWEVNLTNHCGFMGGLQKNKSTGLTTPYFATSTVEVIFHVSTRMPSDSDDSLTKKLRHLGNDEVHIVWSEHTRDYRRGIIPTEFGDVLIVIYPMKNHMFSIQIMKKPEVPFFGPLFDGAIVNGKVLPIMVRATAINASRALKSLIPLYQNFYEERARYLQTIVQHHLEPTTFEDFAAQVF 2035          

HSP 2 Score: 91.6633 bits (226), Expect = 6.310e-145
Identity = 44/176 (25.00%), Postives = 88/176 (50.00%), Query Frame = 3
Query:  735 PAQDTLNDSSRTPTK------HSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            P    L   S+TP+       H  ++ +Q+ +++  + +   D++  S   ++  S             V+ GGT+ GW  +   ++W+R +G+LG++  I +P++   +  Y  EL  +  K+R+N+ I   N  +P+PP+  PP+  + PW+F+   L   +   KL A +++C
Sbjct: 1004 PVHSPLGSRSQTPSPSTLNIDHMEQKDLQLDEKLHHSVLQTPDDLEISEFPSECCS-------------VMAGGTLTGWHADVATVMWRRMLGILGDVNSIMDPEIHAQVFDYLCELWQNLAKIRDNLGISTDNLTSPSPPVLIPPLRILTPWLFKATMLTDKYKQGKLHAYKLIC 1166          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Celegans
Match: hgap-1 (Heterodimeric GTPase Activating Protein subunit [Source:UniProtKB/TrEMBL;Acc:V6CJZ0])

HSP 1 Score: 166.007 bits (419), Expect = 1.947e-42
Identity = 103/271 (38.01%), Postives = 141/271 (52.03%), Query Frame = 2
Query: 3161 TLNTKFYFCRQILTQLGFLSWKRRASIDLVQK--SNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTT--GSLEFNTFISGLGWTVNL-ENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRD-YRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            T N K    R +   LGF        + LV +  +N    LK++DQ   RE HK+AV+YV   QED+ SIL NTT   S +F++F S LGW V +   H G+ GGL    R    APY+A++  E++FHVST +     GD   K+KH+GNDEV V+W+EN R  Y      T F DV+I++  + + +  + + T + +  FGPLFDGA+V   EL  LVR T INA R  R  R  +      R            +PM       H+Y
Sbjct:  352 TPNAKLLEWRSLSASLGF--------VPLVSQVHANFPRDLKHLDQTSSREVHKVAVIYVGESQEDRASILSNTTASASAQFDSFTSELGWEVKVGRGHDGYTGGLPVETR----APYFADAEAEVIFHVSTML----NGDVQQKWKHIGNDEVHVVWTENTRKVYTRETIATKFCDVLIVLEQVGDKMVRVRVDTASALE-FGPLFDGALVTMSELSQLVRLTVINASRAYRLARVEHSRPLRHREEVFCNEALAHMKPMPLAQSINHLY 605          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Celegans
Match: hgap-1 (Heterodimeric GTPase Activating Protein subunit [Source:UniProtKB/TrEMBL;Acc:V6CJZ0])

HSP 1 Score: 166.392 bits (420), Expect = 7.023e-42
Identity = 103/271 (38.01%), Postives = 141/271 (52.03%), Query Frame = 2
Query: 3161 TLNTKFYFCRQILTQLGFLSWKRRASIDLVQK--SNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTT--GSLEFNTFISGLGWTVNL-ENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRD-YRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            T N K    R +   LGF        + LV +  +N    LK++DQ   RE HK+AV+YV   QED+ SIL NTT   S +F++F S LGW V +   H G+ GGL    R    APY+A++  E++FHVST +     GD   K+KH+GNDEV V+W+EN R  Y      T F DV+I++  + + +  + + T + +  FGPLFDGA+V   EL  LVR T INA R  R  R  +      R            +PM       H+Y
Sbjct:  491 TPNAKLLEWRSLSASLGF--------VPLVSQVHANFPRDLKHLDQTSSREVHKVAVIYVGESQEDRASILSNTTASASAQFDSFTSELGWEVKVGRGHDGYTGGLPVETR----APYFADAEAEVIFHVSTML----NGDVQQKWKHIGNDEVHVVWTENTRKVYTRETIATKFCDVLIVLEQVGDKMVRVRVDTASALE-FGPLFDGALVTMSELSQLVRLTVINASRAYRLARVEHSRPLRHREEVFCNEALAHMKPMPLAQSINHLY 744          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Celegans
Match: hgap-1 (Heterodimeric GTPase Activating Protein subunit [Source:UniProtKB/TrEMBL;Acc:V6CJZ0])

HSP 1 Score: 166.777 bits (421), Expect = 1.847e-41
Identity = 103/271 (38.01%), Postives = 141/271 (52.03%), Query Frame = 2
Query: 3161 TLNTKFYFCRQILTQLGFLSWKRRASIDLVQK--SNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTT--GSLEFNTFISGLGWTVNL-ENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRD-YRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            T N K    R +   LGF        + LV +  +N    LK++DQ   RE HK+AV+YV   QED+ SIL NTT   S +F++F S LGW V +   H G+ GGL    R    APY+A++  E++FHVST +     GD   K+KH+GNDEV V+W+EN R  Y      T F DV+I++  + + +  + + T + +  FGPLFDGA+V   EL  LVR T INA R  R  R  +      R            +PM       H+Y
Sbjct:  710 TPNAKLLEWRSLSASLGF--------VPLVSQVHANFPRDLKHLDQTSSREVHKVAVIYVGESQEDRASILSNTTASASAQFDSFTSELGWEVKVGRGHDGYTGGLPVETR----APYFADAEAEVIFHVSTML----NGDVQQKWKHIGNDEVHVVWTENTRKVYTRETIATKFCDVLIVLEQVGDKMVRVRVDTASALE-FGPLFDGALVTMSELSQLVRLTVINASRAYRLARVEHSRPLRHREEVFCNEALAHMKPMPLAQSINHLY 963          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Celegans
Match: hgap-1 (Heterodimeric GTPase Activating Protein subunit [Source:UniProtKB/TrEMBL;Acc:V6CJZ0])

HSP 1 Score: 165.236 bits (417), Expect = 9.193e-41
Identity = 103/271 (38.01%), Postives = 141/271 (52.03%), Query Frame = 2
Query: 3161 TLNTKFYFCRQILTQLGFLSWKRRASIDLVQK--SNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTT--GSLEFNTFISGLGWTVNL-ENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRD-YRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            T N K    R +   LGF        + LV +  +N    LK++DQ   RE HK+AV+YV   QED+ SIL NTT   S +F++F S LGW V +   H G+ GGL    R    APY+A++  E++FHVST +     GD   K+KH+GNDEV V+W+EN R  Y      T F DV+I++  + + +  + + T + +  FGPLFDGA+V   EL  LVR T INA R  R  R  +      R            +PM       H+Y
Sbjct: 1049 TPNAKLLEWRSLSASLGF--------VPLVSQVHANFPRDLKHLDQTSSREVHKVAVIYVGESQEDRASILSNTTASASAQFDSFTSELGWEVKVGRGHDGYTGGLPVETR----APYFADAEAEVIFHVSTML----NGDVQQKWKHIGNDEVHVVWTENTRKVYTRETIATKFCDVLIVLEQVGDKMVRVRVDTASALE-FGPLFDGALVTMSELSQLVRLTVINASRAYRLARVEHSRPLRHREEVFCNEALAHMKPMPLAQSINHLY 1302          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Celegans
Match: hgap-1 (Heterodimeric GTPase Activating Protein subunit [Source:UniProtKB/TrEMBL;Acc:V6CJZ0])

HSP 1 Score: 165.236 bits (417), Expect = 9.404e-41
Identity = 103/271 (38.01%), Postives = 141/271 (52.03%), Query Frame = 2
Query: 3161 TLNTKFYFCRQILTQLGFLSWKRRASIDLVQK--SNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTT--GSLEFNTFISGLGWTVNL-ENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRD-YRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            T N K    R +   LGF        + LV +  +N    LK++DQ   RE HK+AV+YV   QED+ SIL NTT   S +F++F S LGW V +   H G+ GGL    R    APY+A++  E++FHVST +     GD   K+KH+GNDEV V+W+EN R  Y      T F DV+I++  + + +  + + T + +  FGPLFDGA+V   EL  LVR T INA R  R  R  +      R            +PM       H+Y
Sbjct:  931 TPNAKLLEWRSLSASLGF--------VPLVSQVHANFPRDLKHLDQTSSREVHKVAVIYVGESQEDRASILSNTTASASAQFDSFTSELGWEVKVGRGHDGYTGGLPVETR----APYFADAEAEVIFHVSTML----NGDVQQKWKHIGNDEVHVVWTENTRKVYTRETIATKFCDVLIVLEQVGDKMVRVRVDTASALE-FGPLFDGALVTMSELSQLVRLTVINASRAYRLARVEHSRPLRHREEVFCNEALAHMKPMPLAQSINHLY 1184          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Fly
Match: CG5521 (gene:FBgn0039466 transcript:FBtr0085069)

HSP 1 Score: 311.997 bits (798), Expect = 6.660e-86
Identity = 199/576 (34.55%), Postives = 304/576 (52.78%), Query Frame = 2
Query: 2315 PEVTFRSQYEFVKLAARVALC------HLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHS-KLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENN-------NVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLN-LKVLKPEKPVIDYVDNLLVELTEMNPEIFS---NQFPKPSAVE-SGQTSLESLS---KRQIIEQSIVENNLFDNHHCLK--ISHPKLVEKKLRSF----VPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            PE T+++     K    + LC      HL+ +IG +P       LSS V+E  D       ++  G  E          V +   +Q+F++N  ++ SF+ L + KL        PGG  IT     + + + +VR+++RDL GK CWD + ++    N           + S+  ++M  S       P +    +    L + K   P +D +D++L  +   +PE  +   +Q   P+A   SG    +++S    ++++EQ  V ++       L+   S+  L +   RS       +++ P  T +   F +CR + + LG   W+RR+   L+Q+S   +  L+N+D ++ RETHK+AV+YVA GQEDK SIL NT+GS  +  F+S LGW ++LE H GF+GGL   G  G  APYYA   LE+++HV+T MPS++      K +HLGNDEV ++WSE+ RDYR  I  T F DV+I++YPLRNGLF + +  K E+  FGPL + +VV    L  L+RATAINA R  R   P YQ+F+ ER   L+     + E  +FEDFA  IY
Sbjct: 1281 PEATYQTSETIQKCITAIKLCAKAVSMHLVTHIGHFPMGIGASRLSSMVEEQDDI----GNAAYGGQVETRRDSVELPSVVSAQNMQLFMLNSGLVASFIELPTLKL--------PGGG-IT---AGLVTADKQVRVLMRDLNGKACWDASILYSEPRNAEEPPKTTPKIQHSQPLDSMATSMVTHTPSPRHTLRHRPAGVLPLAKDMAPDLDQLDDMLAYIGHTSPECVAPTVSQLNAPTASPLSGNQEAQAISVILNQRLLEQEFVTHSTQAPSPALRHASSNSSLQQPDQRSLHSTTASFDSLPTRTEM--PFQYCRLLFSHLGLAGWERRSRTHLLQRSEKLMRELRNVDLQKCRETHKMAVIYVAAGQEDKGSILRNTSGSSTYEMFVSALGWEIDLETHNGFLGGLPRQG-CGATAPYYATPFLEVVYHVATRMPSDSSEAMLLKTRHLGNDEVHIVWSEHNRDYRRDILPTEFCDVLIVVYPLRNGLFRVTVNRKPEVPWFGPLANESVVSGACLATLIRATAINASRTKRAALPLYQQFYEERNRSLDSVSSRYKESTTFEDFASRIY 1837          

HSP 2 Score: 84.7297 bits (208), Expect = 6.430e-16
Identity = 40/108 (37.04%), Postives = 63/108 (58.33%), Query Frame = 3
Query:  924 VLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVT-PTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            ++LGG+  GW  +S  ++WKR +G LG++  I    +   +  + LE+T + IK+++N  I   NQ T P PPL  PPI  + PW +    LD +F   KL A+++LC
Sbjct:  841 IILGGSAEGWHPDSTSIMWKRMLGALGDVNRIPKADLHAQVFMHLLEMTQNLIKIKQNQGISTDNQNTQPMPPL-VPPIGIVAPWCYGSLSLDRSFKKGKLWALQLLC 947          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Fly
Match: CG5521 (gene:FBgn0039466 transcript:FBtr0301134)

HSP 1 Score: 311.612 bits (797), Expect = 8.267e-86
Identity = 199/576 (34.55%), Postives = 304/576 (52.78%), Query Frame = 2
Query: 2315 PEVTFRSQYEFVKLAARVALC------HLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHS-KLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENN-------NVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLN-LKVLKPEKPVIDYVDNLLVELTEMNPEIFS---NQFPKPSAVE-SGQTSLESLS---KRQIIEQSIVENNLFDNHHCLK--ISHPKLVEKKLRSF----VPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            PE T+++     K    + LC      HL+ +IG +P       LSS V+E  D       ++  G  E          V +   +Q+F++N  ++ SF+ L + KL        PGG  IT     + + + +VR+++RDL GK CWD + ++    N           + S+  ++M  S       P +    +    L + K   P +D +D++L  +   +PE  +   +Q   P+A   SG    +++S    ++++EQ  V ++       L+   S+  L +   RS       +++ P  T +   F +CR + + LG   W+RR+   L+Q+S   +  L+N+D ++ RETHK+AV+YVA GQEDK SIL NT+GS  +  F+S LGW ++LE H GF+GGL   G  G  APYYA   LE+++HV+T MPS++      K +HLGNDEV ++WSE+ RDYR  I  T F DV+I++YPLRNGLF + +  K E+  FGPL + +VV    L  L+RATAINA R  R   P YQ+F+ ER   L+     + E  +FEDFA  IY
Sbjct: 1287 PEATYQTSETIQKCITAIKLCAKAVSMHLVTHIGHFPMGIGASRLSSMVEEQDDI----GNAAYGGQVETRRDSVELPSVVSAQNMQLFMLNSGLVASFIELPTLKL--------PGGG-IT---AGLVTADKQVRVLMRDLNGKACWDASILYSEPRNAEEPPKTTPKIQHSQPLDSMATSMVTHTPSPRHTLRHRPAGVLPLAKDMAPDLDQLDDMLAYIGHTSPECVAPTVSQLNAPTASPLSGNQEAQAISVILNQRLLEQEFVTHSTQAPSPALRHASSNSSLQQPDQRSLHSTTASFDSLPTRTEM--PFQYCRLLFSHLGLAGWERRSRTHLLQRSEKLMRELRNVDLQKCRETHKMAVIYVAAGQEDKGSILRNTSGSSTYEMFVSALGWEIDLETHNGFLGGLPRQG-CGATAPYYATPFLEVVYHVATRMPSDSSEAMLLKTRHLGNDEVHIVWSEHNRDYRRDILPTEFCDVLIVVYPLRNGLFRVTVNRKPEVPWFGPLANESVVSGACLATLIRATAINASRTKRAALPLYQQFYEERNRSLDSVSSRYKESTTFEDFASRIY 1843          

HSP 2 Score: 84.7297 bits (208), Expect = 6.434e-16
Identity = 40/108 (37.04%), Postives = 63/108 (58.33%), Query Frame = 3
Query:  924 VLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVT-PTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            ++LGG+  GW  +S  ++WKR +G LG++  I    +   +  + LE+T + IK+++N  I   NQ T P PPL  PPI  + PW +    LD +F   KL A+++LC
Sbjct:  847 IILGGSAEGWHPDSTSIMWKRMLGALGDVNRIPKADLHAQVFMHLLEMTQNLIKIKQNQGISTDNQNTQPMPPL-VPPIGIVAPWCYGSLSLDRSFKKGKLWALQLLC 953          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Fly
Match: gig (gene:FBgn0005198 transcript:FBtr0074819)

HSP 1 Score: 92.8189 bits (229), Expect = 2.151e-18
Identity = 60/180 (33.33%), Postives = 96/180 (53.33%), Query Frame = 2
Query: 3305 ETHKIAVLYVAWGQEDKE-SILGNTTGSLEFNTFISGLGWTVNLEN--HKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPN---KFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINA 3826
            ETHKI VLYV  GQ + E  IL N+ GS  +  F+  +G  V+L+          L+ +G +G FA  + +  L++ FHV+T MP+ N  D PN   K  H+GND V +I++E+  +Y  +     F    +I+ PL      + +K ++EI  F    +  +V ++  P+L R  A++A
Sbjct: 1596 ETHKIGVLYVGQGQCNNEVEILRNSHGSARYVEFLRNIGTLVSLKEAEQNNLFIMLDRNGADGKFAYIWKDDILQVTFHVATLMPT-NLQDDPNCNEKKSHIGNDFVKIIYNESGEEYNLNTISGQFNYACVIVEPLDLNSNRVYVKARSEISKFVCHAEYRIVSDRSAPLLARQMALHA 1774          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Fly
Match: gig (gene:FBgn0005198 transcript:FBtr0332690)

HSP 1 Score: 92.8189 bits (229), Expect = 2.224e-18
Identity = 60/180 (33.33%), Postives = 96/180 (53.33%), Query Frame = 2
Query: 3305 ETHKIAVLYVAWGQEDKE-SILGNTTGSLEFNTFISGLGWTVNLEN--HKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPN---KFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINA 3826
            ETHKI VLYV  GQ + E  IL N+ GS  +  F+  +G  V+L+          L+ +G +G FA  + +  L++ FHV+T MP+ N  D PN   K  H+GND V +I++E+  +Y  +     F    +I+ PL      + +K ++EI  F    +  +V ++  P+L R  A++A
Sbjct: 1593 ETHKIGVLYVGQGQCNNEVEILRNSHGSARYVEFLRNIGTLVSLKEAEQNNLFIMLDRNGADGKFAYIWKDDILQVTFHVATLMPT-NLQDDPNCNEKKSHIGNDFVKIIYNESGEEYNLNTISGQFNYACVIVEPLDLNSNRVYVKARSEISKFVCHAEYRIVSDRSAPLLARQMALHA 1771          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Fly
Match: RapGAP1 (gene:FBgn0264895 transcript:FBtr0334848)

HSP 1 Score: 87.8113 bits (216), Expect = 4.503e-17
Identity = 49/164 (29.88%), Postives = 83/164 (50.61%), Query Frame = 2
Query: 3314 KIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLE-SSGRNGFFAPYYANSTLEIMFHVSTWMP-SENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLR----NGLFGINIKTKTEIMLFGPLFDGAVVGEK 3787
            K  VLY  +GQ  +E + GN   S  F+ F+  LG  + L++HKG+ GGL+  +G  G  A Y      EIMFHVST +P +E    +  + +H+GND V +++ E    +   +  + F    I++ P+     +  + +++  + ++  FGP      V  K
Sbjct:  360 KFGVLYQRYGQTTEEELFGNQQTSPAFDEFLDVLGQRIRLKDHKGYRGGLDIQNGHTGDTAVYEVFKEREIMFHVSTLLPHTEGDPQQLQRKRHIGNDIVAIVFQETNTPFSPDMIASHFLHAFIVVQPIEPNTPHTRYKVSVTARDDVPFFGPTLPNPAVFRK 523          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Zebrafish
Match: ralgapa2 (Ral GTPase activating protein, alpha subunit 2 (catalytic) [Source:ZFIN;Acc:ZDB-GENE-131122-56])

HSP 1 Score: 440.269 bits (1131), Expect = 6.695e-141
Identity = 302/932 (32.40%), Postives = 466/932 (50.00%), Query Frame = 2
Query: 1229 NAYPL--QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINI-IDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLES------NDLHSKG--LIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFE-----SKRTSMKNPAIH--QGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSN---QFPKPSAVESGQT-SLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQK-SNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
             AY L  ++  +  D+ P+ D L   Y ++H    S+++  + T+I      FF + L G  +L+ DFI A   +L T        E P++E+ ++LGS++ F +L        +   + +I +     K  +VNIL+ +A+ E    AR ++I  + L     L   ET     + +++ I +L   ++F N  +A ++ D+ + L++    +Q   P +P++II++    +         S    DKK + SL+  L+DW M +PLS LLE       +D  S+   L+   +  L   +  +++    + S  L   ++  T +E         S + PAIH   G+F  L                       +   E   R   E + L AR+ + HL+N++G +P +     L+S + E+HD   V++              +LS EVF +P LQ+FV N S L+S++ + S  + +         P++    D     SEVR+IIRD+ GKY WD   + +  +   +  SS+ +E             +   ++ S  L V    +  +D +D LL +L   +PE       +  +P +   G    +E L    +  QS  E          +I  P +  ++ +   P    P+     + FY CR +L  LG  SW RR S  L++K S +   LKN+D R+ RETHKIAV Y+  GQEDK SIL NT GS  +  F+SGLGW VNL  H GFMGGL+ +G  G  APYYA S +E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV++IIYP++N +F + I  K ++  FGPLFDGA+V  + LP LVRAT INA R ++   P YQ F+ ERA YLE  I+   E M+FEDFA  ++
Sbjct: 1093 QAYKLICEMMTKHQDVLPNSDFLVHLYHVMHKGFTSDDQDVLNTMIRWCSPRFFFLGLPGFTMLVGDFITAAARILNTD-----SFEAPRVEAQAVLGSLVCFPNLYQQIPSLQSVPGSEDILVGKEDMKDYLVNILLKTARSETCEGARCVAICGLGLWVCEELRQTETH----HQVKDAINVLGVTLKFGNKVVANVACDIFQLLISHWQHLQRLEPSLPKRIIEIFVATVAFLLPSAEHSTVEADKKLMVSLLLCLLDWCMSVPLSILLEPITMPVLDDPTSQKAPLLDYIYRVLHTCVSGSNLHT--QQSHYLLSLADLSTDYEPFLMLGNVKSFEPPAIHNAMGDFGNL-----------------------LTVAEEKKRRSMELIPLTARMVMTHLVNHLGHHPLSGGPALLNSLISENHDNPYVESS-------------ELSSEVFKSPNLQLFVFNDSTLISYLQIPSDNSNT--------APLSANPRD---HSSEVRIIIRDISGKYSWDSGVLFRTLDGTGV-TSSDSREQSSHEAARLEKRSSVRFSKCSSELDV----EDGVDVLDQLLEDLGHSSPECLPEPQLRLTQPPSPPMGMNLEIEGLIMEAVHRQSKQEEEELMRR---QIEDPSVRAERQKE--PTHQEPK-----SPFYLCRLLLNDLGMNSWDRRKSFHLLKKNSKLLRELKNLDSRQCRETHKIAVFYIGEGQEDKYSILSNTQGSQVYEDFVSGLGWEVNLATHCGFMGGLQRNGSTGSTAPYYATSNVEVIFHVSTRMPSDSDDSITKKLRHLGNDEVHIVWSEHTRDYRRGIIPTDFGDVLVIIYPMKNHMFFVQIMKKPQVPFFGPLFDGAIVTGELLPSLVRATCINASRAVKSRLPLYQSFYEERALYLEAIIQNHKENMTFEDFAAQVF 1951          

HSP 2 Score: 83.1889 bits (204), Expect = 6.695e-141
Identity = 36/125 (28.80%), Postives = 69/125 (55.20%), Query Frame = 3
Query:  873 QDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1247
            Q L +    +DD++   ++ GG++ GW  +S  +LW+R +G+LG++  I+  ++   +  Y  EL     K+R+N+ I   +      PL+ PP+  +  W+F+   L S F + KL A +++C+
Sbjct:  979 QHLDSSEFLADDIS---IIAGGSLTGWHADSAFVLWRRILGILGDVNSIRCARIHAKVFSYLYELWHKLAKIRDNLGIRVDSDTAMVKPLFIPPLRMLASWLFKATMLPSEFKAGKLQAYKLICE 1100          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Zebrafish
Match: ralgapa2 (Ral GTPase activating protein, alpha subunit 2 (catalytic) [Source:ZFIN;Acc:ZDB-GENE-131122-56])

HSP 1 Score: 440.269 bits (1131), Expect = 7.523e-141
Identity = 302/932 (32.40%), Postives = 466/932 (50.00%), Query Frame = 2
Query: 1229 NAYPL--QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINI-IDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLES------NDLHSKG--LIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFE-----SKRTSMKNPAIH--QGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSN---QFPKPSAVESGQT-SLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQK-SNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
             AY L  ++  +  D+ P+ D L   Y ++H    S+++  + T+I      FF + L G  +L+ DFI A   +L T        E P++E+ ++LGS++ F +L        +   + +I +     K  +VNIL+ +A+ E    AR ++I  + L     L   ET     + +++ I +L   ++F N  +A ++ D+ + L++    +Q   P +P++II++    +         S    DKK + SL+  L+DW M +PLS LLE       +D  S+   L+   +  L   +  +++    + S  L   ++  T +E         S + PAIH   G+F  L                       +   E   R   E + L AR+ + HL+N++G +P +     L+S + E+HD   V++              +LS EVF +P LQ+FV N S L+S++ + S  + +         P++    D     SEVR+IIRD+ GKY WD   + +  +   +  SS+ +E             +   ++ S  L V    +  +D +D LL +L   +PE       +  +P +   G    +E L    +  QS  E          +I  P +  ++ +   P    P+     + FY CR +L  LG  SW RR S  L++K S +   LKN+D R+ RETHKIAV Y+  GQEDK SIL NT GS  +  F+SGLGW VNL  H GFMGGL+ +G  G  APYYA S +E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV++IIYP++N +F + I  K ++  FGPLFDGA+V  + LP LVRAT INA R ++   P YQ F+ ERA YLE  I+   E M+FEDFA  ++
Sbjct: 1045 QAYKLICEMMTKHQDVLPNSDFLVHLYHVMHKGFTSDDQDVLNTMIRWCSPRFFFLGLPGFTMLVGDFITAAARILNTD-----SFEAPRVEAQAVLGSLVCFPNLYQQIPSLQSVPGSEDILVGKEDMKDYLVNILLKTARSETCEGARCVAICGLGLWVCEELRQTETH----HQVKDAINVLGVTLKFGNKVVANVACDIFQLLISHWQHLQRLEPSLPKRIIEIFVATVAFLLPSAEHSTVEADKKLMVSLLLCLLDWCMSVPLSILLEPITMPVLDDPTSQKAPLLDYIYRVLHTCVSGSNLHT--QQSHYLLSLADLSTDYEPFLMLGNVKSFEPPAIHNAMGDFGNL-----------------------LTVAEEKKRRSMELIPLTARMVMTHLVNHLGHHPLSGGPALLNSLISENHDNPYVESS-------------ELSSEVFKSPNLQLFVFNDSTLISYLQIPSDNSNT--------APLSANPRD---HSSEVRIIIRDISGKYSWDSGVLFRTLDGTGV-TSSDSREQSSHEAARLEKRSSVRFSKCSSELDV----EDGVDVLDQLLEDLGHSSPECLPEPQLRLTQPPSPPMGMNLEIEGLIMEAVHRQSKQEEEELMRR---QIEDPSVRAERQKE--PTHQEPK-----SPFYLCRLLLNDLGMNSWDRRKSFHLLKKNSKLLRELKNLDSRQCRETHKIAVFYIGEGQEDKYSILSNTQGSQVYEDFVSGLGWEVNLATHCGFMGGLQRNGSTGSTAPYYATSNVEVIFHVSTRMPSDSDDSITKKLRHLGNDEVHIVWSEHTRDYRRGIIPTDFGDVLVIIYPMKNHMFFVQIMKKPQVPFFGPLFDGAIVTGELLPSLVRATCINASRAVKSRLPLYQSFYEERALYLEAIIQNHKENMTFEDFAAQVF 1903          

HSP 2 Score: 83.1889 bits (204), Expect = 7.523e-141
Identity = 36/125 (28.80%), Postives = 69/125 (55.20%), Query Frame = 3
Query:  873 QDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1247
            Q L +    +DD++   ++ GG++ GW  +S  +LW+R +G+LG++  I+  ++   +  Y  EL     K+R+N+ I   +      PL+ PP+  +  W+F+   L S F + KL A +++C+
Sbjct:  931 QHLDSSEFLADDIS---IIAGGSLTGWHADSAFVLWRRILGILGDVNSIRCARIHAKVFSYLYELWHKLAKIRDNLGIRVDSDTAMVKPLFIPPLRMLASWLFKATMLPSEFKAGKLQAYKLICE 1052          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Zebrafish
Match: ralgapa2 (Ral GTPase activating protein, alpha subunit 2 (catalytic) [Source:ZFIN;Acc:ZDB-GENE-131122-56])

HSP 1 Score: 439.884 bits (1130), Expect = 1.179e-140
Identity = 302/932 (32.40%), Postives = 466/932 (50.00%), Query Frame = 2
Query: 1229 NAYPL--QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINI-IDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLES------NDLHSKG--LIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFE-----SKRTSMKNPAIH--QGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSN---QFPKPSAVESGQT-SLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQK-SNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
             AY L  ++  +  D+ P+ D L   Y ++H    S+++  + T+I      FF + L G  +L+ DFI A   +L T        E P++E+ ++LGS++ F +L        +   + +I +     K  +VNIL+ +A+ E    AR ++I  + L     L   ET     + +++ I +L   ++F N  +A ++ D+ + L++    +Q   P +P++II++    +         S    DKK + SL+  L+DW M +PLS LLE       +D  S+   L+   +  L   +  +++    + S  L   ++  T +E         S + PAIH   G+F  L                       +   E   R   E + L AR+ + HL+N++G +P +     L+S + E+HD   V++              +LS EVF +P LQ+FV N S L+S++ + S  + +         P++    D     SEVR+IIRD+ GKY WD   + +  +   +  SS+ +E             +   ++ S  L V    +  +D +D LL +L   +PE       +  +P +   G    +E L    +  QS  E          +I  P +  ++ +   P    P+     + FY CR +L  LG  SW RR S  L++K S +   LKN+D R+ RETHKIAV Y+  GQEDK SIL NT GS  +  F+SGLGW VNL  H GFMGGL+ +G  G  APYYA S +E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV++IIYP++N +F + I  K ++  FGPLFDGA+V  + LP LVRAT INA R ++   P YQ F+ ERA YLE  I+   E M+FEDFA  ++
Sbjct: 1093 QAYKLICEMMTKHQDVLPNSDFLVHLYHVMHKGFTSDDQDVLNTMIRWCSPRFFFLGLPGFTMLVGDFITAAARILNTD-----SFEAPRVEAQAVLGSLVCFPNLYQQIPSLQSVPGSEDILVGKEDMKDYLVNILLKTARSETCEGARCVAICGLGLWVCEELRQTETH----HQVKDAINVLGVTLKFGNKVVANVACDIFQLLISHWQHLQRLEPSLPKRIIEIFVATVAFLLPSAEHSTVEADKKLMVSLLLCLLDWCMSVPLSILLEPITMPVLDDPTSQKAPLLDYIYRVLHTCVSGSNLHT--QQSHYLLSLADLSTDYEPFLMLGNVKSFEPPAIHNAMGDFGNL-----------------------LTVAEEKKRRSMELIPLTARMVMTHLVNHLGHHPLSGGPALLNSLISENHDNPYVESS-------------ELSSEVFKSPNLQLFVFNDSTLISYLQIPSDNSNT--------APLSANPRD---HSSEVRIIIRDISGKYSWDSGVLFRTLDGTGV-TSSDSREQSSHEAARLEKRSSVRFSKCSSELDV----EDGVDVLDQLLEDLGHSSPECLPEPQLRLTQPPSPPMGMNLEIEGLIMEAVHRQSKQEEEELMRR---QIEDPSVRAERQKE--PTHQEPK-----SPFYLCRLLLNDLGMNSWDRRKSFHLLKKNSKLLRELKNLDSRQCRETHKIAVFYIGEGQEDKYSILSNTQGSQVYEDFVSGLGWEVNLATHCGFMGGLQRNGSTGSTAPYYATSNVEVIFHVSTRMPSDSDDSITKKLRHLGNDEVHIVWSEHTRDYRRGIIPTDFGDVLVIIYPMKNHMFFVQIMKKPQVPFFGPLFDGAIVTGELLPSLVRATCINASRAVKSRLPLYQSFYEERALYLEAIIQNHKENMTFEDFAAQVF 1951          

HSP 2 Score: 82.8037 bits (203), Expect = 1.179e-140
Identity = 36/125 (28.80%), Postives = 69/125 (55.20%), Query Frame = 3
Query:  873 QDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1247
            Q L +    +DD++   ++ GG++ GW  +S  +LW+R +G+LG++  I+  ++   +  Y  EL     K+R+N+ I   +      PL+ PP+  +  W+F+   L S F + KL A +++C+
Sbjct:  979 QHLDSSEFLADDIS---IIAGGSLTGWHADSAFVLWRRILGILGDVNSIRCARIHAKVFSYLYELWHKLAKIRDNLGIRVDSDTAMVKPLFIPPLRMLASWLFKATMLPSEFKAGKLQAYKLICE 1100          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Zebrafish
Match: ralgapa2 (Ral GTPase activating protein, alpha subunit 2 (catalytic) [Source:ZFIN;Acc:ZDB-GENE-131122-56])

HSP 1 Score: 439.499 bits (1129), Expect = 1.271e-140
Identity = 302/932 (32.40%), Postives = 466/932 (50.00%), Query Frame = 2
Query: 1229 NAYPL--QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINI-IDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLES------NDLHSKG--LIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFE-----SKRTSMKNPAIH--QGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSN---QFPKPSAVESGQT-SLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQK-SNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
             AY L  ++  +  D+ P+ D L   Y ++H    S+++  + T+I      FF + L G  +L+ DFI A   +L T        E P++E+ ++LGS++ F +L        +   + +I +     K  +VNIL+ +A+ E    AR ++I  + L     L   ET     + +++ I +L   ++F N  +A ++ D+ + L++    +Q   P +P++II++    +         S    DKK + SL+  L+DW M +PLS LLE       +D  S+   L+   +  L   +  +++    + S  L   ++  T +E         S + PAIH   G+F  L                       +   E   R   E + L AR+ + HL+N++G +P +     L+S + E+HD   V++              +LS EVF +P LQ+FV N S L+S++ + S  + +         P++    D     SEVR+IIRD+ GKY WD   + +  +   +  SS+ +E             +   ++ S  L V    +  +D +D LL +L   +PE       +  +P +   G    +E L    +  QS  E          +I  P +  ++ +   P    P+     + FY CR +L  LG  SW RR S  L++K S +   LKN+D R+ RETHKIAV Y+  GQEDK SIL NT GS  +  F+SGLGW VNL  H GFMGGL+ +G  G  APYYA S +E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV++IIYP++N +F + I  K ++  FGPLFDGA+V  + LP LVRAT INA R ++   P YQ F+ ERA YLE  I+   E M+FEDFA  ++
Sbjct: 1093 QAYKLICEMMTKHQDVLPNSDFLVHLYHVMHKGFTSDDQDVLNTMIRWCSPRFFFLGLPGFTMLVGDFITAAARILNTD-----SFEAPRVEAQAVLGSLVCFPNLYQQIPSLQSVPGSEDILVGKEDMKDYLVNILLKTARSETCEGARCVAICGLGLWVCEELRQTETH----HQVKDAINVLGVTLKFGNKVVANVACDIFQLLISHWQHLQRLEPSLPKRIIEIFVATVAFLLPSAEHSTVEADKKLMVSLLLCLLDWCMSVPLSILLEPITMPVLDDPTSQKAPLLDYIYRVLHTCVSGSNLHT--QQSHYLLSLADLSTDYEPFLMLGNVKSFEPPAIHNAMGDFGNL-----------------------LTVAEEKKRRSMELIPLTARMVMTHLVNHLGHHPLSGGPALLNSLISENHDNPYVESS-------------ELSSEVFKSPNLQLFVFNDSTLISYLQIPSDNSNT--------APLSANPRD---HSSEVRIIIRDISGKYSWDSGVLFRTLDGTGV-TSSDSREQSSHEAARLEKRSSVRFSKCSSELDV----EDGVDVLDQLLEDLGHSSPECLPEPQLRLTQPPSPPMGMNLEIEGLIMEAVHRQSKQEEEELMRR---QIEDPSVRAERQKE--PTHQEPK-----SPFYLCRLLLNDLGMNSWDRRKSFHLLKKNSKLLRELKNLDSRQCRETHKIAVFYIGEGQEDKYSILSNTQGSQVYEDFVSGLGWEVNLATHCGFMGGLQRNGSTGSTAPYYATSNVEVIFHVSTRMPSDSDDSITKKLRHLGNDEVHIVWSEHTRDYRRGIIPTDFGDVLVIIYPMKNHMFFVQIMKKPQVPFFGPLFDGAIVTGELLPSLVRATCINASRAVKSRLPLYQSFYEERALYLEAIIQNHKENMTFEDFAAQVF 1951          

HSP 2 Score: 82.8037 bits (203), Expect = 1.271e-140
Identity = 36/125 (28.80%), Postives = 69/125 (55.20%), Query Frame = 3
Query:  873 QDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1247
            Q L +    +DD++   ++ GG++ GW  +S  +LW+R +G+LG++  I+  ++   +  Y  EL     K+R+N+ I   +      PL+ PP+  +  W+F+   L S F + KL A +++C+
Sbjct:  979 QHLDSSEFLADDIS---IIAGGSLTGWHADSAFVLWRRILGILGDVNSIRCARIHAKVFSYLYELWHKLAKIRDNLGIRVDSDTAMVKPLFIPPLRMLASWLFKATMLPSEFKAGKLQAYKLICE 1100          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Zebrafish
Match: ralgapa2 (Ral GTPase activating protein, alpha subunit 2 (catalytic) [Source:ZFIN;Acc:ZDB-GENE-131122-56])

HSP 1 Score: 440.269 bits (1131), Expect = 1.729e-140
Identity = 301/925 (32.54%), Postives = 468/925 (50.59%), Query Frame = 2
Query: 1229 NAYPL--QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINI-IDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLES------NDLHSKG--LIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSN---QFPKPSAVESGQT-SLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQK-SNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
             AY L  ++  +  D+ P+ D L   Y ++H    S+++  + T+I      FF + L G  +L+ DFI A   +L T        E P++E+ ++LGS++ F +L        +   + +I +     K  +VNIL+ +A+ E    AR ++I  + L     L   ET     + +++ I +L   ++F N  +A ++ D+ + L++    +Q   P +P++II++    +         S    DKK + SL+  L+DW M +PLS LLE       +D  S+   L+   +  L   +  +++    + S  L   ++  T +E        P +  GN    S +P   +  + D   +  V +E        R   E + L AR+ + HL+N++G +P +     L+S + E+HD   V++              +LS EVF +P LQ+FV N S L+S++ + S  + +         P++    D     SEVR+IIRD+ GKY WD   + +  +   +  SS+ +E             +   ++ S  L V    +  +D +D LL +L   +PE       +  +P +   G    +E L    +  QS  E          +I  P +  ++ +   P    P+     + FY CR +L  LG  SW RR S  L++K S +   LKN+D R+ RETHKIAV Y+  GQEDK SIL NT GS  +  F+SGLGW VNL  H GFMGGL+ +G  G  APYYA S +E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV++IIYP++N +F + I  K ++  FGPLFDGA+V  + LP LVRAT INA R ++   P YQ F+ ERA YLE  I+   E M+FEDFA  ++
Sbjct: 1058 QAYKLICEMMTKHQDVLPNSDFLVHLYHVMHKGFTSDDQDVLNTMIRWCSPRFFFLGLPGFTMLVGDFITAAARILNTD-----SFEAPRVEAQAVLGSLVCFPNLYQQIPSLQSVPGSEDILVGKEDMKDYLVNILLKTARSETCEGARCVAICGLGLWVCEELRQTETH----HQVKDAINVLGVTLKFGNKVVANVACDIFQLLISHWQHLQRLEPSLPKRIIEIFVATVAFLLPSAEHSTVEADKKLMVSLLLCLLDWCMSVPLSILLEPITMPVLDDPTSQKAPLLDYIYRVLHTCVSGSNLHT--QQSHYLLSLADLSTDYE--------PFLMLGNVK--SFEPPAIHNAMGDFGNLLTVAEEKK------RRSMELIPLTARMVMTHLVNHLGHHPLSGGPALLNSLISENHDNPYVESS-------------ELSSEVFKSPNLQLFVFNDSTLISYLQIPSDNSNT--------APLSANPRD---HSSEVRIIIRDISGKYSWDSGVLFRTLDGTGV-TSSDSREQSSHEAARLEKRSSVRFSKCSSELDV----EDGVDVLDQLLEDLGHSSPECLPEPQLRLTQPPSPPMGMNLEIEGLIMEAVHRQSKQEEEELMRR---QIEDPSVRAERQKE--PTHQEPK-----SPFYLCRLLLNDLGMNSWDRRKSFHLLKKNSKLLRELKNLDSRQCRETHKIAVFYIGEGQEDKYSILSNTQGSQVYEDFVSGLGWEVNLATHCGFMGGLQRNGSTGSTAPYYATSNVEVIFHVSTRMPSDSDDSITKKLRHLGNDEVHIVWSEHTRDYRRGIIPTDFGDVLVIIYPMKNHMFFVQIMKKPQVPFFGPLFDGAIVTGELLPSLVRATCINASRAVKSRLPLYQSFYEERALYLEAIIQNHKENMTFEDFAAQVF 1916          

HSP 2 Score: 82.0333 bits (201), Expect = 1.729e-140
Identity = 34/116 (29.31%), Postives = 66/116 (56.90%), Query Frame = 3
Query:  900 SDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1247
            +DD++   ++ GG++ GW  +S  +LW+R +G+LG++  I+  ++   +  Y  EL     K+R+N+ I   +      PL+ PP+  +  W+F+   L S F + KL A +++C+
Sbjct:  953 ADDIS---IIAGGSLTGWHADSAFVLWRRILGILGDVNSIRCARIHAKVFSYLYELWHKLAKIRDNLGIRVDSDTAMVKPLFIPPLRMLASWLFKATMLPSEFKAGKLQAYKLICE 1065          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Xenopus
Match: RALGAPA1 (Ral GTPase activating protein catalytic alpha subunit 1 [Source:HGNC Symbol;Acc:HGNC:17770])

HSP 1 Score: 411.379 bits (1056), Expect = 2.974e-137
Identity = 301/947 (31.78%), Postives = 472/947 (49.84%), Query Frame = 2
Query: 1229 NAYPL--QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISL-HCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLS---VDPLVEYPYLFDVKPVEGVTQEVNSP-----EVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVH-----------KYENNNVIFK--SSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSN-----QFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY--GIPALN 3973
            +AY L  +I  R+ D+ P+ D L  FY ++H  +   ++  + T+I +    FF + L G+ +LI+DFI A   V  +S      +  P++E+  LLGS++ F +L         NS  I +      K   +  +++SA+ EP   AR +++  + +  C  +++  +T    + +  N I + L   +F N  +A ++  ++  L+N   Q+Q      P KII++L   +         S    DK+ + SL+ +L+DW M L    LL     H++          E+  ++N ++N      + KV  +    + S+  S  NP     + + L+    DP ++   L + +P+     E ++      EV    Q   + +AAR  + HL+N++G YP +     L+S + E+HD    ++              DLS ++F++P LQ F +N + LVS + + S+      +  P G        D+ S  S VR+I+RDL GKY WD + ++           ++ +   IF   S++E E+             +       +L +        D +D LL  L    PE           P P      +  LE+     I++QS  E    + H         L  + +    P    P+     + FY+ R +L+ LG  SW++R +  L++K+   L  LKN+D R+ RETHKIAV YVA GQEDK SIL NT GS ++  F++GLGW VNL NH GF+GGL+ +   GF  PY+A S +E+MFHVST M S++      K +HLGNDEV ++WSE+ R+YR  I  T FGDV+++IYP++N +F I I  K EI  FGPLFDGA+V  K LP LVRATAINA R ++   P YQ FF ER  YL+   ++  EP SFED+A  ++   +PA N
Sbjct: 1484 HAYKLICKIMKRRQDVSPNRDFLTHFYNIMHCGLLHNDQDIVNTIIKHCSPQFFALGLPGATLLIMDFIVAAGRVASSS-----SLNAPRVEAQVLLGSLVCFPNLYQELPALHPNSSDIVMSHFTDVKELTIKTVLNSARDEPSGPARCVALCSLGIWMCEELVN--QTHHPQIKEALNVICVSL---KFPNKVVAQVACSVLNVLLNYVQQLQIYHSDYPLKIIEILLATVTYLLPSAETSSYEQDKRLVVSLLLSLLDWMMAL-PLALLLKPLRHAR---------TESDGRENSVLNC-----AYKVLHD--CVYGSQHFS--NPRYFPMSLSDLASEDYDPFMQLECLKEPEPLHSPDSERSTKLQPVTEVKIPKQQGLIPVAARTVITHLVNHLGHYPMSGDPAMLTSQICENHDNPYCES-------------SDLSPQLFHSPNLQFFALNNTTLVSCLQIQSE------EKLPPG-------EDLSSARSTVRIIMRDLSGKYSWDSSILYGPPLPCEGQMTQWSSLLAIFSPPSNQEVEHPSTQRESEDFSSLSSRRRGRESLPLWDSLSDEQDALDCLLQYLGATGPECLQRAGVPLNVPSPPPACFSE-KLENEVSNAILKQSAEEKEFVEKHSS------NLHMRAMPQDQPVNQKPQ-----SAFYYSRLLLSILGMNSWEKRRNFHLLKKNEKLLRELKNLDSRQCRETHKIAVFYVADGQEDKHSILSNTGGSQDYEDFVAGLGWEVNLSNHCGFLGGLQRNKSTGFSTPYFATSIVEVMFHVSTRMISDSDDCLTKKLRHLGNDEVHIVWSEHSREYRRGIIPTEFGDVLLVIYPMKNHMFSIQIMKKPEIPFFGPLFDGAIVNGKILPGLVRATAINASRALKSLIPLYQNFFEERMRYLDSITQQHLEPTSFEDYAAQVFWPHVPADN 2363          

HSP 2 Score: 100.523 bits (249), Expect = 2.974e-137
Identity = 62/226 (27.43%), Postives = 108/226 (47.79%), Query Frame = 3
Query:  576 PIYKDESEDLNIDADDESEGENVENAYFEVESKSATLTRDESDVDISSQMYRFPAQDTLNDSSRTP--TKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1247
            P   D +  + I+AD  S   +VE    EV S +A L  D      + Q+    A       S +P  + H +R +      +  +   + D + +S+  T          DD+ +  V+ GGT+ GW  +   ++W+R +G+LG++  I NP++   +  Y  EL  +  K+R+N+ I   NQ +P PP+  PP+  + PW+F+   L   +   KL A +++CK
Sbjct: 1278 PFGGDSTVPICIEADAGSTHLSVEEP--EVGSLTA-LHIDSETSSFNQQIMCTEAVAVTGSESVSPALSAHGSRSETPSPAALNSDQAELHDKLQHSVLQT---------PDDIESCSVMAGGTLTGWHADVSTVMWRRMLGILGDVNNIANPEIHAQVFDYLCELWQNLAKIRDNLGISLDNQSSPRPPVLIPPLRILTPWLFKATMLPEKYKQGKLHAYKLICK 1491          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Xenopus
Match: RALGAPA1 (Ral GTPase activating protein catalytic alpha subunit 1 [Source:HGNC Symbol;Acc:HGNC:17770])

HSP 1 Score: 410.609 bits (1054), Expect = 4.981e-137
Identity = 298/939 (31.74%), Postives = 468/939 (49.84%), Query Frame = 2
Query: 1229 NAYPL--QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISL-HCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLS---VDPLVEYPYLFDVKPVEGVTQEVNSP-----EVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVH-----------KYENNNVIFK--SSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSN-----QFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            +AY L  +I  R+ D+ P+ D L  FY ++H  +   ++  + T+I +    FF + L G+ +LI+DFI A   V  +S      +  P++E+  LLGS++ F +L         NS  I +      K   +  +++SA+ EP   AR +++  + +  C  +++  +T    + +  N I + L   +F N  +A ++  ++  L+N   Q+Q      P KII++L   +         S    DK+ + SL+ +L+DW M L    LL     H++          E+  ++N ++N      + KV  +    + S+  S  NP     + + L+    DP ++   L + +P+     E ++      EV    Q   + +AAR  + HL+N++G YP +     L+S + E+HD    ++              DLS ++F++P LQ F +N + LVS + + S+      +  P G        D+ S  S VR+I+RDL GKY WD + ++           ++ +   IF   S++E E+             +       +L +        D +D LL  L    PE           P P      +  LE+     I++QS  E    + H         L  + +    P    P+     + FY+ R +L+ LG  SW++R +  L++K+   L  LKN+D R+ RETHKIAV YVA GQEDK SIL NT GS ++  F++GLGW VNL NH GF+GGL+ +   GF  PY+A S +E+MFHVST M S++      K +HLGNDEV ++WSE+ R+YR  I  T FGDV+++IYP++N +F I I  K EI  FGPLFDGA+V  K LP LVRATAINA R ++   P YQ FF ER  YL+   ++  EP SFED+A  ++
Sbjct: 1527 HAYKLICKIMKRRQDVSPNRDFLTHFYNIMHCGLLHNDQDIVNTIIKHCSPQFFALGLPGATLLIMDFIVAAGRVASSS-----SLNAPRVEAQVLLGSLVCFPNLYQELPALHPNSSDIVMSHFTDVKELTIKTVLNSARDEPSGPARCVALCSLGIWMCEELVN--QTHHPQIKEALNVICVSL---KFPNKVVAQVACSVLNVLLNYVQQLQIYHSDYPLKIIEILLATVTYLLPSAETSSYEQDKRLVVSLLLSLLDWMMAL-PLALLLKPLRHAR---------TESDGRENSVLNC-----AYKVLHD--CVYGSQHFS--NPRYFPMSLSDLASEDYDPFMQLECLKEPEPLHSPDSERSTKLQPVTEVKIPKQQGLIPVAARTVITHLVNHLGHYPMSGDPAMLTSQICENHDNPYCES-------------SDLSPQLFHSPNLQFFALNNTTLVSCLQIQSE------EKLPPG-------EDLSSARSTVRIIMRDLSGKYSWDSSILYGPPLPCEGQMTQWSSLLAIFSPPSNQEVEHPSTQRESEDFSSLSSRRRGRESLPLWDSLSDEQDALDCLLQYLGATGPECLQRAGVPLNVPSPPPACFSE-KLENEVSNAILKQSAEEKEFVEKHSS------NLHMRAMPQDQPVNQKPQ-----SAFYYSRLLLSILGMNSWEKRRNFHLLKKNEKLLRELKNLDSRQCRETHKIAVFYVADGQEDKHSILSNTGGSQDYEDFVAGLGWEVNLSNHCGFLGGLQRNKSTGFSTPYFATSIVEVMFHVSTRMISDSDDCLTKKLRHLGNDEVHIVWSEHSREYRRGIIPTEFGDVLLVIYPMKNHMFSIQIMKKPEIPFFGPLFDGAIVNGKILPGLVRATAINASRALKSLIPLYQNFFEERMRYLDSITQQHLEPTSFEDYAAQVF 2398          

HSP 2 Score: 100.523 bits (249), Expect = 4.981e-137
Identity = 62/226 (27.43%), Postives = 108/226 (47.79%), Query Frame = 3
Query:  576 PIYKDESEDLNIDADDESEGENVENAYFEVESKSATLTRDESDVDISSQMYRFPAQDTLNDSSRTP--TKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1247
            P   D +  + I+AD  S   +VE    EV S +A L  D      + Q+    A       S +P  + H +R +      +  +   + D + +S+  T          DD+ +  V+ GGT+ GW  +   ++W+R +G+LG++  I NP++   +  Y  EL  +  K+R+N+ I   NQ +P PP+  PP+  + PW+F+   L   +   KL A +++CK
Sbjct: 1321 PFGGDSTVPICIEADAGSTHLSVEEP--EVGSLTA-LHIDSETSSFNQQIMCTEAVAVTGSESVSPALSAHGSRSETPSPAALNSDQAELHDKLQHSVLQT---------PDDIESCSVMAGGTLTGWHADVSTVMWRRMLGILGDVNNIANPEIHAQVFDYLCELWQNLAKIRDNLGISLDNQSSPRPPVLIPPLRILTPWLFKATMLPEKYKQGKLHAYKLICK 1534          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Xenopus
Match: RALGAPA1 (Ral GTPase activating protein catalytic alpha subunit 1 [Source:HGNC Symbol;Acc:HGNC:17770])

HSP 1 Score: 412.535 bits (1059), Expect = 1.950e-136
Identity = 314/996 (31.53%), Postives = 491/996 (49.30%), Query Frame = 2
Query: 1229 NAYPL--QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISL-HCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLS---VDPLVEYPYLFDVKPVEGVTQEVNSP-----EVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVH-----------KYENNNVIFK--SSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSN-----QFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY-GIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSKGRDSV 4123
            +AY L  +I  R+ D+ P+ D L  FY ++H  +   ++  + T+I +    FF + L G+ +LI+DFI A   V  +S      +  P++E+  LLGS++ F +L         NS  I +      K   +  +++SA+ EP   AR +++  + +  C  +++  +T    + +  N I + L   +F N  +A ++  ++  L+N   Q+Q      P KII++L   +         S    DK+ + SL+ +L+DW M L    LL     H++          E+  ++N ++N      + KV  +    + S+  S  NP     + + L+    DP ++   L + +P+     E ++      EV    Q   + +AAR  + HL+N++G YP +     L+S + E+HD    ++              DLS ++F++P LQ F +N + LVS + + S+      +  P G        D+ S  S VR+I+RDL GKY WD + ++           ++ +   IF   S++E E+             +       +L +        D +D LL  L    PE           P P      +  LE+     I++QS  E    + H         L  + +    P    P+     + FY+ R +L+ LG  SW++R +  L++K+   L  LKN+D R+ RETHKIAV YVA GQEDK SIL NT GS ++  F++GLGW VNL NH GF+GGL+ +   GF  PY+A S +E+MFHVST M S++      K +HLGNDEV ++WSE+ R+YR  I  T FGDV+++IYP++N +F I I  K EI  FGPLFDGA+V  K LP LVRATAINA R ++   P YQ FF ER  YL+   ++  EP SFED+A  ++  +P     +  Q N+     P     +N+   G   SEL  S+S    SSK R S+
Sbjct: 1134 HAYKLICKIMKRRQDVSPNRDFLTHFYNIMHCGLLHNDQDIVNTIIKHCSPQFFALGLPGATLLIMDFIVAAGRVASSS-----SLNAPRVEAQVLLGSLVCFPNLYQELPALHPNSSDIVMSHFTDVKELTIKTVLNSARDEPSGPARCVALCSLGIWMCEELVN--QTHHPQIKEALNVICVSL---KFPNKVVAQVACSVLNVLLNYVQQLQIYHSDYPLKIIEILLATVTYLLPSAETSSYEQDKRLVVSLLLSLLDWMMAL-PLALLLKPLRHART---------ESDGRENSVLNC-----AYKVLHD--CVYGSQHFS--NPRYFPMSLSDLASEDYDPFMQLECLKEPEPLHSPDSERSTKLQPVTEVKIPKQQGLIPVAARTVITHLVNHLGHYPMSGDPAMLTSQICENHDNPYCES-------------SDLSPQLFHSPNLQFFALNNTTLVSCLQIQSE------EKLPPG-------EDLSSARSTVRIIMRDLSGKYSWDSSILYGPPLPCEGQMTQWSSLLAIFSPPSNQEVEHPSTQRESEDFSSLSSRRRGRESLPLWDSLSDEQDALDCLLQYLGATGPECLQRAGVPLNVPSPPPACFSE-KLENEVSNAILKQSAEEKEFVEKHSS------NLHMRAMPQDQPVNQKPQ-----SAFYYSRLLLSILGMNSWEKRRNFHLLKKNEKLLRELKNLDSRQCRETHKIAVFYVADGQEDKHSILSNTGGSQDYEDFVAGLGWEVNLSNHCGFLGGLQRNKSTGFSTPYFATSIVEVMFHVSTRMISDSDDCLTKKLRHLGNDEVHIVWSEHSREYRRGIIPTEFGDVLLVIYPMKNHMFSIQIMKKPEIPFFGPLFDGAIVNGKILPGLVRATAINASRALKSLIPLYQNFFEERMRYLDSITQQHLEPTSFEDYAAQVFCPVP----HNPLQLNARP--CPTKEQDENVSPPG-DGSELAFSLS--PRSSKSRMSI 2053          

HSP 2 Score: 96.6709 bits (239), Expect = 1.950e-136
Identity = 63/227 (27.75%), Postives = 109/227 (48.02%), Query Frame = 3
Query:  576 PIYKDESEDLNIDADDESEGENVENAYFEVESKSATLTRDESDVDISSQMYRFPAQDTLNDSSRTP--TKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSD-DLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1247
            P   D +  + I+AD  S   +VE    EV S +A L  D      + Q+    A       S +P  + H +R +      +  +   + D + +S+  T D    +   D  L +  V+ GGT+ GW  +   ++W+R +G+LG++  I NP++   +  Y  EL  +  K+R+N+ I   NQ +P PP+  PP+  + PW+F+   L   +   KL A +++CK
Sbjct:  921 PFGGDSTVPICIEADAGSTHLSVEEP--EVGSLTA-LHIDSETSSFNQQIMCTEAVAVTGSESVSPALSAHGSRSETPSPAALNSDQAELHDKLQHSVLQTPD---DIEPCDFPLESCSVMAGGTLTGWHADVSTVMWRRMLGILGDVNNIANPEIHAQVFDYLCELWQNLAKIRDNLGISLDNQSSPRPPVLIPPLRILTPWLFKATMLPEKYKQGKLHAYKLICK 1141          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Xenopus
Match: ralgapa2 (Ral GTPase activating protein, alpha subunit 2 (catalytic) [Source:NCBI gene;Acc:100145357])

HSP 1 Score: 417.927 bits (1073), Expect = 2.462e-136
Identity = 288/922 (31.24%), Postives = 468/922 (50.76%), Query Frame = 2
Query: 1229 NAYPL--QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANS-KTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQE-KLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVE-----GVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIF---SNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQK-SNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
             AY L   +  R+ D+ P+ D L  FY ++H+ + ++++  +  +I +    FF + L G  +L+ DFI A   VL T       +E P+LE+ ++LGS++ F ++  +  +  +++ +T    +    KS +++ L+ +AK EP   AR ++I  + L     L       ++   I++ I ++   ++F N  +A ++ D+++ LV+   ++Q   LPL   KI ++L   I+        S    DKK + SL+  L+DW M LPL  LLE             F+  E+      +++ +       V      T +S+        +   + + +  DP +    + + +P +      +   +   E   R   E + L AR+ + HL+N++G YP +     L S + E+ D    +A              +LS EVF +P LQ+ V N S L+S++ + ++ +   +   P G P             +VR+I+RD+ GKY WD   ++     + IFK  ++ +N+   P       T L + +  +L            +D LL +L  ++PE      ++  +PS+   G      +++ Q  E+ I++     + H  +  H ++        V  +  P  T     FYFC +    L + SW++  +  L++K + +   LKN+D RR RETHKIAV Y+A GQEDK SIL N+ GS  +  F+ GLGW V+L  H GFMGGL+ +G  G  APYYA ST+E++FHVST + S++      K +HLGNDEV ++WSE+ R+YR  I  T FGDV+I+IYP++N +F I I  K ++  FGPLFDGA+V EK LP LV AT INA R ++   P YQ F+ ERA YLE  I  F E M+FEDFA  ++
Sbjct: 1017 QAYKLICSMMTRRQDVLPNSDFLVHFYLIMHTGLNNQDQDILNAVIRHCPSRFFFLGLPGFTMLLGDFITAAARVLSTD-----MLEAPRLEAQTILGSLVCFPNVYKDLPLLGSSAGETDTTTEHKDIKSYLIDKLLKNAKDEPAEIARCIAICSLGLWICEEL----VQNTNHPQIKDAINVIGVTLKFPNKTVAQMACDVLQLLVSYWRELQNTDLPL-SRKITEILVATISFLLPSAENSSVEMDKKLIVSLLLCLLDWCMALPLHILLEPIS---------TFAIDESHSPKASLLDYIYRVLHCCVCGSNTYTQQSQYI------LSLADLSSMDYDPFLPLGNVKNSEPQQFFSSVELGDLLTVVEEKKRRNLELIPLTARMVMTHLVNHLGHYPLSGGPAVLHSLINENQDNPYAEAS-------------ELSNEVFRSPNLQLCVFNDSALISYLQIPAESSVGRD---PSGVP------------GDVRIIVRDISGKYSWDSGIMYGPLECHTIFKMEQKVQNVSQDPVEPYECKTGLTDGEGEDL------------LDTLLEKLGTVSPECLLHPDSKLNEPSSPPYG------MNREQ--EEEIIQAINRQSEH--EAQHVQMCNSDPGVKVACQEEPSTTQPQAPFYFCMEFCNSLLYNSWEKEKNFHLLKKNAKLLRELKNLDSRRCRETHKIAVFYIAEGQEDKRSILSNSAGSKAYEDFLGGLGWEVDLSTHCGFMGGLQRNGSTGQTAPYYATSTVEVIFHVSTRILSDSDDSVTKKLRHLGNDEVQIVWSEHTRNYRKGIIPTDFGDVLIVIYPMKNHMFFIEIMKKPQVPFFGPLFDGAIVTEKLLPTLVCATCINASRAVKSRLPLYQSFYEERALYLEAIIHNFREVMTFEDFAAQVF 1863          

HSP 2 Score: 91.2781 bits (225), Expect = 2.462e-136
Identity = 99/426 (23.24%), Postives = 184/426 (43.19%), Query Frame = 3
Query:    6 MMGKILYNVDMNDLPLDK--KEKRGRRAKKTASSKPLKKLSMNDESILTAPHNQESN-IHSYKTNTMTGILNFQPHTAFIDGLNHNLEDSAASNVEQKNNVNIKSDVKESNQGEFNKGVLYENNEMDAGSFAYSSHEETSSYMSAEDSSSPH---CKDKNIEPNTGAHSDNEFIPLSSSGGDTSIEGNSSFDNSIKPIYKDESED-LNIDADDESEGENVENAYFEVESKSATLTRDESDVDIS-SQMYRFPAQDTLNDSS-RTPTK----HSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            ++ + +Y +DM+ LPLDK  ++K  ++  K     P K  ++     L+   N +S+    +++ T +G    +           N+    AS V++    + +S   ES  G         N E DA   A SS        S  D + P+    + + I+ +    S +      S+G   S       DN    I+ + S   + ++   +S+  N   AY E   K  +++ D ++  I  +++Y  P Q +  D    TPT     H  R+ +Q+S     +   + D+I            + +  D      ++ GG + GW  +S  +LW+R +G+LG++  I++ K+   +  Y  +L     K+R+N+ I   NQ +P PP+  PP+     W+F+   L + +   KL A +++C
Sbjct:  653 VLARTVYGLDMSSLPLDKLSEQKEKKQRGKGGFPDPQKGAAVGRSFSLSWRSNPDSHEPMRFRSATTSGAPGVEK--------ARNIVRQKASEVDEIQPQD-RSAGSESCSG---------NCEQDAQELARSS--------STSDLAEPYPDLTQGQKIDYSVSESSTDSTFAQESTGRGKS-------DNEAPTIFVERSSSPVELEWTADSQSSNGRAAYHE---KGESVSSDIANGYIKDAEIYLMPWQSSEEDHEVNTPTDVAIDHDARQWLQLSPA---DPTPLTDSI------------ECLAGD----CSIIAGGNLTGWHPDSAAVLWRRILGILGDVNTIQSAKIHARVFGYLYDLWYKLAKIRDNLSISLDNQSSPAPPVLIPPLRMFASWLFKATTLPNEYKEGKLQAYKLIC 1023          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Xenopus
Match: RALGAPA1 (Ral GTPase activating protein catalytic alpha subunit 1 [Source:HGNC Symbol;Acc:HGNC:17770])

HSP 1 Score: 410.994 bits (1055), Expect = 5.247e-136
Identity = 298/939 (31.74%), Postives = 468/939 (49.84%), Query Frame = 2
Query: 1229 NAYPL--QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISL-HCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLS---VDPLVEYPYLFDVKPVEGVTQEVNSP-----EVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVH-----------KYENNNVIFK--SSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSNQ-----FPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            +AY L  +I  R+ D+ P+ D L  FY ++H  +   ++  + T+I +    FF + L G+ +LI+DFI A   V  +S      +  P++E+  LLGS++ F +L         NS  I +      K   +  +++SA+ EP   AR +++  + +  C  +++  +T    + +  N I + L   +F N  +A ++  ++  L+N   Q+Q      P KII++L   +         S    DK+ + SL+ +L+DW M L    LL     H++          E+  ++N ++N      + KV  +    + S+  S  NP     + + L+    DP ++   L + +P+     E ++      EV    Q   + +AAR  + HL+N++G YP +     L+S + E+HD    ++              DLS ++F++P LQ F +N + LVS + + S+      +  P G        D+ S  S VR+I+RDL GKY WD + ++           ++ +   IF   S++E E+             +       +L +        D +D LL  L    PE           P P      +  LE+     I++QS  E    + H         L  + +    P    P+     + FY+ R +L+ LG  SW++R +  L++K+   L  LKN+D R+ RETHKIAV YVA GQEDK SIL NT GS ++  F++GLGW VNL NH GF+GGL+ +   GF  PY+A S +E+MFHVST M S++      K +HLGNDEV ++WSE+ R+YR  I  T FGDV+++IYP++N +F I I  K EI  FGPLFDGA+V  K LP LVRATAINA R ++   P YQ FF ER  YL+   ++  EP SFED+A  ++
Sbjct: 1165 HAYKLICKIMKRRQDVSPNRDFLTHFYNIMHCGLLHNDQDIVNTIIKHCSPQFFALGLPGATLLIMDFIVAAGRVASSS-----SLNAPRVEAQVLLGSLVCFPNLYQELPALHPNSSDIVMSHFTDVKELTIKTVLNSARDEPSGPARCVALCSLGIWMCEELVN--QTHHPQIKEALNVICVSL---KFPNKVVAQVACSVLNVLLNYVQQLQIYHSDYPLKIIEILLATVTYLLPSAETSSYEQDKRLVVSLLLSLLDWMMAL-PLALLLKPLRHART---------ESDGRENSVLNC-----AYKVLHD--CVYGSQHFS--NPRYFPMSLSDLASEDYDPFMQLECLKEPEPLHSPDSERSTKLQPVTEVKIPKQQGLIPVAARTVITHLVNHLGHYPMSGDPAMLTSQICENHDNPYCESS-------------DLSPQLFHSPNLQFFALNNTTLVSCLQIQSE------EKLPPG-------EDLSSARSTVRIIMRDLSGKYSWDSSILYGPPLPCEGQMTQWSSLLAIFSPPSNQEVEHPSTQRESEDFSSLSSRRRGRESLPLWDSLSDEQDALDCLLQYLGATGPECLQRAGVPLNVPSPPPACFSE-KLENEVSNAILKQSAEEKEFVEKHSS------NLHMRAMPQDQPVNQKPQ-----SAFYYSRLLLSILGMNSWEKRRNFHLLKKNEKLLRELKNLDSRQCRETHKIAVFYVADGQEDKHSILSNTGGSQDYEDFVAGLGWEVNLSNHCGFLGGLQRNKSTGFSTPYFATSIVEVMFHVSTRMISDSDDCLTKKLRHLGNDEVHIVWSEHSREYRRGIIPTEFGDVLLVIYPMKNHMFSIQIMKKPEIPFFGPLFDGAIVNGKILPGLVRATAINASRALKSLIPLYQNFFEERMRYLDSITQQHLEPTSFEDYAAQVF 2036          

HSP 2 Score: 97.0561 bits (240), Expect = 5.247e-136
Identity = 63/227 (27.75%), Postives = 109/227 (48.02%), Query Frame = 3
Query:  576 PIYKDESEDLNIDADDESEGENVENAYFEVESKSATLTRDESDVDISSQMYRFPAQDTLNDSSRTP--TKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSD-DLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1247
            P   D +  + I+AD  S   +VE    EV S +A L  D      + Q+    A       S +P  + H +R +      +  +   + D + +S+  T D    +   D  L +  V+ GGT+ GW  +   ++W+R +G+LG++  I NP++   +  Y  EL  +  K+R+N+ I   NQ +P PP+  PP+  + PW+F+   L   +   KL A +++CK
Sbjct:  952 PFGGDSTVPICIEADAGSTHLSVEEP--EVGSLTA-LHIDSETSSFNQQIMCTEAVAVTGSESVSPALSAHGSRSETPSPAALNSDQAELHDKLQHSVLQTPD---DIEPCDFPLESCSVMAGGTLTGWHADVSTVMWRRMLGILGDVNNIANPEIHAQVFDYLCELWQNLAKIRDNLGISLDNQSSPRPPVLIPPLRILTPWLFKATMLPEKYKQGKLHAYKLICK 1172          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Mouse
Match: Ralgapa1 (Ral GTPase activating protein, alpha subunit 1 [Source:MGI Symbol;Acc:MGI:1931050])

HSP 1 Score: 455.677 bits (1171), Expect = 9.027e-150
Identity = 318/989 (32.15%), Postives = 486/989 (49.14%), Query Frame = 2
Query: 1256 RKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLH-CYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNP---AIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSP-----EVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKY-------ENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVI-------DYVDNLLVELTEMNPEIFSNQ-------FPKPSAVESGQTS--LESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSKGRDSV 4123
            R+ D+ P+ D L  FY ++H  +   ++  + T+I +    FF + L G+ +LI+DFI A   V  ++      +  P++E+  LLGS++ F +L         N   I +      K  I+  ++SSA+ EP   AR +++  + +  C  ++   E+    + +  N I + L   +F N  +A ++ +M+  LV+   ++Q   P  P KIIQ+L   I         S    DK+ + SL+  L+DW M LPL  LL+   +H+ G         EN   +  ++N +       V   +         S  NP    I   +   +  DP +    L + +P+     E +S      EV  + Q   + +AAR  + HL+N++G YP +     L+S V E+HD    ++              +LS E+F +P +Q FV+N + LVS + + S+      +S PGG         + S  S VR+I+RDL GKY WD A ++         E  + I   S++++   P           + +  SL L+  +   P         D +D LL  L   +PE             P+P  +   Q +  + ++ K+   E+  VE +  D                L      ++ P      + FY+CR +L+ LG  SW +R S  L++K+   L  L+N+D R+ RETHKIAV YVA GQEDK SIL N  GS  +  F++GLGW VNL NH GFMGGL+ +   G   PY+A ST+E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV+I+IYP++N +F I I  K E+  FGPLFDGA+V  K LP++VR+TAINA R ++   P YQ F+ ERA YL+  ++   EP +FEDFA  ++  PA        A S  E+ P    SD         ++L S MS    +SK R S+
Sbjct: 1613 RRQDVSPNRDFLTHFYNIMHCGLLHIDQDIVNTIIKHCSPQFFSLGLPGATMLIMDFIIAAGRVASSA-----FLNAPRVEAQVLLGSLVCFPNLYCELPALHPNIPDIAVSQFTDVKELIIKTVLSSARDEPSGPARCVALCSLGIWICEELVH--ESHHPQIKEALNVICVSL---KFTNKTVAHVACNMLHMLVHYVPRLQIHQPQSPLKIIQILIATITHLLPSTEASSYEMDKRLVVSLLLCLLDWIMALPLKTLLQP--VHATGA--------ENDKTEKSVLNCIYKVLHGCVYGAQ---------SFSNPKYFPISLSDLASVDYDPFMHLESLKEPEPLHSPDSERSSKLQPVTEVKTQMQQGLISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSEST-------------ELSPELFESPNIQFFVLNNTTLVSCIQIRSE------ESMPGG----GLAAGLVSANSNVRIIVRDLSGKYSWDSAILYGPPIVSGLPEPTSFILSMSDQEKPEEPPTSNECLEDIAVKDGLSLQLRRFRETVPTWSTIREEEDVLDELLQYLGTTSPECLQRTGISLNVPAPQPLCISEKQENDVINAILKQYTEEKEFVEKHFND----------------LNMKASEQDEPTPQKPQSAFYYCRLLLSILGMNSWDKRRSFHLLKKNEKLLRELRNLDSRQCRETHKIAVFYVAEGQEDKYSILTNIGGSQAYEDFVAGLGWEVNLTNHCGFMGGLQKNRSTGLTTPYFATSTVEVIFHVSTRMPSDSDDSLTKKLRHLGNDEVHIVWSEHTRDYRRGIIPTEFGDVLIVIYPMKNHMFSIQIMKKPEVPFFGPLFDGAIVNGKVLPIMVRSTAINASRALKSLIPLYQNFYEERARYLQTIVQHHLEPTTFEDFAAQVFS-PAPYHHFPADAGSYPEIPP----SDAAPAAQVDGADLASPMS--PRTSKSRMSM 2526          

HSP 2 Score: 97.4413 bits (241), Expect = 9.027e-150
Identity = 45/170 (26.47%), Postives = 88/170 (51.76%), Query Frame = 3
Query:  735 PAQDTLNDSSRTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            P    L   S+TP+  +  R       IE+  + +++ + +S+  T D  +  ++        V+ GGT+ GW  +   ++W+R +G+LG++  I +P++   +  Y  EL  +  K+R+N+ I   N  +P+PP+  PP+  + PW+F+   L   +   KL A +++C
Sbjct: 1446 PVHSALGSRSQTPSPSTLSRA-----HIEQKDLQLDEKLHHSVLQTPD--DLEISEFPSECCSVMAGGTLTGWHADVATVMWRRMLGILGDVNAIMDPEIHAQVFDYLCELWQNLAKIRDNLGISADNLTSPSPPVLIPPLRILTPWLFKATMLTDKYKQGKLHAYKLIC 1608          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Mouse
Match: Ralgapa1 (Ral GTPase activating protein, alpha subunit 1 [Source:MGI Symbol;Acc:MGI:1931050])

HSP 1 Score: 455.292 bits (1170), Expect = 1.802e-149
Identity = 318/989 (32.15%), Postives = 486/989 (49.14%), Query Frame = 2
Query: 1256 RKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLH-CYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNP---AIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSP-----EVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKY-------ENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVI-------DYVDNLLVELTEMNPEIFSNQ-------FPKPSAVESGQTS--LESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSKGRDSV 4123
            R+ D+ P+ D L  FY ++H  +   ++  + T+I +    FF + L G+ +LI+DFI A   V  ++      +  P++E+  LLGS++ F +L         N   I +      K  I+  ++SSA+ EP   AR +++  + +  C  ++   E+    + +  N I + L   +F N  +A ++ +M+  LV+   ++Q   P  P KIIQ+L   I         S    DK+ + SL+  L+DW M LPL  LL+   +H+ G         EN   +  ++N +       V   +         S  NP    I   +   +  DP +    L + +P+     E +S      EV  + Q   + +AAR  + HL+N++G YP +     L+S V E+HD    ++              +LS E+F +P +Q FV+N + LVS + + S+      +S PGG         + S  S VR+I+RDL GKY WD A ++         E  + I   S++++   P           + +  SL L+  +   P         D +D LL  L   +PE             P+P  +   Q +  + ++ K+   E+  VE +  D                L      ++ P      + FY+CR +L+ LG  SW +R S  L++K+   L  L+N+D R+ RETHKIAV YVA GQEDK SIL N  GS  +  F++GLGW VNL NH GFMGGL+ +   G   PY+A ST+E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV+I+IYP++N +F I I  K E+  FGPLFDGA+V  K LP++VR+TAINA R ++   P YQ F+ ERA YL+  ++   EP +FEDFA  ++  PA        A S  E+ P    SD         ++L S MS    +SK R S+
Sbjct: 1157 RRQDVSPNRDFLTHFYNIMHCGLLHIDQDIVNTIIKHCSPQFFSLGLPGATMLIMDFIIAAGRVASSA-----FLNAPRVEAQVLLGSLVCFPNLYCELPALHPNIPDIAVSQFTDVKELIIKTVLSSARDEPSGPARCVALCSLGIWICEELVH--ESHHPQIKEALNVICVSL---KFTNKTVAHVACNMLHMLVHYVPRLQIHQPQSPLKIIQILIATITHLLPSTEASSYEMDKRLVVSLLLCLLDWIMALPLKTLLQP--VHATGA--------ENDKTEKSVLNCIYKVLHGCVYGAQ---------SFSNPKYFPISLSDLASVDYDPFMHLESLKEPEPLHSPDSERSSKLQPVTEVKTQMQQGLISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSEST-------------ELSPELFESPNIQFFVLNNTTLVSCIQIRSE------ESMPGG----GLAAGLVSANSNVRIIVRDLSGKYSWDSAILYGPPIVSGLPEPTSFILSMSDQEKPEEPPTSNECLEDIAVKDGLSLQLRRFRETVPTWSTIREEEDVLDELLQYLGTTSPECLQRTGISLNVPAPQPLCISEKQENDVINAILKQYTEEKEFVEKHFND----------------LNMKASEQDEPTPQKPQSAFYYCRLLLSILGMNSWDKRRSFHLLKKNEKLLRELRNLDSRQCRETHKIAVFYVAEGQEDKYSILTNIGGSQAYEDFVAGLGWEVNLTNHCGFMGGLQKNRSTGLTTPYFATSTVEVIFHVSTRMPSDSDDSLTKKLRHLGNDEVHIVWSEHTRDYRRGIIPTEFGDVLIVIYPMKNHMFSIQIMKKPEVPFFGPLFDGAIVNGKVLPIMVRSTAINASRALKSLIPLYQNFYEERARYLQTIVQHHLEPTTFEDFAAQVFS-PAPYHHFPADAGSYPEIPP----SDAAPAAQVDGADLASPMS--PRTSKSRMSM 2070          

HSP 2 Score: 96.6709 bits (239), Expect = 1.802e-149
Identity = 45/170 (26.47%), Postives = 88/170 (51.76%), Query Frame = 3
Query:  735 PAQDTLNDSSRTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            P    L   S+TP+  +  R       IE+  + +++ + +S+  T D  +  ++        V+ GGT+ GW  +   ++W+R +G+LG++  I +P++   +  Y  EL  +  K+R+N+ I   N  +P+PP+  PP+  + PW+F+   L   +   KL A +++C
Sbjct:  990 PVHSALGSRSQTPSPSTLSRA-----HIEQKDLQLDEKLHHSVLQTPD--DLEISEFPSECCSVMAGGTLTGWHADVATVMWRRMLGILGDVNAIMDPEIHAQVFDYLCELWQNLAKIRDNLGISADNLTSPSPPVLIPPLRILTPWLFKATMLTDKYKQGKLHAYKLIC 1152          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Mouse
Match: Ralgapa1 (Ral GTPase activating protein, alpha subunit 1 [Source:MGI Symbol;Acc:MGI:1931050])

HSP 1 Score: 450.669 bits (1158), Expect = 5.984e-148
Identity = 302/933 (32.37%), Postives = 465/933 (49.84%), Query Frame = 2
Query: 1256 RKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLH-CYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNP---AIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSP-----EVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKY-------ENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVI-------DYVDNLLVELTEMNPEIFSNQ-------FPKPSAVESGQTS--LESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            R+ D+ P+ D L  FY ++H  +   ++  + T+I +    FF + L G+ +LI+DFI A   V  ++      +  P++E+  LLGS++ F +L         N   I +      K  I+  ++SSA+ EP   AR +++  + +  C  ++   E+    + +  N I + L   +F N  +A ++ +M+  LV+   ++Q   P  P KIIQ+L   I         S    DK+ + SL+  L+DW M LPL  LL+   +H+ G         EN   +  ++N +       V   +         S  NP    I   +   +  DP +    L + +P+     E +S      EV  + Q   + +AAR  + HL+N++G YP +     L+S V E+HD    ++              +LS E+F +P +Q FV+N + LVS + + S+      +S PGG         + S  S VR+I+RDL GKY WD A ++         E  + I   S++++   P           + +  SL L+  +   P         D +D LL  L   +PE             P+P  +   Q +  + ++ K+   E+  VE +  D                L      ++ P      + FY+CR +L+ LG  SW +R S  L++K+   L  L+N+D R+ RETHKIAV YVA GQEDK SIL N  GS  +  F++GLGW VNL NH GFMGGL+ +   G   PY+A ST+E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV+I+IYP++N +F I I  K E+  FGPLFDGA+V  K LP++VR+TAINA R ++   P YQ F+ ERA YL+  ++   EP +FEDFA  ++
Sbjct: 1204 RRQDVSPNRDFLTHFYNIMHCGLLHIDQDIVNTIIKHCSPQFFSLGLPGATMLIMDFIIAAGRVASSA-----FLNAPRVEAQVLLGSLVCFPNLYCELPALHPNIPDIAVSQFTDVKELIIKTVLSSARDEPSGPARCVALCSLGIWICEELVH--ESHHPQIKEALNVICVSL---KFTNKTVAHVACNMLHMLVHYVPRLQIHQPQSPLKIIQILIATITHLLPSTEASSYEMDKRLVVSLLLCLLDWIMALPLKTLLQP--VHATGA--------ENDKTEKSVLNCIYKVLHGCVYGAQ---------SFSNPKYFPISLSDLASVDYDPFMHLESLKEPEPLHSPDSERSSKLQPVTEVKTQMQQGLISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSEST-------------ELSPELFESPNIQFFVLNNTTLVSCIQIRSE------ESMPGG----GLAAGLVSANSNVRIIVRDLSGKYSWDSAILYGPPIVSGLPEPTSFILSMSDQEKPEEPPTSNECLEDIAVKDGLSLQLRRFRETVPTWSTIREEEDVLDELLQYLGTTSPECLQRTGISLNVPAPQPLCISEKQENDVINAILKQYTEEKEFVEKHFND----------------LNMKASEQDEPTPQKPQSAFYYCRLLLSILGMNSWDKRRSFHLLKKNEKLLRELRNLDSRQCRETHKIAVFYVAEGQEDKYSILTNIGGSQAYEDFVAGLGWEVNLTNHCGFMGGLQKNRSTGLTTPYFATSTVEVIFHVSTRMPSDSDDSLTKKLRHLGNDEVHIVWSEHTRDYRRGIIPTEFGDVLIVIYPMKNHMFSIQIMKKPEVPFFGPLFDGAIVNGKVLPIMVRSTAINASRALKSLIPLYQNFYEERARYLQTIVQHHLEPTTFEDFAAQVF 2068          

HSP 2 Score: 96.2857 bits (238), Expect = 5.984e-148
Identity = 45/170 (26.47%), Postives = 88/170 (51.76%), Query Frame = 3
Query:  735 PAQDTLNDSSRTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            P    L   S+TP+  +  R       IE+  + +++ + +S+  T D  +  ++        V+ GGT+ GW  +   ++W+R +G+LG++  I +P++   +  Y  EL  +  K+R+N+ I   N  +P+PP+  PP+  + PW+F+   L   +   KL A +++C
Sbjct: 1037 PVHSALGSRSQTPSPSTLSRA-----HIEQKDLQLDEKLHHSVLQTPD--DLEISEFPSECCSVMAGGTLTGWHADVATVMWRRMLGILGDVNAIMDPEIHAQVFDYLCELWQNLAKIRDNLGISADNLTSPSPPVLIPPLRILTPWLFKATMLTDKYKQGKLHAYKLIC 1199          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Mouse
Match: Ralgapa1 (Ral GTPase activating protein, alpha subunit 1 [Source:MGI Symbol;Acc:MGI:1931050])

HSP 1 Score: 449.514 bits (1155), Expect = 1.126e-147
Identity = 302/933 (32.37%), Postives = 465/933 (49.84%), Query Frame = 2
Query: 1256 RKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLH-CYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNP---AIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSP-----EVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKY-------ENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVI-------DYVDNLLVELTEMNPEIFSNQ-------FPKPSAVESGQTS--LESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            R+ D+ P+ D L  FY ++H  +   ++  + T+I +    FF + L G+ +LI+DFI A   V  ++      +  P++E+  LLGS++ F +L         N   I +      K  I+  ++SSA+ EP   AR +++  + +  C  ++   E+    + +  N I + L   +F N  +A ++ +M+  LV+   ++Q   P  P KIIQ+L   I         S    DK+ + SL+  L+DW M LPL  LL+   +H+ G         EN   +  ++N +       V   +         S  NP    I   +   +  DP +    L + +P+     E +S      EV  + Q   + +AAR  + HL+N++G YP +     L+S V E+HD    ++              +LS E+F +P +Q FV+N + LVS + + S+      +S PGG         + S  S VR+I+RDL GKY WD A ++         E  + I   S++++   P           + +  SL L+  +   P         D +D LL  L   +PE             P+P  +   Q +  + ++ K+   E+  VE +  D                L      ++ P      + FY+CR +L+ LG  SW +R S  L++K+   L  L+N+D R+ RETHKIAV YVA GQEDK SIL N  GS  +  F++GLGW VNL NH GFMGGL+ +   G   PY+A ST+E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV+I+IYP++N +F I I  K E+  FGPLFDGA+V  K LP++VR+TAINA R ++   P YQ F+ ERA YL+  ++   EP +FEDFA  ++
Sbjct: 1157 RRQDVSPNRDFLTHFYNIMHCGLLHIDQDIVNTIIKHCSPQFFSLGLPGATMLIMDFIIAAGRVASSA-----FLNAPRVEAQVLLGSLVCFPNLYCELPALHPNIPDIAVSQFTDVKELIIKTVLSSARDEPSGPARCVALCSLGIWICEELVH--ESHHPQIKEALNVICVSL---KFTNKTVAHVACNMLHMLVHYVPRLQIHQPQSPLKIIQILIATITHLLPSTEASSYEMDKRLVVSLLLCLLDWIMALPLKTLLQP--VHATGA--------ENDKTEKSVLNCIYKVLHGCVYGAQ---------SFSNPKYFPISLSDLASVDYDPFMHLESLKEPEPLHSPDSERSSKLQPVTEVKTQMQQGLISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSEST-------------ELSPELFESPNIQFFVLNNTTLVSCIQIRSE------ESMPGG----GLAAGLVSANSNVRIIVRDLSGKYSWDSAILYGPPIVSGLPEPTSFILSMSDQEKPEEPPTSNECLEDIAVKDGLSLQLRRFRETVPTWSTIREEEDVLDELLQYLGTTSPECLQRTGISLNVPAPQPLCISEKQENDVINAILKQYTEEKEFVEKHFND----------------LNMKASEQDEPTPQKPQSAFYYCRLLLSILGMNSWDKRRSFHLLKKNEKLLRELRNLDSRQCRETHKIAVFYVAEGQEDKYSILTNIGGSQAYEDFVAGLGWEVNLTNHCGFMGGLQKNRSTGLTTPYFATSTVEVIFHVSTRMPSDSDDSLTKKLRHLGNDEVHIVWSEHTRDYRRGIIPTEFGDVLIVIYPMKNHMFSIQIMKKPEVPFFGPLFDGAIVNGKVLPIMVRSTAINASRALKSLIPLYQNFYEERARYLQTIVQHHLEPTTFEDFAAQVF 2021          

HSP 2 Score: 96.6709 bits (239), Expect = 1.126e-147
Identity = 45/170 (26.47%), Postives = 88/170 (51.76%), Query Frame = 3
Query:  735 PAQDTLNDSSRTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            P    L   S+TP+  +  R       IE+  + +++ + +S+  T D  +  ++        V+ GGT+ GW  +   ++W+R +G+LG++  I +P++   +  Y  EL  +  K+R+N+ I   N  +P+PP+  PP+  + PW+F+   L   +   KL A +++C
Sbjct:  990 PVHSALGSRSQTPSPSTLSRA-----HIEQKDLQLDEKLHHSVLQTPD--DLEISEFPSECCSVMAGGTLTGWHADVATVMWRRMLGILGDVNAIMDPEIHAQVFDYLCELWQNLAKIRDNLGISADNLTSPSPPVLIPPLRILTPWLFKATMLTDKYKQGKLHAYKLIC 1152          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Mouse
Match: Ralgapa1 (Ral GTPase activating protein, alpha subunit 1 [Source:MGI Symbol;Acc:MGI:1931050])

HSP 1 Score: 449.514 bits (1155), Expect = 1.126e-147
Identity = 302/933 (32.37%), Postives = 465/933 (49.84%), Query Frame = 2
Query: 1256 RKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLH-CYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNP---AIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSP-----EVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKY-------ENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVI-------DYVDNLLVELTEMNPEIFSNQ-------FPKPSAVESGQTS--LESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            R+ D+ P+ D L  FY ++H  +   ++  + T+I +    FF + L G+ +LI+DFI A   V  ++      +  P++E+  LLGS++ F +L         N   I +      K  I+  ++SSA+ EP   AR +++  + +  C  ++   E+    + +  N I + L   +F N  +A ++ +M+  LV+   ++Q   P  P KIIQ+L   I         S    DK+ + SL+  L+DW M LPL  LL+   +H+ G         EN   +  ++N +       V   +         S  NP    I   +   +  DP +    L + +P+     E +S      EV  + Q   + +AAR  + HL+N++G YP +     L+S V E+HD    ++              +LS E+F +P +Q FV+N + LVS + + S+      +S PGG         + S  S VR+I+RDL GKY WD A ++         E  + I   S++++   P           + +  SL L+  +   P         D +D LL  L   +PE             P+P  +   Q +  + ++ K+   E+  VE +  D                L      ++ P      + FY+CR +L+ LG  SW +R S  L++K+   L  L+N+D R+ RETHKIAV YVA GQEDK SIL N  GS  +  F++GLGW VNL NH GFMGGL+ +   G   PY+A ST+E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV+I+IYP++N +F I I  K E+  FGPLFDGA+V  K LP++VR+TAINA R ++   P YQ F+ ERA YL+  ++   EP +FEDFA  ++
Sbjct: 1157 RRQDVSPNRDFLTHFYNIMHCGLLHIDQDIVNTIIKHCSPQFFSLGLPGATMLIMDFIIAAGRVASSA-----FLNAPRVEAQVLLGSLVCFPNLYCELPALHPNIPDIAVSQFTDVKELIIKTVLSSARDEPSGPARCVALCSLGIWICEELVH--ESHHPQIKEALNVICVSL---KFTNKTVAHVACNMLHMLVHYVPRLQIHQPQSPLKIIQILIATITHLLPSTEASSYEMDKRLVVSLLLCLLDWIMALPLKTLLQP--VHATGA--------ENDKTEKSVLNCIYKVLHGCVYGAQ---------SFSNPKYFPISLSDLASVDYDPFMHLESLKEPEPLHSPDSERSSKLQPVTEVKTQMQQGLISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSEST-------------ELSPELFESPNIQFFVLNNTTLVSCIQIRSE------ESMPGG----GLAAGLVSANSNVRIIVRDLSGKYSWDSAILYGPPIVSGLPEPTSFILSMSDQEKPEEPPTSNECLEDIAVKDGLSLQLRRFRETVPTWSTIREEEDVLDELLQYLGTTSPECLQRTGISLNVPAPQPLCISEKQENDVINAILKQYTEEKEFVEKHFND----------------LNMKASEQDEPTPQKPQSAFYYCRLLLSILGMNSWDKRRSFHLLKKNEKLLRELRNLDSRQCRETHKIAVFYVAEGQEDKYSILTNIGGSQAYEDFVAGLGWEVNLTNHCGFMGGLQKNRSTGLTTPYFATSTVEVIFHVSTRMPSDSDDSLTKKLRHLGNDEVHIVWSEHTRDYRRGIIPTEFGDVLIVIYPMKNHMFSIQIMKKPEVPFFGPLFDGAIVNGKVLPIMVRSTAINASRALKSLIPLYQNFYEERARYLQTIVQHHLEPTTFEDFAAQVF 2021          

HSP 2 Score: 96.6709 bits (239), Expect = 1.126e-147
Identity = 45/170 (26.47%), Postives = 88/170 (51.76%), Query Frame = 3
Query:  735 PAQDTLNDSSRTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            P    L   S+TP+  +  R       IE+  + +++ + +S+  T D  +  ++        V+ GGT+ GW  +   ++W+R +G+LG++  I +P++   +  Y  EL  +  K+R+N+ I   N  +P+PP+  PP+  + PW+F+   L   +   KL A +++C
Sbjct:  990 PVHSALGSRSQTPSPSTLSRA-----HIEQKDLQLDEKLHHSVLQTPD--DLEISEFPSECCSVMAGGTLTGWHADVATVMWRRMLGILGDVNAIMDPEIHAQVFDYLCELWQNLAKIRDNLGISADNLTSPSPPVLIPPLRILTPWLFKATMLTDKYKQGKLHAYKLIC 1152          
BLAST of Rap-GAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6GYP7|RGPA1_MOUSE (Ral GTPase-activating protein subunit alpha-1 OS=Mus musculus OX=10090 GN=Ralgapa1 PE=1 SV=1)

HSP 1 Score: 449.514 bits (1155), Expect = 6.881e-147
Identity = 302/933 (32.37%), Postives = 465/933 (49.84%), Query Frame = 2
Query: 1256 RKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLH-CYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNP---AIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSP-----EVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKY-------ENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVI-------DYVDNLLVELTEMNPEIFSNQ-------FPKPSAVESGQTS--LESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            R+ D+ P+ D L  FY ++H  +   ++  + T+I +    FF + L G+ +LI+DFI A   V  ++      +  P++E+  LLGS++ F +L         N   I +      K  I+  ++SSA+ EP   AR +++  + +  C  ++   E+    + +  N I + L   +F N  +A ++ +M+  LV+   ++Q   P  P KIIQ+L   I         S    DK+ + SL+  L+DW M LPL  LL+   +H+ G         EN   +  ++N +       V   +         S  NP    I   +   +  DP +    L + +P+     E +S      EV  + Q   + +AAR  + HL+N++G YP +     L+S V E+HD    ++              +LS E+F +P +Q FV+N + LVS + + S+      +S PGG         + S  S VR+I+RDL GKY WD A ++         E  + I   S++++   P           + +  SL L+  +   P         D +D LL  L   +PE             P+P  +   Q +  + ++ K+   E+  VE +  D                L      ++ P      + FY+CR +L+ LG  SW +R S  L++K+   L  L+N+D R+ RETHKIAV YVA GQEDK SIL N  GS  +  F++GLGW VNL NH GFMGGL+ +   G   PY+A ST+E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV+I+IYP++N +F I I  K E+  FGPLFDGA+V  K LP++VR+TAINA R ++   P YQ F+ ERA YL+  ++   EP +FEDFA  ++
Sbjct: 1157 RRQDVSPNRDFLTHFYNIMHCGLLHIDQDIVNTIIKHCSPQFFSLGLPGATMLIMDFIIAAGRVASSA-----FLNAPRVEAQVLLGSLVCFPNLYCELPALHPNIPDIAVSQFTDVKELIIKTVLSSARDEPSGPARCVALCSLGIWICEELVH--ESHHPQIKEALNVICVSL---KFTNKTVAHVACNMLHMLVHYVPRLQIHQPQSPLKIIQILIATITHLLPSTEASSYEMDKRLVVSLLLCLLDWIMALPLKTLLQP--VHATGA--------ENDKTEKSVLNCIYKVLHGCVYGAQ---------SFSNPKYFPISLSDLASVDYDPFMHLESLKEPEPLHSPDSERSSKLQPVTEVKTQMQQGLISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSEST-------------ELSPELFESPNIQFFVLNNTTLVSCIQIRSE------ESMPGG----GLAAGLVSANSNVRIIVRDLSGKYSWDSAILYGPPIVSGLPEPTSFILSMSDQEKPEEPPTSNECLEDIAVKDGLSLQLRRFRETVPTWSTIREEEDVLDELLQYLGTTSPECLQRTGISLNVPAPQPLCISEKQENDVINAILKQYTEEKEFVEKHFND----------------LNMKASEQDEPTPQKPQSAFYYCRLLLSILGMNSWDKRRSFHLLKKNEKLLRELRNLDSRQCRETHKIAVFYVAEGQEDKYSILTNIGGSQAYEDFVAGLGWEVNLTNHCGFMGGLQKNRSTGLTTPYFATSTVEVIFHVSTRMPSDSDDSLTKKLRHLGNDEVHIVWSEHTRDYRRGIIPTEFGDVLIVIYPMKNHMFSIQIMKKPEVPFFGPLFDGAIVNGKVLPIMVRSTAINASRALKSLIPLYQNFYEERARYLQTIVQHHLEPTTFEDFAAQVF 2021          

HSP 2 Score: 96.6709 bits (239), Expect = 6.881e-147
Identity = 45/170 (26.47%), Postives = 88/170 (51.76%), Query Frame = 3
Query:  735 PAQDTLNDSSRTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            P    L   S+TP+  +  R       IE+  + +++ + +S+  T D  +  ++        V+ GGT+ GW  +   ++W+R +G+LG++  I +P++   +  Y  EL  +  K+R+N+ I   N  +P+PP+  PP+  + PW+F+   L   +   KL A +++C
Sbjct:  990 PVHSALGSRSQTPSPSTLSRA-----HIEQKDLQLDEKLHHSVLQTPD--DLEISEFPSECCSVMAGGTLTGWHADVATVMWRRMLGILGDVNAIMDPEIHAQVFDYLCELWQNLAKIRDNLGISADNLTSPSPPVLIPPLRILTPWLFKATMLTDKYKQGKLHAYKLIC 1152          
BLAST of Rap-GAP domain-containing protein vs. UniProt/SwissProt
Match: sp|O55007|RGPA1_RAT (Ral GTPase-activating protein subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Ralgapa1 PE=1 SV=2)

HSP 1 Score: 449.899 bits (1156), Expect = 9.460e-146
Identity = 304/937 (32.44%), Postives = 468/937 (49.95%), Query Frame = 2
Query: 1256 RKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLH-CYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNP---AIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSP-----EVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKY-------ENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVI-------DYVDNLLVELTEMNPEIFSNQ-------FPKPSAVESGQTS--LESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPA 3967
            R+ D+ P+ D L  FY ++H  +   ++  + T+I +    FF + L G+ +LI+DFI A   V  ++      +  P++E+  LLGS++ F +L         ++  I +      K  I+  ++SSA+ EP   AR +++  + +  C  ++   E+    + +  N I + L   +F N  +A ++ +M+  LV+   ++Q   P  P KIIQ+L   I         S    DK+ + SL+  L+DW M LPL  LL+S  +HS G         EN   +  ++N +       V   +         S  +P    I   +   +  DP +    L + +P+     E +S      EV  + Q   + +AAR  + HL+N++G YP +     L+S V E+HD    ++              +LS E+F++P +Q FV+N + LVS + + S+      +S PGG         + S  S VR+I+RDL GKY WD A ++         E  + I   S +++   P           + +  SL L+  +   P         D +D LL  L   +PE             P+P  +   Q +  + ++ K+   E+  VE +  D                L      ++ P      + FY+CR +L+ LG  SW +R S  L++K+   L  L+N+D R+ RETHKIAV YVA GQEDK SIL N  GS  +  F++GLGW VNL NH GFMGGL+ +   G   PY+A ST+E++FHVST MPSE+      K +HLGNDEV ++WSE+ RDYR  I  T FGDV+I+IYP++N +F I I  K E+  FGPLFDGA+V  K LP++VR+TAINA R ++   P YQ  + ERA YL+  ++   EP +FEDFA  ++  PA
Sbjct: 1157 RRQDVSPNRDFLTHFYNIMHCGLLHIDQDIVNTIIKHCSPQFFSLGLPGATMLIMDFIIAAGRVASSA-----FLNAPRVEAQVLLGSLVCFPNLYCELPALHPSTPDIAVSQFTDVKELIIKTVLSSARDEPSGPARCVALCSLGIWICEELVH--ESHHPQIKEALNVICVSL---KFTNKTVAHVACNMLHMLVHYAPRLQTYQPDSPLKIIQILIATITHLLPSTEASSYEMDKRLVVSLLLCLLDWIMALPLKTLLQS--VHSTGA--------ENEKTEKSVLNCIYKVLHGCVYGAQ---------SFSHPKYFPISLSDLASVDYDPFMHLESLREPEPLHSPDSERSSKLQPVTEVKTQMQQGLISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSEST-------------ELSPELFDSPNIQFFVLNNTTLVSCIQIRSE------ESVPGG----GLAAGLVSANSNVRIIVRDLSGKYSWDSAILYGPPIVSGLPEPTSFILSMSYQEKPEEPPTSNECLEDITVKDGLSLQLRRFRETVPTWSTIREEEDVLDELLQYLGTTSPECLQRTGISLNVPAPQPVCISEKQENDVINAILKQYTEEKEFVEKHFND----------------LNMKASEQDEPTPQKPQSAFYYCRLLLSILGMNSWDKRRSFHLLKKNEKLLRELRNLDSRQCRETHKIAVFYVAEGQEDKYSILTNIGGSQAYEDFVAGLGWEVNLTNHCGFMGGLQKNKSTGLTTPYFATSTVEVIFHVSTRMPSESDDSLTKKLRHLGNDEVHIVWSEHTRDYRRGIIPTEFGDVLIVIYPMKNHMFSIQIMKKPEVPFFGPLFDGAIVNGKVLPIMVRSTAINASRALKSLIPLYQNLYEERARYLQTIVQHHLEPTTFEDFAAQVFS-PA 2024          

HSP 2 Score: 92.4337 bits (228), Expect = 9.460e-146
Identity = 44/176 (25.00%), Postives = 88/176 (50.00%), Query Frame = 3
Query:  735 PAQDTLNDSSRTPTK------HSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            P    L   S+TP+       H  ++ +Q+ +++  + +   D++  S   ++  S             V+ GGT+ GW  +   ++W+R +G+LG++  I +P++   +  Y  EL  +  K+R+N+ I   N  +P+PP+  PP+  + PW+F+   L   +   KL A +++C
Sbjct:  990 PVHSALGSRSQTPSPSTLNIDHMEQKDLQLDEKLHHSVLQTPDDLEISEFPSECCS-------------VMAGGTLTGWHADVATVMWRRMLGILGDVNAIMDPEIHAQVFDYLCELWQNLAKIRDNLGISADNLTSPSPPVLIPPLRILTPWLFKATMLTDKYKQGKLHAYKLIC 1152          
BLAST of Rap-GAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6GYQ0|RGPA1_HUMAN (Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1 PE=1 SV=1)

HSP 1 Score: 446.047 bits (1146), Expect = 2.348e-144
Identity = 301/933 (32.26%), Postives = 466/933 (49.95%), Query Frame = 2
Query: 1256 RKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLH-CYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLS---VDPLVEYPYLFDVKPVEGVTQEVNSP-----EVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHK-------YENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYV-------DNLLVELTEMNPEIFSNQ-------FPKPSAVESGQTS--LESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            R+ D+ P+ D L  FY ++H  +   ++  + T+I +    FF + L G+ +LI+DFI A   V  ++      +  P++E+  LLGS++ F +L         N   + +      K  I+  ++SSA+ EP   AR +++  + +  C  ++   E+    + +  N I + L   +F N  +A ++ +M+  LV+   ++Q   P  P KIIQ+L   I         S    DK+ + SL+  L+DW M LPL  LL+    H+ G         E+   +  ++N +       V   +            NP     + + L+    DP +    L + +P+     E +S      EV  + Q+  + +AAR  + HL+N++G YP +     L+S V E+HD    ++              +LS E+F +P +Q FV+N + LVS + + S+      ++ PGG         + S  S VR+I+RDL GKY WD A ++         E  + +   S +++   P           + +  SL  K  +   P  D +       D LL  L   +PE             P+P  +   Q +  + ++ K+   E+  VE +  D           L  K +    P    P+     + FY+CR +L+ LG  SW +R S  L++K+   L  L+N+D R+ RETHKIAV YVA GQEDK SIL NT GS  +  F++GLGW VNL NH GFMGGL+ +   G   PY+A ST+E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV+I+IYP++N +F I I  K E+  FGPLFDGA+V  K LP++VRATAINA R ++   P YQ F+ ERA YL+  ++   EP +FEDFA  ++
Sbjct: 1158 RRQDVSPNRDFLTHFYNIMHCGLLHIDQDIVNTIIKHCSPQFFSLGLPGATMLIMDFIVAAGRVASSA-----FLNAPRVEAQVLLGSLVCFPNLYCELPSLHPNIPDVAVSQFTDVKELIIKTVLSSARDEPSGPARCVALCSLGIWICEELVH--ESHHPQIKEALNVICVSL---KFTNKTVAHVACNMLHMLVHYVPRLQIYQPDSPLKIIQILIATITHLLPSTEASSYEMDKRLVVSLLLCLLDWIMALPLKTLLQP--FHATGA--------ESDKTEKSVLNCIYKVLHGCVYGAQ---------CFSNPRYFPMSLSDLASVDYDPFMHLESLKEPEPLHSPDSERSSKLQPVTEVKTQMQHGLISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSEST-------------ELSPELFESPNIQFFVLNNTTLVSCIQIRSE------ENMPGG----GLSAGLASANSNVRIIVRDLSGKYSWDSAILYGPPPVSGLSEPTSFMLSLSHQEKPEEPPTSNECLEDITVKDGLSLQFKRFRETVPTWDTIRDEEDVLDELLQYLGVTSPECLQRTGISLNIPAPQPVCISEKQENDVINAILKQHTEEKEFVEKHFND-----------LNMKAVEQDEPIPQKPQ-----SAFYYCRLLLSILGMNSWDKRRSFHLLKKNEKLLRELRNLDSRQCRETHKIAVFYVAEGQEDKHSILTNTGGSQAYEDFVAGLGWEVNLTNHCGFMGGLQKNKSTGLTTPYFATSTVEVIFHVSTRMPSDSDDSLTKKLRHLGNDEVHIVWSEHTRDYRRGIIPTEFGDVLIVIYPMKNHMFSIQIMKKPEVPFFGPLFDGAIVNGKVLPIMVRATAINASRALKSLIPLYQNFYEERARYLQTIVQHHLEPTTFEDFAAQVF 2022          

HSP 2 Score: 91.6633 bits (226), Expect = 2.348e-144
Identity = 44/176 (25.00%), Postives = 88/176 (50.00%), Query Frame = 3
Query:  735 PAQDTLNDSSRTPTK------HSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            P    L   S+TP+       H  ++ +Q+ +++  + +   D++  S   ++  S             V+ GGT+ GW  +   ++W+R +G+LG++  I +P++   +  Y  EL  +  K+R+N+ I   N  +P+PP+  PP+  + PW+F+   L   +   KL A +++C
Sbjct:  991 PVHSPLGSRSQTPSPSTLNIDHMEQKDLQLDEKLHHSVLQTPDDLEISEFPSECCS-------------VMAGGTLTGWHADVATVMWRRMLGILGDVNSIMDPEIHAQVFDYLCELWQNLAKIRDNLGISTDNLTSPSPPVLIPPLRILTPWLFKATMLTDKYKQGKLHAYKLIC 1153          
BLAST of Rap-GAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2PPJ7|RGPA2_HUMAN (Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=RALGAPA2 PE=1 SV=2)

HSP 1 Score: 418.698 bits (1075), Expect = 3.408e-136
Identity = 301/911 (33.04%), Postives = 457/911 (50.16%), Query Frame = 2
Query: 1256 RKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKF----QDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMK----SSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEE--QENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQK-SNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            R+ D+ P+ D L  FY ++H  + SE++  + T+I +    FF +   G  +L+ DFI A   VL T       +  P+ E+V++LGS++ F    Q++     V + N       D   Y   ++NIL+ +A +EP   AR +++  + +    +   +   TS    ++  I ++   ++F N  +A ++ D+++ LV+   ++Q     +P K+ ++L   +         S    DKKF+ SL+  L+DW M LP+S LL      S  ++    SA   +L  + I  V+      S++    S    T     ++  +P +   N    S +P V+Y    ++  +  V +E        R   E + L AR+ + HL+N++G YP +     L S V E+HD   V      +GS       +LS EVF +P LQ+FV N S L+S++       ++  +   GG P+           S+VR+I+RD+ GKY WD           V++   E     N         +   +    +  + +V + +    D +D LL  +   +PE        PS +   + SL         E+ I+E  L  N    +       +  ++  V  +  P        FYFCR +L  LG  SW RR +  L++K S +   LKN+D R+ RETHKIAV Y+A GQEDK SIL N  GS  +  F++GLGW V+L  H GFMGGL+ +G  G  APYYA ST+E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV IIIYP++N +F I I  K E+  FGPLFDGA+V  K LP LV AT INA R ++   P YQ F+ ERA YLE  I+   E M+FEDFA  ++
Sbjct: 1025 RRQDVLPNSDFLVHFYLVMHLGLTSEDQDILNTIIRHCPPRFFSLGFPGFSMLVGDFITAAARVLSTDI-----LTAPRSEAVTVLGSLVCFPNTYQEIPLLQSVPEVNEAITGTEDVKHY---LINILLKNATEEPNEYARCIAVCSLGVW---ICEELAQCTSH-PQVKEAINVIGVTLKFPNKIVAQVACDVLQLLVSYWEKLQMFETSLPRKMAEILVATVAFLLPSAEYSSVETDKKFIVSLLLCLLDWCMALPVSVLLHPV---STAVLEEQHSARAPLL--DYIYRVLHCCVCGSSTYTQQSHYILTLADLSSTDYDPFLPLANVK--SSEP-VQYHSSAELGNLLTVEEEKK------RRSLELIPLTARMVMAHLVNHLGHYPLSGGPAILHSLVSENHDNAHV------EGS-------ELSFEVFRSPNLQLFVFNDSTLISYL-------QTPTEGPVGGSPV--------GSLSDVRVIVRDISGKYSWD---------GKVLYGPLEGCLAPNGRNPSFLISSWHRDTFGPQKDSSQVEEGD----DVLDKLLENIGHTSPECL-----LPSQLNLNEPSLTPCGMNYDQEKEIIEVILRQNAQEDEYIQSHNFDSAMK--VTSQGQPSPVEPRGPFYFCRLLLDDLGMNSWDRRKNFHLLKKNSKLLRELKNLDSRQCRETHKIAVFYIAEGQEDKCSILSNERGSQAYEDFVAGLGWEVDLSTHCGFMGGLQRNGSTGQTAPYYATSTVEVIFHVSTRMPSDSDDSLTKKLRHLGNDEVHIVWSEHSRDYRRGIIPTAFGDVSIIIYPMKNHMFFIAITKKPEVPFFGPLFDGAIVSGKLLPSLVCATCINASRAVKCLIPLYQSFYEERALYLEAIIQNHREVMTFEDFAAQVF 1861          

HSP 2 Score: 91.6633 bits (226), Expect = 3.408e-136
Identity = 98/428 (22.90%), Postives = 182/428 (42.52%), Query Frame = 3
Query:    6 MMGKILYNVDMNDLPLDK--KEKRGRRAKKTASSKPLKKLSMNDESILTAPHNQESNIHSYKTNT-MTGILNFQPHTAFIDGLNHNLEDSAASNVEQKNNV--NIKSDVKESNQGEFNKGVLYENNEMDAGS--FAYSSHEETSSYMSAEDSSSPHCKDKNI---EPNTGAHSDNEFIPLSSSGGDTSIEGNSSFDNSIKPIYKDESEDLNIDADD---ESEGENVENAYFEVESKSATL-TRDESDVDISSQMYRFPAQDTLNDSS-RTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            ++ + +Y V+M +LPLDK  ++K  ++  K     P K  ++     L           S++++  +T  + F+  T            S A  VE+  N+     ++V+E  Q E         N   AGS        ++     S  D   P C D +      NT   S +E  P+  + G    E        I  + +  S    +D  D   +++G+  E    E  +   TL   +E+++ +       P Q    D    TPT         ++    R+ + +     +++T++ +       +DD +   ++ GG++ GW  +S  +LW+R +G+LG++  I++PK+   +  Y  EL     K+R+N+ I   NQ +P+PP+  PP+     W+F+   L + +   KL A R++C
Sbjct:  650 VLARTVYGVEMTNLPLDKLSEQKEKKQRGKGCVLDPQKGTTVGRSFSL-----------SWRSHPDVTEPMRFRSATT-----------SGAPGVEKARNIVRQKATEVEECQQSE---------NAPAAGSGHLTVGQQQQVLRSSSTSDIPEPLCSDSSQGQKAENTQNSSSSEPQPIQENKGHVKRE-----HEGITILVRRSSSPAELDLKDDLQQTQGKCRERQKSESTNSDTTLGCTNEAELSMG------PWQTCEEDPELNTPTD-------VVADADARHWLQLSPTDASNLTDSSE-----CLTDDCS---IIAGGSLTGWHPDSAAVLWRRVLGILGDVNNIQSPKIHARVFCYLYELWYKLAKIRDNLAISLDNQSSPSPPVLIPPLRMFASWLFKAATLPNEYKEGKLQAYRLIC 1020          
BLAST of Rap-GAP domain-containing protein vs. UniProt/SwissProt
Match: sp|P86411|RGPA2_RAT (Ral GTPase-activating protein subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Ralgapa2 PE=1 SV=1)

HSP 1 Score: 433.335 bits (1113), Expect = 3.540e-133
Identity = 300/922 (32.54%), Postives = 461/922 (50.00%), Query Frame = 2
Query: 1229 NAYPL--QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSG-SYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPE-IFSNQF------PKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNH--HCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQK-SNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
             AY L   +  R+ D+ P+ D L  FY ++H  + SE++  + T+I N    FF + L G  +L+ DFI A   VL T       +  P+ E+++LLGS++ F +      +  +  +  +++      K  ++NIL+ +A +EP   AR ++I  + +     L+   +       +++ I ++   ++F N  +A ++ D+++ LV+   ++Q     +P K+ ++L   I         S    DKKF+ SL+  L+DW M LP+S LL          ++ + + L + +       V  SST  +  S    T     ++  +P +   N    + +P V+Y    D+  +  V +E        R   E + L AR+ + HL+N++G YP +     L S V E+HD   V+               +LS EVF +P LQ+FV N S L+S++   ++         P G      ++D       VR+I+RD+ GKY WD   ++      +          +           +NL + +  +           D +D LL  +   +PE +  +Q       P PSA+   Q       +++IIE  + ++   D +   C   S  K+  +   S V    P         FYFCR +L  LG  SW RR +  L++K S +   LKN+D R+ RETHKIAV Y+A GQEDK SIL N  GS  +  F++GLGW V+L  H GFMGGL+ +G  G  APYYA ST+E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV IIIYP++N +F I I  K E+  FGPLFDGA+V  K LP L+ AT INA R ++   P YQ F+ ERA YLE  I+   E M+FEDFA  ++
Sbjct: 1013 QAYKLICAMMTRRQDVLPNSDFLVHFYLVMHLGLTSEDQDVLNTIIKNCSPRFFSLGLPGFSMLVGDFITAAARVLSTD-----MLAAPRSEALTLLGSLVCFPNTYQEIPLLQSVPEVSDVVTGAEDVKHYLINILLKNATEEPNECARCIAICSLGVWICEELAQCASHP----QVKDAINVIGVTLKFPNKIVAQVACDVLQLLVSYWEKLQMFETALPRKMAEILVATIAFLLPSAEYSSVETDKKFIVSLLLCLLDWCMALPVSALLHPVSTAVIEELHPSRAPLLDYIYRVLHCCVCGSSTYTQ-QSHYTLTLADLSSTDYDPFLPLANVR--NSEP-VQYHSSADLGNLLTVEEEKK------RRSVELIPLTARMVMAHLVNHLGHYPLSGGPAVLHSLVSENHDNAHVEGT-------------ELSSEVFRSPNLQLFVFNDSTLISYLQTPAE--------GPAGGTSGGSLSD-------VRVIVRDISGKYSWDGKVLYGPLEGRLAPSGRNPSFQISGWHHHTCGPQSNLFHGEEGD-----------DVLDKLLENIGHTSPECLLPSQLNLNEPSPTPSAMNCDQ-------EKEIIEVILRQSTQEDEYVQRCHSNSAVKVTSQGQPSPVEPRGP---------FYFCRLLLDDLGMNSWDRRKNFHLLKKNSKLLRELKNLDSRQCRETHKIAVFYIAEGQEDKCSILANERGSQAYEDFVAGLGWEVDLSTHCGFMGGLQRNGSTGQTAPYYATSTVEVIFHVSTRMPSDSDDSLTKKLRHLGNDEVHIVWSEHSRDYRRGIIPTAFGDVSIIIYPMKNHMFFITITKKPEVPFFGPLFDGAIVSGKLLPSLICATCINASRAVKCLIPLYQSFYEERALYLEAIIQNHREVMTFEDFAAQVF 1860          

HSP 2 Score: 67.3958 bits (163), Expect = 3.540e-133
Identity = 36/107 (33.64%), Postives = 63/107 (58.88%), Query Frame = 3
Query:  924 VLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            ++ GG + GW  +S  +LW+R +G+LG++  I++PK+   +  Y  EL     K+R+N+ I   NQ +P+PPL  PP+     W+F+   L + +   KL A +++C
Sbjct:  913 IIAGGNLTGWHPDSAAVLWRRVLGILGDVNNIQSPKIHAKVFSYLYELWYKLAKIRDNLAISLDNQSSPSPPLLIPPLRMFASWLFKATTLPNEYKEGKLQAYKLIC 1019          
BLAST of Rap-GAP domain-containing protein vs. TrEMBL
Match: A0A1S3IQ71 (ral GTPase-activating protein subunit alpha-1-like isoform X3 OS=Lingula unguis OX=7574 GN=LOC106166146 PE=4 SV=1)

HSP 1 Score: 511.531 bits (1316), Expect = 9.018e-169
Identity = 330/987 (33.43%), Postives = 525/987 (53.19%), Query Frame = 2
Query: 1247 ITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDI----INVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFR--SQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVID-------------------YVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSM---SNVDGSSKGRDS 4120
            I++R+ D+   +DHL+QFY+++H  + S ++  +  L+ + G  FF +PL GS +L+LDF+ A   +  ++D +    E P+ E+VS+LGS+L   +      V   +   + ++     K  ++++++   K+EP   AR ++I  + +  Y  LS      S  + ++  + +LL++++F++  +A ++ DM+R L +    + E  P +P+KII+V++  ++          +  +K+ L S++F +++W MH+PL  LLE +D   + ++Y  F  L NV     +      +M  STS      +++  E  +     P          S  P        D+ P  G  Q+  SP V        + VKLAARV LCHL+N++G +P        ++ VQE+HDF           SP     D+LS ++F  P +Q FV+N + L+SFV + + L        PGG  +T  +T   + ++  R+IIRD+ GKY WD A +  Y   +    S + + +   +             E+++ L+ L+ E   ID                    +D+LL  + + +PE    Q  +P  + +G     S +  Q    ++ E    + ++  +    K +  K  +  P  +P  ++T  T    CR +L QLGFL+W +R S DL+ KS+  L  LKN+D++R RETHKIAV+YV  GQEDK+SIL    GS  +  F++GLGW V+LE+H GF+GGL+ +  +G  APYYA ST+E++FHVST MPS++      K +HLGNDE+ +IWSE+ RDYR  I  T FGDV+IIIYPL+N L+ I I  K E+  FGPLFDGA+V +K LP LVRATAINA R  R   P++Q FF ERA YL+  I++  +P  FEDFA +++  P L Q +      +T L P+T +      +  +  E  SS    S++   S+G DS
Sbjct: 1112 ISLRRHDVPLPMDHLSQFYRVLHEGLMSNDQDVVNALVRHCGPRFFSMPLPGSTILLLDFLHAANTIASSTDLK----EAPRTEAVSILGSLLCLPNHFGQLSVLQPSPVEMTMMWCNDLKDHLISMVLKCGKKEPAGLARCVAISSLGIFIYEELSH----GSMHSKMKEAVNVLLAVLKFNSKLVAQVACDMLRLLCDHIPTLLEHQPDLPKKIIEVMASTLSSLLPASEHQHSEEEKRLLVSIMFCMLEWCMHMPLHTLLEKSD-SGRSILYRVFRVL-NVAVVGGVSMLTPKMMHPSTSFADFYAQESDVEGVKDGANTPT--------FSKTP--------DLAP--GTPQKPASPTVDLLNIGNMDLVKLAARVVLCHLVNHLGHFPMGGGAAKSNTFVQEYHDF-----------SP---ALDELSTDIFRAPNVQFFVLNNTTLISFVEIPALL------DLPGGG-VTAGLT---TGKTVARVIIRDIVGKYSWDSAIL--YGPPSCQAGSYQPEISPLMNFFDELLDLAPSTVEQTI-LEYLRAESRTIDPAVHPSEVRELLRLGEDYDCLDHLLQYIGQTSPEC-ELQPGEPLNIAAGLPDQLSDTMEQETMATLQEQQSQEENYTAEHEKDKSMSAKSTTPAPSHDP--VSTFQT----CRMLLNQLGFLTWIKRTSFDLLHKSDKLLRELKNLDKQRCRETHKIAVIYVGEGQEDKQSILTTQAGSKAYEDFVAGLGWEVDLEHHTGFLGGLQQNKSSGDTAPYYATSTMEVIFHVSTRMPSDSSDAVHRKLRHLGNDEIQIIWSEHSRDYRRGIIPTEFGDVLIIIYPLQNELYRIQINRKPEVPYFGPLFDGAIVDQKVLPGLVRATAINASRTKRAQLPYFQPFFEERAKYLDNIIQQHKQPSMFEDFAANVFA-PVLPQAEDIPTLQTT-LGPMTTSGLLGDQSSVSVQEEDSSQSPHSSIGRHSRGSDS 2034          

HSP 2 Score: 115.161 bits (287), Expect = 9.018e-169
Identity = 56/144 (38.89%), Postives = 88/144 (61.11%), Query Frame = 3
Query:  819 ERNSMNIEDNIVNSITNTQDLSNQVVTSDDL--NAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            +R S++IE+      T  ++L + V+T      ++  VL GG V GW+ E+ V+LW+R +G LG+I  IK+P +  S+ +YF +LTDS IK+REN  +   NQ +P  P + PPI  I PW+F+  +L   +   +L+A R+LC
Sbjct:  972 DRESIHIEEE-----TPDENLLSPVLTMHSCPEDSRCVLAGGNVTGWTPEAAVILWRRMLGALGDINQIKDPDIHASVFEYFCDLTDSLIKVRENQSVTPDNQSSPIRPEFIPPILMIAPWLFRAVELQDRYKRGRLLAYRLLC 1110          
BLAST of Rap-GAP domain-containing protein vs. TrEMBL
Match: A0A1S3IPB2 (ral GTPase-activating protein subunit alpha-1-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106166146 PE=4 SV=1)

HSP 1 Score: 507.294 bits (1305), Expect = 1.913e-167
Identity = 331/990 (33.43%), Postives = 524/990 (52.93%), Query Frame = 2
Query: 1247 ITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSL---MRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDI----INVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFR--SQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVID-------------------YVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSM---SNVDGSSKGRDS 4120
            I++R+ D+   +DHL+QFY+++H  + S ++  +  L+ + G  FF +PL GS +L+LDF+ A   +  ++D +    E P+ E+VS+LGS+L   +      V   +   + ++     K  ++++++   K+EP   AR ++I  + +  Y  LS   +  S + +  N +L +L +   + F++  +A ++ DM+R L +    + E  P +P+KII+V++  ++          +  +K+ L S++F +++W MH+PL  LLE +D   + ++Y  F  L NV     +      +M  STS      +++  E  +     P          S  P        D+ P  G  Q+  SP V        + VKLAARV LCHL+N++G +P        ++ VQE+HDF           SP     D+LS ++F  P +Q FV+N + L+SFV + + L        PGG  +T  +T   + ++  R+IIRD+ GKY WD A +  Y   +    S + + +   +             E+++ L+ L+ E   ID                    +D+LL  + + +PE    Q  +P  + +G     S +  Q    ++ E    + ++  +    K +  K  +  P  +P  ++T  T    CR +L QLGFL+W +R S DL+ KS+  L  LKN+D++R RETHKIAV+YV  GQEDK+SIL    GS  +  F++GLGW V+LE+H GF+GGL+ +  +G  APYYA ST+E++FHVST MPS++      K +HLGNDE+ +IWSE+ RDYR  I  T FGDV+IIIYPL+N L+ I I  K E+  FGPLFDGA+V +K LP LVRATAINA R  R   P++Q FF ERA YL+  I++  +P  FEDFA +++  P L Q +      +T L P+T +      +  +  E  SS    S++   S+G DS
Sbjct: 1112 ISLRRHDVPLPMDHLSQFYRVLHEGLMSNDQDVVNALVRHCGPRFFSMPLPGSTILLLDFLHAANTIASSTDLK----EAPRTEAVSILGSLLCLPNHFGQLSVLQPSPVEMTMMWCNDLKDHLISMVLKCGKKEPAGLARCVAISSLGIFIYEELSH-GSMHSKMKEAVNVLLAVLKVWPSINFNSKLVAQVACDMLRLLCDHIPTLLEHQPDLPKKIIEVMASTLSSLLPASEHQHSEEEKRLLVSIMFCMLEWCMHMPLHTLLEKSD-SGRSILYRVFRVL-NVAVVGGVSMLTPKMMHPSTSFADFYAQESDVEGVKDGANTPT--------FSKTP--------DLAP--GTPQKPASPTVDLLNIGNMDLVKLAARVVLCHLVNHLGHFPMGGGAAKSNTFVQEYHDF-----------SP---ALDELSTDIFRAPNVQFFVLNNTTLISFVEIPALL------DLPGGG-VTAGLT---TGKTVARVIIRDIVGKYSWDSAIL--YGPPSCQAGSYQPEISPLMNFFDELLDLAPSTVEQTI-LEYLRAESRTIDPAVHPSEVRELLRLGEDYDCLDHLLQYIGQTSPEC-ELQPGEPLNIAAGLPDQLSDTMEQETMATLQEQQSQEENYTAEHEKDKSMSAKSTTPAPSHDP--VSTFQT----CRMLLNQLGFLTWIKRTSFDLLHKSDKLLRELKNLDKQRCRETHKIAVIYVGEGQEDKQSILTTQAGSKAYEDFVAGLGWEVDLEHHTGFLGGLQQNKSSGDTAPYYATSTMEVIFHVSTRMPSDSSDAVHRKLRHLGNDEIQIIWSEHSRDYRRGIIPTEFGDVLIIIYPLQNELYRIQINRKPEVPYFGPLFDGAIVDQKVLPGLVRATAINASRTKRAQLPYFQPFFEERAKYLDNIIQQHKQPSMFEDFAANVFA-PVLPQAEDIPTLQTT-LGPMTTSGLLGDQSSVSVQEEDSSQSPHSSIGRHSRGSDS 2040          

HSP 2 Score: 115.161 bits (287), Expect = 1.913e-167
Identity = 56/144 (38.89%), Postives = 88/144 (61.11%), Query Frame = 3
Query:  819 ERNSMNIEDNIVNSITNTQDLSNQVVTSDDL--NAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            +R S++IE+      T  ++L + V+T      ++  VL GG V GW+ E+ V+LW+R +G LG+I  IK+P +  S+ +YF +LTDS IK+REN  +   NQ +P  P + PPI  I PW+F+  +L   +   +L+A R+LC
Sbjct:  972 DRESIHIEEE-----TPDENLLSPVLTMHSCPEDSRCVLAGGNVTGWTPEAAVILWRRMLGALGDINQIKDPDIHASVFEYFCDLTDSLIKVRENQSVTPDNQSSPIRPEFIPPILMIAPWLFRAVELQDRYKRGRLLAYRLLC 1110          
BLAST of Rap-GAP domain-containing protein vs. TrEMBL
Match: A0A1S3IPB9 (ral GTPase-activating protein subunit alpha-1-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106166146 PE=4 SV=1)

HSP 1 Score: 505.753 bits (1301), Expect = 4.547e-167
Identity = 332/994 (33.40%), Postives = 524/994 (52.72%), Query Frame = 2
Query: 1247 ITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLL-------SLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDI----INVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFR--SQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVID-------------------YVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSM---SNVDGSSKGRDS 4120
            I++R+ D+   +DHL+QFY+++H  + S ++  +  L+ + G  FF +PL GS +L+LDF+ A   +  ++D +    E P+ E+VS+LGS+L   +      V   +   + ++     K  ++++++   K+EP   AR ++I  + +  Y  LS   +  S + +  N +L +L       S  +F++  +A ++ DM+R L +    + E  P +P+KII+V++  ++          +  +K+ L S++F +++W MH+PL  LLE +D   + ++Y  F  L NV     +      +M  STS      +++  E  +     P          S  P        D+ P  G  Q+  SP V        + VKLAARV LCHL+N++G +P        ++ VQE+HDF           SP     D+LS ++F  P +Q FV+N + L+SFV + + L        PGG  +T  +T   + ++  R+IIRD+ GKY WD A +  Y   +    S + + +   +             E+++ L+ L+ E   ID                    +D+LL  + + +PE    Q  +P  + +G     S +  Q    ++ E    + ++  +    K +  K  +  P  +P  ++T  T    CR +L QLGFL+W +R S DL+ KS+  L  LKN+D++R RETHKIAV+YV  GQEDK+SIL    GS  +  F++GLGW V+LE+H GF+GGL+ +  +G  APYYA ST+E++FHVST MPS++      K +HLGNDE+ +IWSE+ RDYR  I  T FGDV+IIIYPL+N L+ I I  K E+  FGPLFDGA+V +K LP LVRATAINA R  R   P++Q FF ERA YL+  I++  +P  FEDFA +++  P L Q +      +T L P+T +      +  +  E  SS    S++   S+G DS
Sbjct: 1112 ISLRRHDVPLPMDHLSQFYRVLHEGLMSNDQDVVNALVRHCGPRFFSMPLPGSTILLLDFLHAANTIASSTDLK----EAPRTEAVSILGSLLCLPNHFGQLSVLQPSPVEMTMMWCNDLKDHLISMVLKCGKKEPAGLARCVAISSLGIFIYEELSH-GSMHSKMKEAVNVLLAVLKYSTNQLSDPKFNSKLVAQVACDMLRLLCDHIPTLLEHQPDLPKKIIEVMASTLSSLLPASEHQHSEEEKRLLVSIMFCMLEWCMHMPLHTLLEKSD-SGRSILYRVFRVL-NVAVVGGVSMLTPKMMHPSTSFADFYAQESDVEGVKDGANTPT--------FSKTP--------DLAP--GTPQKPASPTVDLLNIGNMDLVKLAARVVLCHLVNHLGHFPMGGGAAKSNTFVQEYHDF-----------SP---ALDELSTDIFRAPNVQFFVLNNTTLISFVEIPALL------DLPGGG-VTAGLT---TGKTVARVIIRDIVGKYSWDSAIL--YGPPSCQAGSYQPEISPLMNFFDELLDLAPSTVEQTI-LEYLRAESRTIDPAVHPSEVRELLRLGEDYDCLDHLLQYIGQTSPEC-ELQPGEPLNIAAGLPDQLSDTMEQETMATLQEQQSQEENYTAEHEKDKSMSAKSTTPAPSHDP--VSTFQT----CRMLLNQLGFLTWIKRTSFDLLHKSDKLLRELKNLDKQRCRETHKIAVIYVGEGQEDKQSILTTQAGSKAYEDFVAGLGWEVDLEHHTGFLGGLQQNKSSGDTAPYYATSTMEVIFHVSTRMPSDSSDAVHRKLRHLGNDEIQIIWSEHSRDYRRGIIPTEFGDVLIIIYPLQNELYRIQINRKPEVPYFGPLFDGAIVDQKVLPGLVRATAINASRTKRAQLPYFQPFFEERAKYLDNIIQQHKQPSMFEDFAANVFA-PVLPQAEDIPTLQTT-LGPMTTSGLLGDQSSVSVQEEDSSQSPHSSIGRHSRGSDS 2044          

HSP 2 Score: 115.161 bits (287), Expect = 4.547e-167
Identity = 57/144 (39.58%), Postives = 89/144 (61.81%), Query Frame = 3
Query:  819 ERNSMNIEDNIVNSITNTQDLSNQVVT--SDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            +R S++IE+      T  ++L + V+T  S   ++  VL GG V GW+ E+ V+LW+R +G LG+I  IK+P +  S+ +YF +LTDS IK+REN  +   NQ +P  P + PPI  I PW+F+  +L   +   +L+A R+LC
Sbjct:  972 DRESIHIEEE-----TPDENLLSPVLTMHSCPEDSRCVLAGGNVTGWTPEAAVILWRRMLGALGDINQIKDPDIHASVFEYFCDLTDSLIKVRENQSVTPDNQSSPIRPEFIPPILMIAPWLFRAVELQDRYKRGRLLAYRLLC 1110          
BLAST of Rap-GAP domain-containing protein vs. TrEMBL
Match: V3ZXJ4 (Rap-GAP domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_210880 PE=4 SV=1)

HSP 1 Score: 460.299 bits (1183), Expect = 5.586e-149
Identity = 314/953 (32.95%), Postives = 491/953 (51.52%), Query Frame = 2
Query: 1232 AYPL--QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLN-DIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDL---------------HSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFES--KRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHK---------------YENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVI---DYVDNLLVELTEMNPEIFSNQFPKPSAV-----ESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYG 3958
            AY L  QI I++ DI P +D L+Q+Y ++H  + S ++     LI N G  +F  PL  S +L+LDFI+A   ++ T+ D N   E P+ E+VSLLG ++ F +      V   NS     +     K+ I++ L+ + K+EP   AR +++  I +  Y      E T   L+  I++ I +LL+ ++  N  +A ++ DM+  L +   ++      +P+KI++V+   I+        S    +K+ +  ++F L++W + +P+  L+E+ D                HS   +  + ++L + + D+D  NV  S +    SS K    +S  +   +K P                + P +FD        Q    PE       + VKLAAR  + HL+NN+  +P  +    L++ VQEHHD             PE +  +DL  ++F+   +Q FV+N   LVSF+ L +K        APGG  +T  +T   + ++  R+++RD+ GK+CW+ + ++                 E++++  +SS     + P P           + +++N         +    D +D+LL  +   +PE    +  KP  +     E      E +    +++Q   E   +  H     +  +  E +L    P E P EI    + F  CR +L Q+G +SW +R   DL++K++  L  LKN+D ++ RETHKIAV+YVA GQEDK SIL NT GS ++ TF++GLGW V+LENH+GF+GGL+ +   G  APYYANS+ E++FHVST MP      K  K +HLGNDEV ++WSE+ RDYR  I  T FGD++IIIYPL  GL+ I I  K E+  FGPLFDG++V  K LP LVRATA+NA R  R   P +  F+ ERA  LE  I++  EP +FEDFA +I+ 
Sbjct: 1089 AYQLLCQIMIQRHDITPALDILSQYYYILHHGLLSSDQDVANVLIRNCGAKYFSCPLPASRLLMLDFIQAASSII-TAMDVN---EPPRAEAVSLLGCLICFPNHFQEMPVLKPNSVDRITLTCNDMKNHIIDSLLVAGKREPAGHARCIAVSSIGIFLYE-----ELTHGTLHPKIKDGIDILLAALKCVNRKVAKVASDMLMLLCDHTDKLLNYHSHLPKKIVEVIVSTISGLLGHHENSSTEEEKRLIVLMMFNLIEWCIKIPIHLLMETTDTDKSCLYKVLHAAVTGHSSTSLPRSANSLSDFMSDSDFNNVTDSHSPTINSSPKSYASDSVLEEQILKTP----------------DTPNVFD--------QPRQPPET------DIVKLAARTLMKHLVNNLCHFPMGSGPARLNTLVQEHHDI------------PEYIE-EDLKPDIFSAANVQFFVLNHRCLVSFIELPAK-------DAPGGG-VTAGLT---TAKTVCRVVVRDVGGKFCWESSVLYSPPWCKKDMELEPLIIQEDSDINIESSPSTRQLAPVPA----------SSRTINTLPSYSTTGIQNGDDNLDDLLSFIGNTSPECLL-RLGKPLNINPPIPEDLCDQAEGMMTTMVLDQRQAELEYYKQHK----ADVRQREIELMLAKP-ELPDEIEDPISPFQMCRMLLDQMGLMSWDKRCQFDLLKKTDKLLRELKNLDNQKCRETHKIAVIYVATGQEDKNSILSNTAGSRDYETFVAGLGWEVDLENHQGFLGGLQKNKTTGDTAPYYANSSCEVIFHVSTRMPVGTDESKHIKMRHLGNDEVHIVWSEHSRDYRRGIIPTEFGDIIIIIYPLPCGLYRIQINRKHEVPYFGPLFDGSIVDSKVLPGLVRATAVNASRIKRSLMPFFHSFYEERAKCLETIIQQNTEPTTFEDFAAYIFA 1962          

HSP 2 Score: 100.523 bits (249), Expect = 5.586e-149
Identity = 43/108 (39.81%), Postives = 66/108 (61.11%), Query Frame = 3
Query:  924 VLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1247
            VL GG V GW  +  V+LWKR IG LGNI  I++P +  S+ +Y  +L D+  +MREN+ + + N ++P PP+  P     + W+F+  KLD  +   KL A ++LC+
Sbjct:  988 VLSGGHVTGWMPDVAVVLWKRMIGCLGNINKIEDPAIHASVFEYLSDLQDTMFRMRENLGVTSDNMISPQPPILIPEQHKFISWLFECIKLDERYKEGKLFAYQLLCQ 1095          
BLAST of Rap-GAP domain-containing protein vs. TrEMBL
Match: A0A2I3BRX9 (Ral GTPase-activating protein subunit alpha-1 OS=Mus musculus OX=10090 GN=Ralgapa1 PE=1 SV=1)

HSP 1 Score: 455.677 bits (1171), Expect = 1.246e-146
Identity = 318/989 (32.15%), Postives = 486/989 (49.14%), Query Frame = 2
Query: 1256 RKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLH-CYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNP---AIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSP-----EVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKY-------ENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVI-------DYVDNLLVELTEMNPEIFSNQ-------FPKPSAVESGQTS--LESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSKGRDSV 4123
            R+ D+ P+ D L  FY ++H  +   ++  + T+I +    FF + L G+ +LI+DFI A   V  ++      +  P++E+  LLGS++ F +L         N   I +      K  I+  ++SSA+ EP   AR +++  + +  C  ++   E+    + +  N I + L   +F N  +A ++ +M+  LV+   ++Q   P  P KIIQ+L   I         S    DK+ + SL+  L+DW M LPL  LL+   +H+ G         EN   +  ++N +       V   +         S  NP    I   +   +  DP +    L + +P+     E +S      EV  + Q   + +AAR  + HL+N++G YP +     L+S V E+HD    ++              +LS E+F +P +Q FV+N + LVS + + S+      +S PGG         + S  S VR+I+RDL GKY WD A ++         E  + I   S++++   P           + +  SL L+  +   P         D +D LL  L   +PE             P+P  +   Q +  + ++ K+   E+  VE +  D                L      ++ P      + FY+CR +L+ LG  SW +R S  L++K+   L  L+N+D R+ RETHKIAV YVA GQEDK SIL N  GS  +  F++GLGW VNL NH GFMGGL+ +   G   PY+A ST+E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV+I+IYP++N +F I I  K E+  FGPLFDGA+V  K LP++VR+TAINA R ++   P YQ F+ ERA YL+  ++   EP +FEDFA  ++  PA        A S  E+ P    SD         ++L S MS    +SK R S+
Sbjct: 1613 RRQDVSPNRDFLTHFYNIMHCGLLHIDQDIVNTIIKHCSPQFFSLGLPGATMLIMDFIIAAGRVASSA-----FLNAPRVEAQVLLGSLVCFPNLYCELPALHPNIPDIAVSQFTDVKELIIKTVLSSARDEPSGPARCVALCSLGIWICEELVH--ESHHPQIKEALNVICVSL---KFTNKTVAHVACNMLHMLVHYVPRLQIHQPQSPLKIIQILIATITHLLPSTEASSYEMDKRLVVSLLLCLLDWIMALPLKTLLQP--VHATGA--------ENDKTEKSVLNCIYKVLHGCVYGAQ---------SFSNPKYFPISLSDLASVDYDPFMHLESLKEPEPLHSPDSERSSKLQPVTEVKTQMQQGLISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSEST-------------ELSPELFESPNIQFFVLNNTTLVSCIQIRSE------ESMPGG----GLAAGLVSANSNVRIIVRDLSGKYSWDSAILYGPPIVSGLPEPTSFILSMSDQEKPEEPPTSNECLEDIAVKDGLSLQLRRFRETVPTWSTIREEEDVLDELLQYLGTTSPECLQRTGISLNVPAPQPLCISEKQENDVINAILKQYTEEKEFVEKHFND----------------LNMKASEQDEPTPQKPQSAFYYCRLLLSILGMNSWDKRRSFHLLKKNEKLLRELRNLDSRQCRETHKIAVFYVAEGQEDKYSILTNIGGSQAYEDFVAGLGWEVNLTNHCGFMGGLQKNRSTGLTTPYFATSTVEVIFHVSTRMPSDSDDSLTKKLRHLGNDEVHIVWSEHTRDYRRGIIPTEFGDVLIVIYPMKNHMFSIQIMKKPEVPFFGPLFDGAIVNGKVLPIMVRSTAINASRALKSLIPLYQNFYEERARYLQTIVQHHLEPTTFEDFAAQVFS-PAPYHHFPADAGSYPEIPP----SDAAPAAQVDGADLASPMS--PRTSKSRMSM 2526          

HSP 2 Score: 97.4413 bits (241), Expect = 1.246e-146
Identity = 45/170 (26.47%), Postives = 88/170 (51.76%), Query Frame = 3
Query:  735 PAQDTLNDSSRTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            P    L   S+TP+  +  R       IE+  + +++ + +S+  T D  +  ++        V+ GGT+ GW  +   ++W+R +G+LG++  I +P++   +  Y  EL  +  K+R+N+ I   N  +P+PP+  PP+  + PW+F+   L   +   KL A +++C
Sbjct: 1446 PVHSALGSRSQTPSPSTLSRA-----HIEQKDLQLDEKLHHSVLQTPD--DLEISEFPSECCSVMAGGTLTGWHADVATVMWRRMLGILGDVNAIMDPEIHAQVFDYLCELWQNLAKIRDNLGISADNLTSPSPPVLIPPLRILTPWLFKATMLTDKYKQGKLHAYKLIC 1608          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Cavefish
Match: ralgapa2 (Ral GTPase activating protein, alpha subunit 2 (catalytic) [Source:ZFIN;Acc:ZDB-GENE-131122-56])

HSP 1 Score: 438.343 bits (1126), Expect = 9.613e-140
Identity = 321/975 (32.92%), Postives = 480/975 (49.23%), Query Frame = 2
Query: 1265 DIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINII-DSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGL---IYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHK-YENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPE----KPVIDYVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPY-----ENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQK-SNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPA-----LNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSKGRDSVIS 4129
            D+ P+ D L   Y ++H    S+++  + T+I      FF + L G  +L+ DFI A   VL          E P++E+ +LLGS++ F  L        A   T +I+      K  +VNIL+ +A+ EP   AR ++I  + L     L   +      + +++ I +L   ++F N  +A ++ D+ + L+     +Q+    +P++II++    I         S    DKK + SL+  L+DW M +PLS LLE   +   GL   I      L+ + +   +++   S ++L           +  ++  +P +  G     S +P   +    D   +  V +E        R   E + L AR+ + HL+N++G +P +     L S V E+HD   V++              +LS EVF +P LQ+FV N S LVS++ + S+            PP            SEVR+I+RD+ GKY WD + ++K  E  N+   S EE+ +         T  ++ ++  S +           +  +D +D LL +L   +PE      P+P    + Q +   +     IE +I+E      H   K    ++  +  RS  P      + PP        FYFCR +L  LG  SW RR S  L++K S +   LKN+D R+ RETHKIAV Y+  GQEDK SIL NT GS  +  F+SGLGW V+L  H GFMGGL+ +G  G  APYYA ST+E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV+IIIYP++N +F I I  K ++  FGPLFDGA+V    LP LVRAT INA R ++     YQ F+ ERA YLE  I    E M FEDFA  ++  P+     ++   S   ++S ELS    TS++ +    T    T   S V G  +   S IS
Sbjct:  960 DVLPNSDFLVYLYHVMHKGFTSDDQDVLNTMIRWCSPRFFFLGLPGFTMLVGDFITAAARVLGAD-----SFEAPRIEAQTLLGSLVCFPSLYQQIPSLQAIPGTQDIVVGREDIKDYLVNILLKTARNEPSEGARCVAICSLGLWVCEELGQQKIH----HQVKDAINVLGVTLKFGNKAVAHVACDIFQLLICHWQHLQKLEHSLPKRIIEIFVATIAFLLPSAEHSTMEGDKKLMVSLLLCLLDWCMAVPLSILLEP--ISMIGLDDSITQKAPLLDYIYR---VLHCCVSGSNLHTQQSHYLLSLADLSTDYDPFLPLGQVK--SSEPQPMHSAAGDFGSLLTVAEEKK------RRNMELIPLTARMIMMHLVNHLGHHPLSGGPALLHSLVNENHDNPYVESS-------------ELSSEVFKSPNLQLFVFNDSTLVSYLQIPSE--------GSSAPP--------REHASEVRVIVRDISGKYSWDGSILYKTLEGTNLHCSSGEEEASFHQHQHHHHTDRSSTSSRPSSSHTSRCSSAVELEDSVDALDQLLEDLGISSPECL----PQPQQTLN-QPAPPPMGMNHDIETAIMEAI----HRQTKQEEEEVAWR--RSEDPSVRAANQRPPSQQDPKAPFYFCRLLLNDLGMNSWDRRKSFHLLKKNSKLLRELKNLDSRQCRETHKIAVFYIGEGQEDKYSILSNTEGSQVYEVFVSGLGWEVDLATHCGFMGGLQRNGSTGTTAPYYATSTVEVIFHVSTRMPSDSDDSITKKLRHLGNDEVQIVWSEHTRDYRRGIIPTDFGDVLIIIYPMKNHMFFIQIMKKPQVPFFGPLFDGAIVTGTLLPSLVRATCINASRAVKSRLTLYQSFYEERALYLEAIILNHKENMMFEDFAAQVFS-PSPTYYPMSGTGSLSGSTSAELSVTVTTSESSEQVSPTLPRATK--SRVSGKLRRSASAIS 1869          

HSP 2 Score: 81.2629 bits (199), Expect = 9.613e-140
Identity = 38/130 (29.23%), Postives = 71/130 (54.62%), Query Frame = 3
Query:  855 NSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            ++I    DL +    +D+++   ++ GG + GW  +S  +LW+R +G+LG++  I+ P++   +  Y  EL     K+R+N+ I    Q   +  L+ PP+  +  W+F+   L + F S KL A R++C
Sbjct:  826 DAIHMHHDLDSSEFLADNIS---IIAGGCLTGWHADSAFVLWRRILGILGDVNSIRCPRIHAKVFSYLYELWHKLAKIRDNLGINVDIQPDLSRTLFIPPLRMLASWLFKATMLPAEFKSGKLQAYRLIC 952          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Cavefish
Match: ralgapa2 (Ral GTPase activating protein, alpha subunit 2 (catalytic) [Source:ZFIN;Acc:ZDB-GENE-131122-56])

HSP 1 Score: 432.18 bits (1110), Expect = 6.365e-138
Identity = 305/912 (33.44%), Postives = 455/912 (49.89%), Query Frame = 2
Query: 1265 DIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINII-DSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGL---IYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHK-YENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPE----KPVIDYVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPY-----ENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQK-SNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            D+ P+ D L   Y ++H    S+++  + T+I      FF + L G  +L+ DFI A   VL          E P++E+ +LLGS++ F  L        A   T +I+      K  +VNIL+ +A+ EP   AR ++I  + L     L   +      + +++ I +L   ++F N  +A ++ D+ + L+     +Q+    +P++II++    I         S    DKK + SL+  L+DW M +PLS LLE   +   GL   I      L+ + +   +++   S ++L           +  ++  +P +  G     S +P   +    D   +  V +E        R   E + L AR+ + HL+N++G +P +     L S V E+HD   V++              +LS EVF +P LQ+FV N S LVS++ + S+            PP            SEVR+I+RD+ GKY WD + ++K  E  N+   S EE+ +         T  ++ ++  S +           +  +D +D LL +L   +PE      P+P    + Q +   +     IE +I+E      H   K    ++  +  RS  P      + PP        FYFCR +L  LG  SW RR S  L++K S +   LKN+D R+ RETHKIAV Y+  GQEDK SIL NT GS  +  F+SGLGW V+L  H GFMGGL+ +G  G  APYYA ST+E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV+IIIYP++N +F I I  K ++  FGPLFDGA+V    LP LVRAT INA R ++     YQ F+ ERA YLE  I    E M FEDFA  ++
Sbjct:  960 DVLPNSDFLVYLYHVMHKGFTSDDQDVLNTMIRWCSPRFFFLGLPGFTMLVGDFITAAARVLGAD-----SFEAPRIEAQTLLGSLVCFPSLYQQIPSLQAIPGTQDIVVGREDIKDYLVNILLKTARNEPSEGARCVAICSLGLWVCEELGQQKIH----HQVKDAINVLGVTLKFGNKAVAHVACDIFQLLICHWQHLQKLEHSLPKRIIEIFVATIAFLLPSAEHSTMEGDKKLMVSLLLCLLDWCMAVPLSILLEP--ISMIGLDDSITQKAPLLDYIYR---VLHCCVSGSNLHTQQSHYLLSLADLSTDYDPFLPLGQVK--SSEPQPMHSAAGDFGSLLTVAEEKK------RRNMELIPLTARMIMMHLVNHLGHHPLSGGPALLHSLVNENHDNPYVESS-------------ELSSEVFKSPNLQLFVFNDSTLVSYLQIPSE--------GSSAPP--------REHASEVRVIVRDISGKYSWDGSILYKTLEGTNLHCSSGEEEASFHQHQHHHHTDRSSTSSRPSSSHTSRCSSAVELEDSVDALDQLLEDLGISSPECL----PQPQQTLN-QPAPPPMGMNHDIETAIMEAI----HRQTKQEEEEVAWR--RSEDPSVRAANQRPPSQQDPKAPFYFCRLLLNDLGMNSWDRRKSFHLLKKNSKLLRELKNLDSRQCRETHKIAVFYIGEGQEDKYSILSNTEGSQVYEVFVSGLGWEVDLATHCGFMGGLQRNGSTGTTAPYYATSTVEVIFHVSTRMPSDSDDSITKKLRHLGNDEVQIVWSEHTRDYRRGIIPTDFGDVLIIIYPMKNHMFFIQIMKKPQVPFFGPLFDGAIVTGTLLPSLVRATCINASRAVKSRLTLYQSFYEERALYLEAIILNHKENMMFEDFAAQVF 1809          

HSP 2 Score: 81.2629 bits (199), Expect = 6.365e-138
Identity = 38/130 (29.23%), Postives = 71/130 (54.62%), Query Frame = 3
Query:  855 NSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            ++I    DL +    +D+++   ++ GG + GW  +S  +LW+R +G+LG++  I+ P++   +  Y  EL     K+R+N+ I    Q   +  L+ PP+  +  W+F+   L + F S KL A R++C
Sbjct:  826 DAIHMHHDLDSSEFLADNIS---IIAGGCLTGWHADSAFVLWRRILGILGDVNSIRCPRIHAKVFSYLYELWHKLAKIRDNLGINVDIQPDLSRTLFIPPLRMLASWLFKATMLPAEFKSGKLQAYRLIC 952          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Cavefish
Match: ralgapa2 (Ral GTPase activating protein, alpha subunit 2 (catalytic) [Source:ZFIN;Acc:ZDB-GENE-131122-56])

HSP 1 Score: 425.246 bits (1092), Expect = 2.187e-135
Identity = 303/907 (33.41%), Postives = 447/907 (49.28%), Query Frame = 2
Query: 1265 DIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINII-DSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGL---IYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPY-----ENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQK-SNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            D+ P+ D L   Y ++H    S+++  + T+I      FF + L G  +L+ DFI A   VL          E P++E+ +LLGS++ F  L        A   T +I+      K  +VNIL+ +A+ EP   AR ++I  + L     L   +      + +++ I +L   ++F N  +A ++ D+ + L+     +Q+    +P++II++    I         S    DKK + SL+  L+DW M +PLS LLE   +   GL   I      L+ + +   +++   S ++L           +  ++  +P +  G     S +P   +    D   +  V +E        R   E + L AR+ + HL+N++G +P +     L S V E+HD   V++              +LS EVF +P LQ+FV N S LVS++ + S+            PP            SEVR+I+RD+ GKY WD + ++K          + E  N+P S    R        +              +D +D LL +L   +PE      P+P    + Q +   +     IE +I+E      H   K    ++  +  RS  P      + PP        FYFCR +L  LG  SW RR S  L++K S +   LKN+D R+ RETHKIAV Y+  GQEDK SIL NT GS  +  F+SGLGW V+L  H GFMGGL+ +G  G  APYYA ST+E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV+IIIYP++N +F I I  K ++  FGPLFDGA+V    LP LVRAT INA R ++     YQ F+ ERA YLE  I    E M FEDFA  ++
Sbjct:  928 DVLPNSDFLVYLYHVMHKGFTSDDQDVLNTMIRWCSPRFFFLGLPGFTMLVGDFITAAARVLGAD-----SFEAPRIEAQTLLGSLVCFPSLYQQIPSLQAIPGTQDIVVGREDIKDYLVNILLKTARNEPSEGARCVAICSLGLWVCEELGQQKIH----HQVKDAINVLGVTLKFGNKAVAHVACDIFQLLICHWQHLQKLEHSLPKRIIEIFVATIAFLLPSAEHSTMEGDKKLMVSLLLCLLDWCMAVPLSILLEPISM--IGLDDSITQKAPLLDYIYR---VLHCCVSGSNLHTQQSHYLLSLADLSTDYDPFLPLGQVK--SSEPQPMHSAAGDFGSLLTVAEEKK------RRNMELIPLTARMIMMHLVNHLGHHPLSGGPALLHSLVNENHDNPYVESS-------------ELSSEVFKSPNLQLFVFNDSTLVSYLQIPSE--------GSSAPP--------REHASEVRVIVRDISGKYSWDGSILYK----------TLEGTNLPSSSHTSRCSSAVELEDS-------------VDALDQLLEDLGISSPECL----PQPQQTLN-QPAPPPMGMNHDIETAIMEAI----HRQTKQEEEEVAWR--RSEDPSVRAANQRPPSQQDPKAPFYFCRLLLNDLGMNSWDRRKSFHLLKKNSKLLRELKNLDSRQCRETHKIAVFYIGEGQEDKYSILSNTEGSQVYEVFVSGLGWEVDLATHCGFMGGLQRNGSTGTTAPYYATSTVEVIFHVSTRMPSDSDDSITKKLRHLGNDEVQIVWSEHTRDYRRGIIPTDFGDVLIIIYPMKNHMFFIQIMKKPQVPFFGPLFDGAIVTGTLLPSLVRATCINASRAVKSRLTLYQSFYEERALYLEAIILNHKENMMFEDFAAQVF 1749          

HSP 2 Score: 79.337 bits (194), Expect = 2.187e-135
Identity = 34/107 (31.78%), Postives = 60/107 (56.07%), Query Frame = 3
Query:  924 VLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILC 1244
            ++ GG + GW  +S  +LW+R +G+LG++  I+ P++   +  Y  EL     K+R+N+ I    Q   +  L+ PP+  +  W+F+   L + F S KL A R++C
Sbjct:  814 IIAGGCLTGWHADSAFVLWRRILGILGDVNSIRCPRIHAKVFSYLYELWHKLAKIRDNLGINVDIQPDLSRTLFIPPLRMLASWLFKATMLPAEFKSGKLQAYRLIC 920          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Cavefish
Match: ralgapa1 (Ral GTPase activating protein, alpha subunit 1 (catalytic) [Source:ZFIN;Acc:ZDB-GENE-080806-1])

HSP 1 Score: 419.083 bits (1076), Expect = 1.811e-133
Identity = 294/929 (31.65%), Postives = 454/929 (48.87%), Query Frame = 2
Query: 1229 NAYPL--QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLN-DIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSP-----EVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFV----HKYENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSN-----QFPK--PSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            +AY L  +I  R+ D+ P+ D L  FY ++H  +  +++  + T+I +    FF I L G+ +LILDFI A   V   S      +  P++E+  LLGS++ F +L          +  + +      K  I+  +++SA+ EP   AR     C++L    +  S E      +  I+  + ++   ++F N  +A ++ D++  L+N    +Q   P +P+KI+++L   I         S +  DK+ + SL+  L+DW M LP   LL+      + L+     A ++VL  + I  V+        S      F    + + +P            DP +    L + +P+     E +S      EV  R Q   + +AAR  + HL+N++G YP +     L+S V E+ D     +              DL+ E+F+TP LQ FV+NG+ L+S + + ++         PGG         + S  + VR+I+RD+ GK+ WD A +    H    +  I   +               L      E   +   L+  +   D +D +L  L   +PE           P   P+ V   Q   E+     I++QS  E   F  H    +      + + R   P           + FY+CR +L  LG  SW++R++  L++K+   L  LKN+D R+ RETHKIAV YVA GQEDK SIL NT+GS  +  F+SGLGW VNL +H GFMGGL+ +   G   PY+A ST+E+MFHVST MP ++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV+I+IYP++N +          ++ FGPLFDGA+V  K LP +VRATAINA R ++   P YQ F+ ERA YLE  ++   E  +FED+A  ++
Sbjct: 1130 HAYKLICKIMKRRQDVSPNSDFLTHFYNIMHCGLLHQDQDIVNTIIKHCSPRFFSIGLPGATMLILDFIVAASRVTACS-----SLNAPRVEAQILLGSLVCFPNLYEELPALHPTTAEVIMTKFKDVKEHIIKHILASARDEPSAPAR-----CVALCSLGIWLSEELIHGTRHPQIKEALNVICVTLKFPNKTVALVASDILHLLINYVDHLQAFPPDMPKKIVEILIATITYLLPSTESSPHELDKRLVVSLLLCLLDWVMALPPKTLLQP----VQTLVLDKDKADKSVL--SAIYKVLHGCVYGAQSFSSARYFPLSLSDLSSP----------DYDPFLPLEGLKEPEPLHSPDSERSSKLQPVTEVRSRIQQGLISIAARTVISHLVNHLGHYPMSGGPATLTSQVCENQDNPYCDSS-------------DLAPELFHTPNLQFFVLNGTTLLSCLQIRAQ------DGLPGG----GMAAGLTSANACVRVIVRDISGKHSWDSAVLYGPPHCAAPSQPIHFPTPSSGPEEAVLELMAPLAKRRCREAVPSWDALQDGEDGEDALDEMLQYLGYSSPECLQRTGMPLNIPALPPACVSEKQ---ENDVINAILKQS-AEEREFSLHRGNDVHMRAAAQPEPRPQRP----------QSAFYYCRLLLNILGMNSWEKRSNFHLLKKNEKLLRELKNLDSRQCRETHKIAVFYVAEGQEDKHSILSNTSGSEAYEDFVSGLGWEVNLTSHCGFMGGLQRNKSTGLTTPYFATSTVEVMFHVSTRMPPDSDDSLTKKLRHLGNDEVHIVWSEHTRDYRRGIIPTEFGDVLIVIYPMKNHM---------TVLFFGPLFDGAIVDGKILPTMVRATAINASRALKSLIPLYQNFYEERARYLETIVQHHLESSTFEDYAARLF 1986          

HSP 2 Score: 79.337 bits (194), Expect = 1.811e-133
Identity = 54/228 (23.68%), Postives = 111/228 (48.68%), Query Frame = 3
Query:  591 ESEDLNIDADDESEGENVENAYFEVESKSATLTRDESDVD---ISSQMYRFPAQDTLNDSSRTPT------KHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1247
            E E + +  +   E ++       ++S++++L++     D   I+      P        S+TP+      +H+  + +Q+ +++  + +   D++  S   T+D S             V+ GG++ GW  +   ++W+R +G+LG++  IK+P++   +  Y  EL  +  K+R+N+ I   NQ +P PP   PP+  + PW+F+   L   +   KL A +++CK
Sbjct:  923 EQEGVCVTGNTLDEPDHASLTTLHIDSETSSLSQHGLSADTVTITGSESASPLHSLGGSRSQTPSPATLTAEHTKHKDLQLDEKLHHSVLQTPDDLETSEFPTEDCS-------------VMAGGSLTGWHADVATVMWRRMLGILGDVNSIKDPEIHAQVFDYLCELWQNLAKIRDNLGISLDNQTSPPPPDLIPPLRILTPWLFRATMLSERYKQGKLHAYKLICK 1137          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Cavefish
Match: tsc2 (TSC complex subunit 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2702])

HSP 1 Score: 91.6633 bits (226), Expect = 4.848e-18
Identity = 58/192 (30.21%), Postives = 110/192 (57.29%), Query Frame = 2
Query: 3275 LKNIDQRRGRETHKIAVLYVAWGQEDKE-SILGNTTGSLEFNTFISGLGWTVNLEN---HKGFMGGLESSGR---NGFFAPYYANSTLEIMFHVSTWMPS-ENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINA 3826
            +K +DQ    +THKI V++V  GQ + E +IL N  GS  +  F++GLG  ++L++    + F+GGL+  GR   +G F   + +  ++ +FH++T MP+ E+     NK +H+GND V+V+++++  +Y+    +  F  V ++I PL      + ++ + ++          +V ++ LP+LVR  A++A
Sbjct: 1428 VKVLDQMPPYDTHKIGVVFVGPGQANNEVAILSNEYGSNRYARFLTGLGKLIHLKDCDPDQIFLGGLDH-GRYADDGEFTYCWHDDIMQAIFHIATLMPNRESDKSCCNKKRHIGNDFVVVVYNDSGEEYKLGTIKGQFNFVEVLIKPLDFESNLVTLQCRRDLEGLVDTTVAKIVSDQNLPLLVRQMALHA 1618          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Sea Lamprey
Match: ralgapa1 (Ral GTPase activating protein, alpha subunit 1 (catalytic) [Source:ZFIN;Acc:ZDB-GENE-080806-1])

HSP 1 Score: 417.157 bits (1071), Expect = 1.591e-132
Identity = 301/913 (32.97%), Postives = 451/913 (49.40%), Query Frame = 2
Query: 1229 NAYPL--QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLES------NDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLK--VSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSNQFPK-----PSAV-ESGQTSLESLSKRQIIEQSIVENNLFDNHH---CLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIK 3907
            +AY L  ++  R+ D+ P+ D L  FY ++H  + S +   + T+I       F + L G  +L+ DFI A   V          V  P+ E+  LLGSML F +L     V    +    +I     K  I+  L+ SAK+EP ++AR +++  + +     L+    T   L  I+  + ++ + ++F + H+A ++ D++  LV+   ++ E    +P+KII +L   +         S    +K+ + SL+  L+DW M LP+  LL+S      +  HS  L+   +  L + +      N  +   +LK  +S +             NP +          DP + YP        +  ++ +   +   R Q E + LAAR  + HL+N++G YP +     L+S V+EHH+        +P  S       +LS ++F  P LQ FV N S L+S + + ++      +  PGG           S  S VR+++RD+ GKY WD A ++   +     +   + +        R T       E SL     +      D +D  L  L   +PE    Q P      P+A  +     LE   +R +  Q + E      H    C++ + P             E  P+     + F++CR  L+ LG  SW RR S DL++K+   L  LKN+D R+ RETHKIAVLYVA GQEDK SIL N  GS  +  FI+GLGW V+L  H GFMGGL+ +  NGF APYYA ST+E++FHVST MPSE+      K +H+GNDEV ++WSE+ RDYR  I  T FGDV+I+I P +N LF I I  K E+  FGPLFDGA+V  K LPVLVRATA+NA R ++   P YQ F+ ERA YL+  ++
Sbjct:  829 HAYKLVCKVMTRQQDMLPNSDFLVHFYSIMHQGLLSPDLDTVSTIIRFCSPRIFSLGLPGCTLLLWDFIVAASKVATCG-----VVHAPRTEAQMLLGSMLCFPNLYKEVLVLQPVATDTALIPCKDLKEHIIKSLLKSAKEEPSVSARCIALCNVGIWMCEELA--HATKHSL--IKEALNVIGATLKFPHKHVAQVACDLLHLLVSYVDKLMEYHVDMPKKIIGILVATMVYLLPAAEHSQQEQEKRLMVSLLLCLLDWCMVLPVETLLQSLIPAGASKPHSVSLLSSIYKVLYSCVYGYHFFNNPRYPLTLKDLISVDY------------NPTLPLDEIK----DPELLYPQ------SDRSSKLLTVSDGAARIQRELIPLAARTVMVHLVNHLGHYPLSCGPALLASLVREHHE--------NPHASAA-----ELSADLFENPNLQFFVFNKSTLLSCLQIPAE------RDVPGG---GVAAGLASSAASNVRVVVRDVSGKYSWDAAILYGPAHCCPQQEQERQWQQKQQQQGRRPTASEGDCAE-SLPAPSWETLGRDQDALDETLRFLGSTSPECL--QRPGAPLNVPAAPPQCSSEKLEGEVRRAVRAQWLEEGRHARAHSGDACMR-AEP-------------ECEPDAREPQSAFHYCRLFLSSLGMHSWDRRPSFDLLKKNEKLLRELKNLDSRQCRETHKIAVLYVAEGQEDKLSILSNQGGSRAYEDFIAGLGWEVDLTTHCGFMGGLQHNRSNGFSAPYYATSTMEVIFHVSTRMPSESDDSVTKKLRHIGNDEVHIVWSEHSRDYRRGIIPTEFGDVLIVITPTKNQLFSIQIIKKPEVPFFGPLFDGAIVDGKILPVLVRATALNASRALKTLIPLYQSFYEERARYLDSIVQ 1671          

HSP 2 Score: 75.8702 bits (185), Expect = 1.591e-132
Identity = 39/108 (36.11%), Postives = 63/108 (58.33%), Query Frame = 3
Query:  924 VLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1247
            V+ GGT++GW  +   +LW+R +G+LG++  IK+P +   +  Y  EL  +  KMR+N+ I   NQ +P PP   PP+    PW+F+   L   +   KL A +++CK
Sbjct:  729 VMSGGTLMGWHPDVATVLWRRVLGILGDVNSIKDPDIHAQVLDYLCELWQNLAKMRDNLGISLDNQRSPPPPELIPPLRMFTPWLFRATALPERYKQGKLHAYKLVCK 836          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003319.1 (pep scaffold:Pmarinus_7.0:GL478269:10551:16928:1 gene:ENSPMAG00000003039.1 transcript:ENSPMAT00000003319.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 227.254 bits (578), Expect = 5.904e-68
Identity = 109/190 (57.37%), Postives = 135/190 (71.05%), Query Frame = 2
Query: 3302 RETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFF 3871
            RETHKIAVL+VA GQEDK SIL N  GS  +  F++GLGW V+L  H GF+GGL+ +G NG  APYYA ST+E+++HVST MPS+       K +HLGNDEV V+W E+ R+YR  I  T F DV+I+IYPLR   F I I  KTE+  FGPLFDGA+VG+K LP LVRATAINA R ++   P Y+  +
Sbjct:   32 RETHKIAVLFVAEGQEDKHSILSNAGGSQSYEDFLAGLGWEVDLTRHCGFLGGLQRNGSNGLTAPYYATSTVEVIYHVSTRMPSDTDDALTKKLRHLGNDEVHVVWCEHTREYRRDIIPTEFRDVLIVIYPLRGHTFRICIMKKTEVPFFGPLFDGAIVGKKLLPGLVRATAINASRALKRRLPLYRSLY 221          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000176.1 (pep scaffold:Pmarinus_7.0:GL480328:40:24176:1 gene:ENSPMAG00000000157.1 transcript:ENSPMAT00000000176.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.005 bits (284), Expect = 5.969e-37
Identity = 76/272 (27.94%), Postives = 132/272 (48.53%), Query Frame = 2
Query: 1229 NAYPL--QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLE 2038
            +AY L  +I +R+ ++ P  D L  FY +IHS + S ++  +  ++ N   HFF + L GS +L+ DF+ A   +  +   Q      P+ E+ SLLGS++ F +L             I   D    K ++V ++++ AK+EP   AR +++   SL  +     +  T   L  + + I ++ + ++F +  +A +S DM+  L      +Q+    +P  I+Q L   I Q       S    +KK + SL+  L+DW M L L  LL+
Sbjct:   66 HAYRLICKIMMRRQELHPSTDFLVHFYAVIHSALLSSDQDVLSVVMRNCSPHFFSLGLPGSSMLLWDFLLAASRIATSQSSQA-----PRAETQSLLGSLVCFPNLYGEMPALHPTLHDITPTDCEGLKEQLVKLILNGAKEEPSETARCIALC--SLGIWICEELVHCTRHPL--VTDAIHVICATLKFSHRSVAQVSCDMLTVLAMYADDLQQHSEELPSVIVQALVSTITQLLPVTEISSQEEEKKRMVSLLLCLLDWCMVLTLPALLQ 328          

HSP 2 Score: 59.6918 bits (143), Expect = 5.969e-37
Identity = 27/65 (41.54%), Postives = 37/65 (56.92%), Query Frame = 3
Query: 1053 YFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1247
            Y  EL DS  K+R+N+ I   NQ TP PP   PP+  + PW+F+   L   +   KL A R++CK
Sbjct:    9 YLCELWDSLAKIRDNLGISLDNQCTPEPPDLIPPLTILTPWLFKATTLPDQYKQGKLHAYRLICK 73          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Sea Lamprey
Match: tsc2 (TSC complex subunit 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2702])

HSP 1 Score: 110.153 bits (274), Expect = 2.883e-24
Identity = 61/189 (32.28%), Postives = 109/189 (57.67%), Query Frame = 2
Query: 3275 LKNIDQRRGRETHKIAVLYVAWGQ-EDKESILGNTTGSLEFNTFISGLGWTVNLENHKG---FMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPS-ENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINA 3826
            +K +D+    +THKI V+YV  GQ +++ ++L N  GS  + +F+ GLG  ++L +      ++GGL++ G +G FA  + +  ++ +FHV+T MP+ E      NK +H+GND VM++++++  DYR  I R  F  V ++I PL      + I+ + ++          +V +K LP+L R  A++A
Sbjct: 1538 IKMMDRIPPYDTHKIGVIYVGEGQVKNQTAMLMNEHGSPRYVSFVQGLGRLISLRDCDADQIYLGGLDTKGEDGDFAYCWHDDVMQTIFHVATLMPNMERDPVCCNKKRHVGNDFVMIVYNDSQEDYRMGIIRGQFNFVEVVIKPLDYECSLVTIQARKDLEGLIDTTVAKIVSDKNLPLLARQMALHA 1726          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Sea Lamprey
Match: rap1gap (RAP1 GTPase activating protein [Source:ZFIN;Acc:ZDB-GENE-080402-9])

HSP 1 Score: 69.707 bits (169), Expect = 5.753e-13
Identity = 40/145 (27.59%), Postives = 73/145 (50.34%), Query Frame = 2
Query: 3341 GQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLE-SSGRNGFFAPYYANSTLEIMFHVSTWMP-SENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNG----LFGINIKTKTEIMLFGP 3757
            GQ+ +  + GN   S   + F+  LG  V L N  GF GGL+ + G+ G  + Y      E+MFH+ST +P +E    +  + +H+GND V +++ E    +   +  + F    +++ P R G     + + +  + ++ +FGP
Sbjct:    1 GQKTEGEVFGNRQESAALDAFLGMLGDPVQLHNFSGFRGGLDVTHGQTGSESVYTRFLDREVMFHISTKLPYTEGDAQQLQRKRHIGNDIVALVFQEESTPFVPDMIASNFLHAYVVVQPFRPGDGSTWYKVAVTARNDVPMFGP 145          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Nematostella
Match: EDO33259 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSP3])

HSP 1 Score: 367.466 bits (942), Expect = 9.947e-111
Identity = 270/939 (28.75%), Postives = 437/939 (46.54%), Query Frame = 2
Query: 1247 ITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIV-----LQTSDDQNLGVEIPKLESV-SLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCIS--LHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKS-STSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVA-LCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFV-----------HKYENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVI-DYVDNLLVELTEMNPE--IFSNQF---PKPSAVESGQTS--LESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALN 3973
            +T+R+ D     ++L  FY+L+H  +   ++  I  +I N    FF + L  S +LILDFI+A   +     L+  D +   + +  LE + +  G  +K  +     +  D    +I  + +  Y        I        IA  +L +  +   +HC                + +CI +LL    F +  ++T+++D++  L     ++      +P K+++V+   +         +    +   L S+I  L+DW M +P ++L+      ++  +   F  L+    +  +    KS + S  +S + +    ++         H            V  P     +P E + ++ N  +     Q     L ARVA L H++N++G +P       L S + EH D                   D++   +FN+P +Q FV+N S+LVS V L         +  P   P+ + MT   + +++VRLI RD+ G++ WD   +           H +    ++     E +  P                    L   K   P+  D +D  L  +   + E  +F +Q    P P+ V     S  +E +  +   E S + +N  D   C        VE +         PP     ++ F   R ++++ G L+W++R  +DL++K+  FL  LKN+D RR RETHKIAVLYVA GQEDK SI+ N+ GS  +  F++ LGW V+L  H GF+GGLE +   G  APYYA S  E+MFHV+T MP    G    + +HLGNDEV ++WSE+ R+YR+ I  T FGDV++IIYPL+N +F I+I  K E+  FGPLFDGA+V  + LP LVRATAINA    R   P Y+ ++ ER   +E+ ++   +P +FE+FA  ++  PA N
Sbjct:   90 MTVRQHDTALSQEYLTHFYRLMHIGLTGTDQDVISVIIRNCS-KFFSMMLPCSTLLILDFIQAANTIFINQNLEAIDQETHPIRV-SLECMPTSTGKGIKVCN-----RPGDTPHPSIPGMHANQYCRNTSAPNICCLCHFRCIALNSLGVFLVEELVHC-----------KGHPRVHDCICVLLQSTTFHHKTVSTLAIDLLHMLSQYTQELCAFDSELPIKVVEVMCHTVTSLLPGGEFASVQEENSILVSVILCLLDWVMVIPSAKLMARKGEENRSTLSRVFQVLQMAAHNRTVPKRRKSLNISTIISGDGRPVRLARVQETSKTPNH------------VPSP----AEPTETIEEKNNENDSDNDDQQGRFTLLARVAALMHIVNHLGHFPLGAGPSRLDSLISEHEDHLSTDC-------------DEMQPTIFNSPNIQFFVLNDSVLVSAVEL--------PKEDPKCHPLLQDMT---TAKTQVRLITRDMTGRFSWDHTMMYSRSGTPEPERHAFPLPGLLLDQEREAKESPEESRRTMRGA----------LSTFKSTTPIAPDRLDEALSYIGSSSRECVLFPDQALNEPAPAPVGHSMESSVMEHVLTQHTAEHSYIRDNTTDASLCS-------VEFR---------PPAYVDPSSPFQLGRFLISETGLLAWEKRLRVDLLKKNEKFLRELKNLDNRRCRETHKIAVLYVAAGQEDKTSIMSNSAGSQAYEDFVAALGWEVDLSTHTGFLGGLERNLSTGETAPYYATSMHEVMFHVATRMPLATDGTGTTRMRHLGNDEVHIVWSEHSREYRYGIVNTEFGDVLLIIYPLKNHMFRIHIIKKPEVPSFGPLFDGAIVNRRVLPSLVRATAINASMAKRSLLPLYERYYEERDKCIERIVQYHKQPSTFEEFASRVFS-PAPN 943          

HSP 2 Score: 53.5286 bits (127), Expect = 9.947e-111
Identity = 26/87 (29.89%), Postives = 46/87 (52.87%), Query Frame = 3
Query:  990 IGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKL--DSNFDSVKLVAMRILC 1244
            +G+LGN+  IK+P +   + +  +   +   K+R N  I   N+ TP  P   PP++Y   W+F+   L     F S +L+A +++C
Sbjct:    2 LGILGNVNQIKSPSIHAKVIECLISTWNMLAKVRMNQGISLDNKFTPAVPDLLPPLQYYATWVFEAASLLMPHKFKSGRLLAYQLIC 88          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Nematostella
Match: EDO36502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF7])

HSP 1 Score: 78.5666 bits (192), Expect = 1.204e-14
Identity = 51/172 (29.65%), Postives = 86/172 (50.00%), Query Frame = 2
Query: 3275 LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGL----ESSGRNGFFAPYYANSTLEIMFHVSTWMP--SENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPL-----RNGLFGINIKTKTEIMLFGP 3757
            L  ++++ G   +K  VLY   GQ   + +  N TGS EFN F+  LG  V L+  +G+ GGL    + +G    F  Y  +   EIMFHVS+ +P   +NP     K +H+GND V +++ +   +Y+   +  G     I I+ L      +  + + + ++  + +FGP
Sbjct:  105 LLTLEEQEGSVNYKFGVLYAKAGQTSDDEMFSNETGSEEFNRFLELLGDRVELQGWQGYRGGLDVKNDMTGSQSVFTIYEGH---EIMFHVSSLLPYTPDNPQQVERK-RHIGNDIVTIVFQDTDDEYKPSFSPLGVKSKFIHIFALVTYNKHDDSYRVTVYSERNVPIFGP 272          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Nematostella
Match: EDO39335 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAA4])

HSP 1 Score: 68.9366 bits (167), Expect = 3.230e-12
Identity = 47/157 (29.94%), Postives = 79/157 (50.32%), Query Frame = 2
Query: 3161 TLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGR-NGFFAPYYANSTLEIMFHVSTWMP-SENPGDKPNKFKHLGNDEVMVIWSE 3625
            TL++     R I  ++G  S  R  +I     +     L  ID+   ++ +KI +LYV  GQE +E++  N   S  F+ F+  LG  V +     + GGL+++    G  + +      ++MFHVST +P  +N   K  + +H+GND V V++ E
Sbjct:   67 TLSSHSEVLRFISQEIGLTSPLRLITIPSAPAA-----LLRIDKISLKDEYKIGLLYVKEGQETEEAMFENQEHSPAFDAFLESLGDRVRMRGFSKYRGGLDNANDLTGLHSVHTTYRNKQVMFHVSTLLPYDKNDSQKLQRKRHIGNDIVCVVFLE 218          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Nematostella
Match: EDO37811 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEL9])

HSP 1 Score: 60.077 bits (144), Expect = 1.570e-10
Identity = 35/117 (29.91%), Postives = 62/117 (52.99%), Query Frame = 2
Query: 3287 DQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESS-GRNGFFAPYYANSTLEIMFHVSTWMPSENPGD--KPNKFKHLGNDEVMVIWSEN 3628
            D+       K  ++Y  +GQ  +E    N   S   + F+  LG  V L++  G+ GGL+   G+ G  + +  ++  E+MFHVST +P  N GD  +  + +H+GND V +++ ++
Sbjct:   10 DEHSASRAFKFGIIYQKFGQISEEEYFCNKHHSPAMDEFLQMLGHRVRLQDFNGYNGGLDVKYGQTGESSVHTEHNNKEVMFHVSTLLPFSN-GDTQQVQRKRHIGNDIVCIVFQDD 125          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Nematostella
Match: EDO42942 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S022])

HSP 1 Score: 61.2326 bits (147), Expect = 2.581e-9
Identity = 44/169 (26.04%), Postives = 81/169 (47.93%), Query Frame = 2
Query: 3272 HLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLES-SGRNGFFAPYYANSTLEIMFHVSTWMP-SENPGDKPNKFKHLGNDEVMVIWSE-NYRDYRFHITRTGFGDVMIIIYPLR----NGLFGINIKTKTEIMLFGP 3757
             L  +D++     +K+ +LY   GQ  +E +  N   S  F+ F++ +G  V L+   G+   L++ +   G ++ Y   +  EIMFHVST +P + N   +  + +H+GND V +++ E     +     R+ F  V I+I        N  + + +    ++  FGP
Sbjct:  105 QLMKLDEQGMTNQYKVGILYCKAGQSTEEEMYNNQVSSPAFDEFLNLIGKKVRLKGFDGYRAQLDNRNDSTGEYSVYTKFNNREIMFHVSTLLPWTPNNKQQLLRKRHIGNDIVTIVFQEPGALAFTPKNIRSHFQHVFIVIRVFNPCSDNTYYRVAMSRSKDVPPFGP 273          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Medaka
Match: ralgapa1 (Ral GTPase activating protein catalytic alpha subunit 1 [Source:NCBI gene;Acc:101158901])

HSP 1 Score: 441.81 bits (1135), Expect = 2.391e-139
Identity = 296/938 (31.56%), Postives = 452/938 (48.19%), Query Frame = 2
Query: 1229 NAYPL--QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLN-DIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLE--------SNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNP---AIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNS-----PEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYEN--NNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSNQ-------FPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLH-LKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY 3955
            +AY L  +I  R+ D+ P+ D L  FY ++H  +  +++  + T+I +    FF I L G+ +LILDFI A   V   S      +  P++E+  LLGS++ F +L          +  + +      K  I+  ++++AK EP   AR     C++L    +    E     L+  I++ + ++   +++ N ++A ++ D++  L++    +++     P+KI+++L   I         S +  DK+ + SL+  L+DW M LP   LL+          D  +K L+   +  L   +                              S  NP    +   + +G   DP +    L + +P+     E +S      EV  R Q   V +AAR  + HL+N++G YP +     LSS V E+ D    ++              DL  E+F++P LQ  V NGS L+S + + S+         PGG         + S  + VR+IIRD+ GK+ WD A ++   +   N    S + +E               +  E       L+      D +D +L  L   +PE               P+ V   Q   E+     I++QS  E     N   ++ S P                 E  T  + FY+CR ++  LG  SW++R++  L++K+   L  LKN+D R+ RETHKIAV YVA GQEDK SIL NT GS  +  F+SGLGW V+L  H GFMGGL+ +   G   PYYA ST E+++HVST MP +   +   K +HLGNDEV +IWSE+ RDYR  I  T FGDV+IIIYP++N ++ I+I  K E+  FGPLFDGA+V  K LP +VRATAINA R ++   P YQ F+ ERA YLE  ++   E  +FED+A  +Y
Sbjct: 1124 HAYKLICRIMKRRQDVSPNTDFLTHFYNIMHQGLLHQDQDIVNTIIKHCSPRFFSIGLPGATMLILDFIIAASRVTACS-----SLNAPRVEAQILLGSLVCFPNLYEELPALHPTTADVVLTKFPDVKEHIIKTILTAAKDEPSAPAR-----CVALCSLGIWLCEELAHGTLHPQIKDALNVICVTLKYPNKNVALVASDILHLLISYVDHLEKFPTYTPKKIVEILIATITYLLPSTDSSPHELDKRLVVSLLLCLMDWVMALPPKTLLQPVQTQSPSDKDQPTKSLLNCIYKVLHGCVYGAQ--------------------------SFSNPKYFPLQLSDLSGPDYDPFLPLESLREPEPLHSPDSERSSKLQPVAEVRSRIQQGLVSIAARTVITHLVNHLGHYPMSGGPATLSSQVCENQDNPFCEST-------------DLGPELFHSPNLQFLVFNGSTLLSVLQIRSE------SDIPGG----GMTAGLSSASACVRVIIRDVAGKHSWDSAVLYGPPSCSTNSPAHSQQLKEEPGSEHLLAPPQAKRVCREVVPAWDSLREGD---DALDEMLQYLGYSSPECLQRAGMPLNIPAAPPTCVTEKQ---ENDVINAILKQSAAEREFELNMRAVQQSEP-----------------ETQTPQSAFYYCRLMINILGLNSWEKRSNFHLLKKNEKLLRELKNLDSRQCRETHKIAVFYVAEGQEDKHSILTNTAGSQAYEDFVSGLGWEVDLTTHCGFMGGLQRNRSTGQTTPYYATSTTEVIYHVSTRMPHDQDQNLTKKLRHLGNDEVHIIWSEHSRDYRQGIIPTEFGDVLIIIYPMKNHMYSIHILKKPEVPFFGPLFDGAIVDMKILPTMVRATAINASRALKSLIPLYQNFYEERARYLETIVQHHQEQTTFEDYAARVY 1979          

HSP 2 Score: 76.2554 bits (186), Expect = 2.391e-139
Identity = 52/212 (24.53%), Postives = 108/212 (50.94%), Query Frame = 3
Query:  615 ADDESEGENVENAYFEVESKSATLTRDESDVDISSQMYRFPAQDTLNDSSRTPT-KHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1247
            A DE E  ++   + + E+ S + T   +  + +S M+      +   S  T T +H++   +Q+ +++  + +   D++  +   ++D S             V+ GG++ GW  +   ++W+R +G+LG++  IK+P++   +  Y  EL  +  K+R+N+ I   NQ +P PP+  PP+  + PW+F+   L   +   KL A +++C+
Sbjct:  933 ASDEHEVASLTTLHIDSENSSLSHTVTVTGSESASPMHSLGGSRSQTPSPATLTAEHTDHTHLQLDQKLHNSVLQTPDDLETNDFPSEDCS-------------VMAGGSLTGWHADVATVMWRRMLGILGDVNSIKDPEIHAQVFDYLCELWQNLAKIRDNLGISLDNQSSPPPPVLIPPLRILTPWLFKATMLTERYKQGKLHAYKLICR 1131          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Medaka
Match: ralgapa2 (Ral GTPase activating protein catalytic alpha subunit 2 [Source:NCBI gene;Acc:101161106])

HSP 1 Score: 415.231 bits (1066), Expect = 1.852e-119
Identity = 318/1000 (31.80%), Postives = 490/1000 (49.00%), Query Frame = 2
Query: 1229 NAYPL--QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKK-------FLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPL----VEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWD--VAFVHKYENNNV-IFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKP-----EKPVIDYVDNLLVELTEMNPEIFSN---QFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLK----ISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQK-SNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY----GIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSKGRDSVIS 4129
             AY L  ++  R  D+ P  D     + ++H    S+++  + TLI +    FF + L G  +LI DFI A   VL TSD      E P++++ ++LGS++ F +L     +   +S  INI  +   K+ +V+IL+ +A +EP   AR +++  + L     L    T  +  + +++ I +L   ++F N  +A ++ D  + L++    +Q     +P+KII++    I         S    DKK        L SL+  L+DW + +PLS LLE+  + S G      + L + +    +++   S ++L           S  +S  +  +  G        P     VE+  L  V             E   R   E + L AR+ + HL+N++G +P +     L S V E+HD   V++              +LS EVF +P LQ+ V N S LVS++ + +      + +  G PP            S+VR+I+RD+ GKY WD  + +    E+ +V  F +++   +   S   +    + +          L       E+  +D +D LL +L+  +PE  S    +  +P+    G  S     + + I+ +IV     +     +    IS     ++K     P    P+     + FYFCR +L  LG  SW RR S  L++K S +   LKN+D R+ RETHKIAV Y+  GQEDK SIL N  GS  +  F+SGLGW V+L  H GFMGGL+ +G  G  APYYA ST+E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV+I IYP++N ++ I I  K ++  FGPLF+GA+V    LP LVRAT INA R I+   P YQ F+ ERA YLE  ++   E M+FEDFA  ++    G P ++   S   + STE      T+D+++    T     S+   V G  +   S IS
Sbjct:  998 QAYRLICEMITRHQDVLPSSDFSVHLFNVMHKGFTSDDQDVLNTLIHSCSPRFFFLGLPGFTMLIGDFINAAACVL-TSDSP----EAPRIKAQTILGSLVCFPNLYRQIPILLPSSNDINI-GNMDIKNYLVSILLEAATKEPCEGARCIAVCSLGLWVCEEL----TQKNIHHQVKDAINVLGVTLKFGNKAVAQVACDAFQLLISHWQHLQRLEATLPKKIIEIFVATIAFLLPSAEHSTVEADKKRSKSPLSLLVSLLLCLLDWCIAIPLSLLLETITIRSVGDHTSQKAPLLDYIYR--VLHCCVSGSNLHTQQSHYLLSLSDLSSDYDLML--GQVRSFEPPPSQTTNVEFGNLLTVA------------EEKRRRNMELIPLTARMVMTHLVNHLGHHPLSGGPALLHSLVSENHDNPYVESS-------------ELSSEVFKSPNLQLCVFNDSTLVSYLQIPA------DTNTVGQPP---------HPSSQVRVIVRDISGKYSWDGTILYCTTQEDCDVGAFYAADHSFSTTTSTHSKNLHFSPIQGPSKNPCSALDSLSNCSEEDEVDALDKLLEDLSHSSPECLSQPQVRLNQPAPSPHGMNS----EQEKAIQDAIVHQTQQEEEQVRRWDADISFRADCQQK-----PIHQEPK-----SPFYFCRLLLNDLGMNSWDRRKSFHLLKKNSKLLRELKNLDSRQCRETHKIAVFYIGEGQEDKCSILSNNAGSQAYEDFVSGLGWEVDLATHCGFMGGLQRNGSTGLTAPYYATSTVEVIFHVSTRMPSDSDDSITKKLRHLGNDEVHIVWSEHTRDYRRGIIPTDFGDVLINIYPMKNNMYFIQIMQKVQVPFFGPLFNGAIVSGILLPSLVRATCINASRAIKSRLPLYQSFYEERALYLEAIVQNHREVMTFEDFASQVFSPSPGYP-VSGTGSLTGSVSTEGGNNPTTTDSVEQVSPTMPR--STKLRVSGKLRRSASAIS 1926          

HSP 2 Score: 89.3521 bits (220), Expect = 2.739e-17
Identity = 49/166 (29.52%), Postives = 88/166 (53.01%), Query Frame = 3
Query:  837 IEDNIVNSITNT-QDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK*PLGNLILSHMLIIWLNSTSLYIQLFKV 1331
            ++D I +S+ +    L +    +DD++   ++ GGT+ GW  +S  +LW+R +G+LG++  I  PK+   +  Y  EL     K+R+N+ I   NQ +P  P + PP+     W+F+   L + + + KL A R++C+     +I  H  +  L S+   + LF V
Sbjct:  871 LDDTIHHSVLHMPHHLDSSECLADDVS---IIAGGTLTGWHPDSAFVLWRRILGILGDVNNISCPKIHAKVFAYLYELWHKLAKIRDNLGISVDNQSSPPQPAFIPPLRMFGSWLFRATVLPAEYKAGKLQAYRLICE-----MITRHQDV--LPSSDFSVHLFNV 1026          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Medaka
Match: ralgapa2 (Ral GTPase activating protein catalytic alpha subunit 2 [Source:NCBI gene;Acc:101161106])

HSP 1 Score: 383.645 bits (984), Expect = 5.767e-109
Identity = 307/992 (30.95%), Postives = 472/992 (47.58%), Query Frame = 2
Query: 1232 AYPL--QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLN-DIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPL----VEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWD--VAFVHKYENNNV-IFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKP-----EKPVIDYVDNLLVELTEMNPEIFSN---QFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLK----ISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIY----GIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSKGRDSVIS 4129
            AY L  ++  R  D+ P  D     + ++H    S+++  + TLI +    FF + L G  +LI DFI A   VL TSD      E P++++ ++LGS++ F +L     +   +S  INI +                          + I CI++    +    E T  +++  +++ I +L   ++F N  +A ++ D  + L++    +Q     +P+KII++    I         S    DKK L SL+  L+DW + +PLS LLE+  + S G      + L + +    +++   S ++L           S  +S  +  +  G        P     VE+  L  V             E   R   E + L AR+ + HL+N++G +P +     L S V E+HD   V++              +LS EVF +P LQ+ V N S LVS++ + +      + +  G PP            S+VR+I+RD+ GKY WD  + +    E+ +V  F +++   +   S   +    + +          L       E+  +D +D LL +L+  +PE  S    +  +P+    G  S     + + I+ +IV     +     +    IS     ++K     P    P+     + FYFCR +L  LG  SW R++   L + S +   LKN+D R+ RETHKIAV Y+  GQEDK SIL N  GS  +  F+SGLGW V+L  H GFMGGL+ +G  G  APYYA ST+E++FHVST MPS++      K +HLGNDEV ++WSE+ RDYR  I  T FGDV+I IYP++N ++ I I  K  +  FGPLF+GA+V    LP LVRAT INA R I+   P YQ  + ERA YLE  ++   E M+FEDFA  ++    G P      S   + STE      T+D+++    T     S+   V G  +   S IS
Sbjct: 1020 AYRLICEMITRHQDVLPSSDFSVHLFNVMHKGFTSDDQDVLNTLIHSCSPRFFFLGLPGFTMLIGDFINAAACVL-TSDSP----EAPRIKAQTILGSLVCFPNLYRQIPILLPSSNDINIGN--------------------------MDIKCIAVCSLGLWVCEELTQKNIHHQVKDAINVLGVTLKFGNKAVAQVACDAFQLLISHWQHLQRLEATLPKKIIEIFVATIAFLLPSAEHSTVEADKKLLVSLLLCLLDWCIAIPLSLLLETITIRSVGDHTSQKAPLLDYIYR--VLHCCVSGSNLHTQQSHYLLSLSDLSSDYDLML--GQVRSFEPPPSQTTNVEFGNLLTVA------------EEKRRRNMELIPLTARMVMTHLVNHLGHHPLSGGPALLHSLVSENHDNPYVESS-------------ELSSEVFKSPNLQLCVFNDSTLVSYLQIPA------DTNTVGQPP---------HPSSQVRVIVRDISGKYSWDGTILYCTTQEDCDVGAFYAADHSFSTTTSTHSKNLHFSPIQGPSKNPCSALDSLSNCSEEDEVDALDKLLEDLSHSSPECLSQPQVRLNQPAPSPHGMNS----EQEKAIQDAIVHQTQQEEEQVRRWDADISFRADCQQK-----PIHQEPK-----SPFYFCRLLLNDLGMNSWDRKSFHLLKKNSKLLRELKNLDSRQ-RETHKIAVFYIGEGQEDKCSILSNNAGSQAYEDFVSGLGWEVDLATHCGFMGGLQRNGSTGLTAPYYATSTVEVIFHVSTRMPSDSDDSITKKLRHLGNDEVHIVWSEHTRDYRRGIIPTDFGDVLINIYPMKNNMYFIQIMQK--VPFFGPLFNGAIVSGILLPSLVRATCINASRAIKSRLPLYQS-YEERALYLEAIVQNHREVMTFEDFASQVFSPSPGYPV--SGTSLTGSVSTEGGNNPTTTDSVEQVSPTMPR--STKLRVSGKLRRSASAIS 1914          

HSP 2 Score: 90.1225 bits (222), Expect = 1.663e-17
Identity = 46/157 (29.30%), Postives = 85/157 (54.14%), Query Frame = 3
Query:  861 ITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK*PLGNLILSHMLIIWLNSTSLYIQLFKV 1331
            +++ + L++    +DD++   ++ GGT+ GW  +S  +LW+R +G+LG++  I  PK+   +  Y  EL     K+R+N+ I   NQ +P  P + PP+     W+F+   L + + + KL A R++C+     +I  H  +  L S+   + LF V
Sbjct:  901 LSHNEALASSECLADDVS---IIAGGTLTGWHPDSAFVLWRRILGILGDVNNISCPKIHAKVFAYLYELWHKLAKIRDNLGISVDNQSSPPQPAFIPPLRMFGSWLFRATVLPAEYKAGKLQAYRLICE-----MITRHQDV--LPSSDFSVHLFNV 1047          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Medaka
Match: TSC2 (TSC complex subunit 2 [Source:NCBI gene;Acc:101168435])

HSP 1 Score: 103.219 bits (256), Expect = 1.639e-21
Identity = 59/189 (31.22%), Postives = 108/189 (57.14%), Query Frame = 2
Query: 3275 LKNIDQRRGRETHKIAVLYVAWGQEDKE-SILGNTTGSLEFNTFISGLGWTVNLENHKG---FMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPS-ENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINA 3826
            +K +DQ    +THKI V++V  GQ + E +IL N  GS  +  F++GLG  ++L++      F+GGL+  G +G F   + +  ++ +FH++T MP+ E+     NK +H+GND VMV+++++  +Y+    +  F  V +II PL      + ++ + ++          +V ++ LP+LVR  A++A
Sbjct: 1331 VKVLDQMPPYDTHKIGVVFVGAGQVNNEVAILSNEYGSNRYAAFLTGLGKLIHLKDCDSDQIFLGGLDQYGDDGEFTYCWHDDIMQAIFHIATLMPNRESDRGCCNKKRHIGNDFVMVVYNDSGEEYKLGTIKGQFNFVEVIIKPLDYDCNLVTLQCRKDLEGLVDTTVAKIVSDRNLPLLVRQMALHA 1519          
BLAST of Rap-GAP domain-containing protein vs. Ensembl Medaka
Match: si:ch1073-90m23.1 (rap1 GTPase-activating protein 2 [Source:NCBI gene;Acc:101167898])

HSP 1 Score: 79.337 bits (194), Expect = 1.539e-14
Identity = 54/184 (29.35%), Postives = 90/184 (48.91%), Query Frame = 2
Query: 3248 VQKSNIFLHLKN------IDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLE-SSGRNGFFAPYYANSTLEIMFHVSTWMP-SENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLR-----NGLFGINIKTKTEIMLFGPL 3760
            V K N+  +LK        D+ R     K  VLY   GQ  +E IL N   S EF  F+S LG TV L+   GF GGL+    + G  A Y +    EIMFHVST +P ++    +  + +H+GND V +++ E    +   + ++ F    +++  ++        + +++  + ++  FGP+
Sbjct:  226 VPKFNVVCYLKAPDLITAFDEHRVSPNFKFGVLYQKEGQLTEEDILSNREESEEFKEFLSILGDTVQLQGFTGFRGGLDVCHAQTGSEAVYTSFHGREIMFHVSTKLPYTDGDPQQLQRKRHIGNDIVALVYQEGNTPFLCDVIKSHFLHSFLVVRRIQREEKGGTAYQVSVTARDDVPPFGPV 409          
BLAST of Rap-GAP domain-containing protein vs. Planmine SMEST
Match: SMESG000032884.1 (SMESG000032884.1)

HSP 1 Score: 1971.82 bits (5107), Expect = 0.000e+0
Identity = 973/975 (99.79%), Postives = 974/975 (99.90%), Query Frame = 2
Query: 1244 QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSKGRDSVISIDWPNARVNDIRK 4168
            +ITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKS NQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMPPSPPPRRTLPTNLNNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSKGRDSVISIDWPNARVNDIRK
Sbjct: 1028 KITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSCNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMPPSPPPRRTLPTNLNNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSKGRDSVISIDWPNARVNDIRK 2002          

HSP 2 Score: 856.284 bits (2211), Expect = 0.000e+0
Identity = 413/415 (99.52%), Postives = 414/415 (99.76%), Query Frame = 3
Query:    3 KMMGKILYNVDMNDLPLDKKEKRGRRAKKTASSKPLKKLSMNDESILTAPHNQESNIHSYKTNTMTGILNFQPHTAFIDGLNHNLEDSAASNVEQKNNVNIKSDVKESNQGEFNKGVLYENNEMDAGSFAYSSHEETSSYMSAEDSSSPHCKDKNIEPNTGAHSDNEFIPLSSSGGDTSIEGNSSFDNSIKPIYKDESEDLNIDADDESEGENVENAYFEVESKSATLTRDESDVDISSQMYRFPAQDTLNDSSRTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1247
            KMMGKILYNVDMNDLPLDKKEKRGRRAKKTASSKPLKKLSMNDESILTAPHNQESNIHSYKTNTMTGILNFQPHTAFIDGLNHNLEDSAASNVEQKNNVNIKSDVKESNQGEFNKGVLYENNEMDAGSFAYSSHEETSSYMSAEDSSSPHCKDKNIEPNTGAHSDNEFIPLSSSGGDTSIEGNSSFDNSIKPIYKDESEDLNIDADDESEGENVENAYFEVESKSATLTRDESDVDISSQMYRFPAQDTLNDSSRTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGT IGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELT+SFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK
Sbjct:  614 KMMGKILYNVDMNDLPLDKKEKRGRRAKKTASSKPLKKLSMNDESILTAPHNQESNIHSYKTNTMTGILNFQPHTAFIDGLNHNLEDSAASNVEQKNNVNIKSDVKESNQGEFNKGVLYENNEMDAGSFAYSSHEETSSYMSAEDSSSPHCKDKNIEPNTGAHSDNEFIPLSSSGGDTSIEGNSSFDNSIKPIYKDESEDLNIDADDESEGENVENAYFEVESKSATLTRDESDVDISSQMYRFPAQDTLNDSSRTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTAIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTNSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1028          
BLAST of Rap-GAP domain-containing protein vs. Planmine SMEST
Match: SMESG000032884.1 (SMESG000032884.1)

HSP 1 Score: 1971.44 bits (5106), Expect = 0.000e+0
Identity = 973/975 (99.79%), Postives = 974/975 (99.90%), Query Frame = 2
Query: 1244 QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSKGRDSVISIDWPNARVNDIRK 4168
            +ITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKS NQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMPPSPPPRRTLPTNLNNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSKGRDSVISIDWPNARVNDIRK
Sbjct: 1063 KITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSCNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMPPSPPPRRTLPTNLNNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSKGRDSVISIDWPNARVNDIRK 2037          

HSP 2 Score: 838.951 bits (2166), Expect = 0.000e+0
Identity = 413/450 (91.78%), Postives = 414/450 (92.00%), Query Frame = 3
Query:    3 KMMGKILYNVDMNDLPLDKKEKRGRRAKKTASSKPLKKLSMNDESILTAPHNQESNIHSYKTNTMTGILNFQPHTAFIDGLNHNLEDSAASNVEQKNNVNIKSDVKESNQGEFNKGVLYENNEMDAGSFAYSSHEETSSYMSAEDSSSPH-----------------------------------CKDKNIEPNTGAHSDNEFIPLSSSGGDTSIEGNSSFDNSIKPIYKDESEDLNIDADDESEGENVENAYFEVESKSATLTRDESDVDISSQMYRFPAQDTLNDSSRTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1247
            KMMGKILYNVDMNDLPLDKKEKRGRRAKKTASSKPLKKLSMNDESILTAPHNQESNIHSYKTNTMTGILNFQPHTAFIDGLNHNLEDSAASNVEQKNNVNIKSDVKESNQGEFNKGVLYENNEMDAGSFAYSSHEETSSYMSAEDSSSPH                                   CKDKNIEPNTGAHSDNEFIPLSSSGGDTSIEGNSSFDNSIKPIYKDESEDLNIDADDESEGENVENAYFEVESKSATLTRDESDVDISSQMYRFPAQDTLNDSSRTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGT IGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELT+SFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK
Sbjct:  614 KMMGKILYNVDMNDLPLDKKEKRGRRAKKTASSKPLKKLSMNDESILTAPHNQESNIHSYKTNTMTGILNFQPHTAFIDGLNHNLEDSAASNVEQKNNVNIKSDVKESNQGEFNKGVLYENNEMDAGSFAYSSHEETSSYMSAEDSSSPHSYKSAVEYISGSCYHSPRSSVENKYLSVPKRKRYLCKDKNIEPNTGAHSDNEFIPLSSSGGDTSIEGNSSFDNSIKPIYKDESEDLNIDADDESEGENVENAYFEVESKSATLTRDESDVDISSQMYRFPAQDTLNDSSRTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTAIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTNSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1063          
BLAST of Rap-GAP domain-containing protein vs. Planmine SMEST
Match: SMESG000032884.1 (SMESG000032884.1)

HSP 1 Score: 1971.44 bits (5106), Expect = 0.000e+0
Identity = 973/975 (99.79%), Postives = 974/975 (99.90%), Query Frame = 2
Query: 1244 QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSKGRDSVISIDWPNARVNDIRK 4168
            +ITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKS NQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMPPSPPPRRTLPTNLNNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSKGRDSVISIDWPNARVNDIRK
Sbjct: 1014 KITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSCNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMPPSPPPRRTLPTNLNNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSKGRDSVISIDWPNARVNDIRK 1988          

HSP 2 Score: 814.683 bits (2103), Expect = 0.000e+0
Identity = 398/415 (95.90%), Postives = 400/415 (96.39%), Query Frame = 3
Query:    3 KMMGKILYNVDMNDLPLDKKEKRGRRAKKTASSKPLKKLSMNDESILTAPHNQESNIHSYKTNTMTGILNFQPHTAFIDGLNHNLEDSAASNVEQKNNVNIKSDVKESNQGEFNKGVLYENNEMDAGSFAYSSHEETSSYMSAEDSSSPHCKDKNIEPNTGAHSDNEFIPLSSSGGDTSIEGNSSFDNSIKPIYKDESEDLNIDADDESEGENVENAYFEVESKSATLTRDESDVDISSQMYRFPAQDTLNDSSRTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1247
            KMMGKILYNVDMNDLPLDKKEKRGRRAKKTASSKPLKKLSMNDESILTAPHNQESNIHSYKTNTMTGILNFQPHTAFIDGLNHNLEDSAASNVEQKNNVNIKSDVKESNQGEFNKGVLYENNEMDAGSFAYSSHEETSSYMSAEDSSSPHCKDKNIEPNTGAHSDNEFIPLSSSGGDTSIEGNSSFDNSIKPIYKDESEDLNIDADDESEGENVENAYFEVESKSATLTRDESDVDISSQ+              TPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGT IGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELT+SFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK
Sbjct:  614 KMMGKILYNVDMNDLPLDKKEKRGRRAKKTASSKPLKKLSMNDESILTAPHNQESNIHSYKTNTMTGILNFQPHTAFIDGLNHNLEDSAASNVEQKNNVNIKSDVKESNQGEFNKGVLYENNEMDAGSFAYSSHEETSSYMSAEDSSSPHCKDKNIEPNTGAHSDNEFIPLSSSGGDTSIEGNSSFDNSIKPIYKDESEDLNIDADDESEGENVENAYFEVESKSATLTRDESDVDISSQI--------------TPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTAIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTNSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1014          
BLAST of Rap-GAP domain-containing protein vs. Planmine SMEST
Match: SMESG000032884.1 (SMESG000032884.1)

HSP 1 Score: 1949.48 bits (5049), Expect = 0.000e+0
Identity = 965/975 (98.97%), Postives = 966/975 (99.08%), Query Frame = 2
Query: 1244 QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSKGRDSVISIDWPNARVNDIRK 4168
            +ITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKS NQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMPPSPPPRRTLPTNLNNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSK        DWPNARVNDIRK
Sbjct: 1028 KITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSCNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMPPSPPPRRTLPTNLNNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSK--------DWPNARVNDIRK 1994          

HSP 2 Score: 856.284 bits (2211), Expect = 0.000e+0
Identity = 413/415 (99.52%), Postives = 414/415 (99.76%), Query Frame = 3
Query:    3 KMMGKILYNVDMNDLPLDKKEKRGRRAKKTASSKPLKKLSMNDESILTAPHNQESNIHSYKTNTMTGILNFQPHTAFIDGLNHNLEDSAASNVEQKNNVNIKSDVKESNQGEFNKGVLYENNEMDAGSFAYSSHEETSSYMSAEDSSSPHCKDKNIEPNTGAHSDNEFIPLSSSGGDTSIEGNSSFDNSIKPIYKDESEDLNIDADDESEGENVENAYFEVESKSATLTRDESDVDISSQMYRFPAQDTLNDSSRTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1247
            KMMGKILYNVDMNDLPLDKKEKRGRRAKKTASSKPLKKLSMNDESILTAPHNQESNIHSYKTNTMTGILNFQPHTAFIDGLNHNLEDSAASNVEQKNNVNIKSDVKESNQGEFNKGVLYENNEMDAGSFAYSSHEETSSYMSAEDSSSPHCKDKNIEPNTGAHSDNEFIPLSSSGGDTSIEGNSSFDNSIKPIYKDESEDLNIDADDESEGENVENAYFEVESKSATLTRDESDVDISSQMYRFPAQDTLNDSSRTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGT IGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELT+SFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK
Sbjct:  614 KMMGKILYNVDMNDLPLDKKEKRGRRAKKTASSKPLKKLSMNDESILTAPHNQESNIHSYKTNTMTGILNFQPHTAFIDGLNHNLEDSAASNVEQKNNVNIKSDVKESNQGEFNKGVLYENNEMDAGSFAYSSHEETSSYMSAEDSSSPHCKDKNIEPNTGAHSDNEFIPLSSSGGDTSIEGNSSFDNSIKPIYKDESEDLNIDADDESEGENVENAYFEVESKSATLTRDESDVDISSQMYRFPAQDTLNDSSRTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTAIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTNSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1028          
BLAST of Rap-GAP domain-containing protein vs. Planmine SMEST
Match: SMESG000032884.1 (SMESG000032884.1)

HSP 1 Score: 1930.22 bits (4999), Expect = 0.000e+0
Identity = 953/955 (99.79%), Postives = 954/955 (99.90%), Query Frame = 2
Query: 1244 QITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMXXXXXXXXXXXXXXXNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSK 4108
            +ITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKS NQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMPPSPPPRRTLPTNLNNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSK
Sbjct: 1028 KITIRKLDIEPHVDHLAQFYKLIHSVIQSENKQFIFTLISNIGFHFFLIPLAGSEVLILDFIKACEIVLQTSDDQNLGVEIPKLESVSLLGSMLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAARTLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATISVDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKKFLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDIINVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYLFDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNVLGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVVNGSMLVSFVTLHSKLTKSCNQSAPGGPPITKQMTDIYSQESEVRLIIRDLCGKYCWDVAFVHKYENNNVIFKSSEEQENMPPSPPPRRTLPTNLNNEKSLNLKVLKPEKPVIDYVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESLSKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLNTKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLHLKNIDQRRGRETHKIAVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLESSGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIWSENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDGAVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCEPMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSELTSSMSNVDGSSK 1982          

HSP 2 Score: 857.055 bits (2213), Expect = 0.000e+0
Identity = 413/415 (99.52%), Postives = 414/415 (99.76%), Query Frame = 3
Query:    3 KMMGKILYNVDMNDLPLDKKEKRGRRAKKTASSKPLKKLSMNDESILTAPHNQESNIHSYKTNTMTGILNFQPHTAFIDGLNHNLEDSAASNVEQKNNVNIKSDVKESNQGEFNKGVLYENNEMDAGSFAYSSHEETSSYMSAEDSSSPHCKDKNIEPNTGAHSDNEFIPLSSSGGDTSIEGNSSFDNSIKPIYKDESEDLNIDADDESEGENVENAYFEVESKSATLTRDESDVDISSQMYRFPAQDTLNDSSRTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1247
            KMMGKILYNVDMNDLPLDKKEKRGRRAKKTASSKPLKKLSMNDESILTAPHNQESNIHSYKTNTMTGILNFQPHTAFIDGLNHNLEDSAASNVEQKNNVNIKSDVKESNQGEFNKGVLYENNEMDAGSFAYSSHEETSSYMSAEDSSSPHCKDKNIEPNTGAHSDNEFIPLSSSGGDTSIEGNSSFDNSIKPIYKDESEDLNIDADDESEGENVENAYFEVESKSATLTRDESDVDISSQMYRFPAQDTLNDSSRTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGT IGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELT+SFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK
Sbjct:  614 KMMGKILYNVDMNDLPLDKKEKRGRRAKKTASSKPLKKLSMNDESILTAPHNQESNIHSYKTNTMTGILNFQPHTAFIDGLNHNLEDSAASNVEQKNNVNIKSDVKESNQGEFNKGVLYENNEMDAGSFAYSSHEETSSYMSAEDSSSPHCKDKNIEPNTGAHSDNEFIPLSSSGGDTSIEGNSSFDNSIKPIYKDESEDLNIDADDESEGENVENAYFEVESKSATLTRDESDVDISSQMYRFPAQDTLNDSSRTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTSDDLNAHHVLLGGTAIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQYFLELTNSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDSNFDSVKLVAMRILCK 1028          

HSP 3 Score: 84.3445 bits (207), Expect = 7.015e-16
Identity = 41/41 (100.00%), Postives = 41/41 (100.00%), Query Frame = 1
Query: 4174 VTLRHSSSPKFNQFLTIDRSQYSFDESVTIRKHSKSYKSTK 4296
            VTLRHSSSPKFNQFLTIDRSQYSFDESVTIRKHSKSYKSTK
Sbjct: 1983 VTLRHSSSPKFNQFLTIDRSQYSFDESVTIRKHSKSYKSTK 2023          
The following BLAST results are available for this feature:
BLAST of Rap-GAP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RALGAPA14.051e-14632.05Ral GTPase activating protein catalytic alpha subu... [more]
RALGAPA12.285e-14532.15Ral GTPase activating protein catalytic alpha subu... [more]
RALGAPA14.755e-14532.26Ral GTPase activating protein catalytic alpha subu... [more]
RALGAPA15.298e-14532.26Ral GTPase activating protein catalytic alpha subu... [more]
RALGAPA16.310e-14532.26Ral GTPase activating protein catalytic alpha subu... [more]
back to top
BLAST of Rap-GAP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hgap-11.947e-4238.01Heterodimeric GTPase Activating Protein subunit [... [more]
hgap-17.023e-4238.01Heterodimeric GTPase Activating Protein subunit [... [more]
hgap-11.847e-4138.01Heterodimeric GTPase Activating Protein subunit [... [more]
hgap-19.193e-4138.01Heterodimeric GTPase Activating Protein subunit [... [more]
hgap-19.404e-4138.01Heterodimeric GTPase Activating Protein subunit [... [more]
back to top
BLAST of Rap-GAP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG55216.660e-8634.55gene:FBgn0039466 transcript:FBtr0085069[more]
CG55218.267e-8634.55gene:FBgn0039466 transcript:FBtr0301134[more]
gig2.151e-1833.33gene:FBgn0005198 transcript:FBtr0074819[more]
gig2.224e-1833.33gene:FBgn0005198 transcript:FBtr0332690[more]
RapGAP14.503e-1729.88gene:FBgn0264895 transcript:FBtr0334848[more]
back to top
BLAST of Rap-GAP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ralgapa26.695e-14132.40Ral GTPase activating protein, alpha subunit 2 (ca... [more]
ralgapa27.523e-14132.40Ral GTPase activating protein, alpha subunit 2 (ca... [more]
ralgapa21.179e-14032.40Ral GTPase activating protein, alpha subunit 2 (ca... [more]
ralgapa21.271e-14032.40Ral GTPase activating protein, alpha subunit 2 (ca... [more]
ralgapa21.729e-14032.54Ral GTPase activating protein, alpha subunit 2 (ca... [more]
back to top
BLAST of Rap-GAP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RALGAPA12.974e-13731.78Ral GTPase activating protein catalytic alpha subu... [more]
RALGAPA14.981e-13731.74Ral GTPase activating protein catalytic alpha subu... [more]
RALGAPA11.950e-13631.53Ral GTPase activating protein catalytic alpha subu... [more]
ralgapa22.462e-13631.24Ral GTPase activating protein, alpha subunit 2 (ca... [more]
RALGAPA15.247e-13631.74Ral GTPase activating protein catalytic alpha subu... [more]
back to top
BLAST of Rap-GAP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ralgapa19.027e-15032.15Ral GTPase activating protein, alpha subunit 1 [So... [more]
Ralgapa11.802e-14932.15Ral GTPase activating protein, alpha subunit 1 [So... [more]
Ralgapa15.984e-14832.37Ral GTPase activating protein, alpha subunit 1 [So... [more]
Ralgapa11.126e-14732.37Ral GTPase activating protein, alpha subunit 1 [So... [more]
Ralgapa11.126e-14732.37Ral GTPase activating protein, alpha subunit 1 [So... [more]
back to top
BLAST of Rap-GAP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6GYP7|RGPA1_MOUSE6.881e-14732.37Ral GTPase-activating protein subunit alpha-1 OS=M... [more]
sp|O55007|RGPA1_RAT9.460e-14632.44Ral GTPase-activating protein subunit alpha-1 OS=R... [more]
sp|Q6GYQ0|RGPA1_HUMAN2.348e-14432.26Ral GTPase-activating protein subunit alpha-1 OS=H... [more]
sp|Q2PPJ7|RGPA2_HUMAN3.408e-13633.04Ral GTPase-activating protein subunit alpha-2 OS=H... [more]
sp|P86411|RGPA2_RAT3.540e-13332.54Ral GTPase-activating protein subunit alpha-2 OS=R... [more]
back to top
BLAST of Rap-GAP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IQ719.018e-16933.43ral GTPase-activating protein subunit alpha-1-like... [more]
A0A1S3IPB21.913e-16733.43ral GTPase-activating protein subunit alpha-1-like... [more]
A0A1S3IPB94.547e-16733.40ral GTPase-activating protein subunit alpha-1-like... [more]
V3ZXJ45.586e-14932.95Rap-GAP domain-containing protein OS=Lottia gigant... [more]
A0A2I3BRX91.246e-14632.15Ral GTPase-activating protein subunit alpha-1 OS=M... [more]
back to top
BLAST of Rap-GAP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ralgapa29.613e-14032.92Ral GTPase activating protein, alpha subunit 2 (ca... [more]
ralgapa26.365e-13833.44Ral GTPase activating protein, alpha subunit 2 (ca... [more]
ralgapa22.187e-13533.41Ral GTPase activating protein, alpha subunit 2 (ca... [more]
ralgapa11.811e-13331.65Ral GTPase activating protein, alpha subunit 1 (ca... [more]
tsc24.848e-1830.21TSC complex subunit 2 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of Rap-GAP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ralgapa11.591e-13232.97Ral GTPase activating protein, alpha subunit 1 (ca... [more]
ENSPMAT00000003319.15.904e-6857.37pep scaffold:Pmarinus_7.0:GL478269:10551:16928:1 g... [more]
ENSPMAT00000000176.15.969e-3727.94pep scaffold:Pmarinus_7.0:GL480328:40:24176:1 gene... [more]
tsc22.883e-2432.28TSC complex subunit 2 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
rap1gap5.753e-1327.59RAP1 GTPase activating protein [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Rap-GAP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rap-GAP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO332599.947e-11128.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365021.204e-1429.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393353.230e-1229.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378111.570e-1029.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429422.581e-926.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rap-GAP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ralgapa12.391e-13931.56Ral GTPase activating protein catalytic alpha subu... [more]
ralgapa21.852e-11931.80Ral GTPase activating protein catalytic alpha subu... [more]
ralgapa25.767e-10930.95Ral GTPase activating protein catalytic alpha subu... [more]
TSC21.639e-2131.22TSC complex subunit 2 [Source:NCBI gene;Acc:101168... [more]
si:ch1073-90m23.11.539e-1429.35rap1 GTPase-activating protein 2 [Source:NCBI gene... [more]
back to top
BLAST of Rap-GAP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032884.10.000e+099.79SMESG000032884.1[more]
SMESG000032884.10.000e+099.79SMESG000032884.1[more]
SMESG000032884.10.000e+099.79SMESG000032884.1[more]
SMESG000032884.10.000e+098.97SMESG000032884.1[more]
SMESG000032884.17.015e-1699.79SMESG000032884.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004017 ID=SMED30004017|Name=Rap-GAP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4408bp
TGAAAATGATGGGGAAAATTCTTTATAATGTCGATATGAATGATTTGCCG
TTGGACAAAAAAGAGAAGCGTGGTCGTCGAGCTAAAAAAACTGCTTCTTC
AAAACCATTGAAAAAGCTATCAATGAATGATGAAAGCATATTAACTGCTC
CACACAATCAAGAGTCGAATATTCACTCATATAAAACTAATACAATGACA
GGGATTCTCAATTTTCAACCACATACTGCATTTATAGATGGATTAAATCA
TAATTTGGAAGACTCGGCTGCATCCAATGTAGAACAAAAGAATAATGTCA
ACATAAAATCAGATGTGAAAGAATCGAATCAAGGAGAATTTAATAAAGGT
GTACTCTACGAGAACAATGAGATGGATGCTGGCAGTTTTGCCTATTCTAG
TCATGAAGAAACATCAAGCTATATGTCGGCGGAAGATTCCAGCAGTCCTC
ATTGTAAAGATAAAAACATTGAACCGAACACGGGGGCTCATTCGGACAAC
GAATTCATTCCATTATCTTCATCAGGTGGCGACACGAGCATTGAAGGAAA
TAGTTCTTTTGATAATTCAATCAAGCCGATTTATAAAGATGAAAGTGAAG
ATCTCAACATAGACGCAGACGATGAAAGTGAAGGAGAAAATGTTGAAAAT
GCATACTTTGAAGTCGAGAGTAAATCAGCAACTTTAACAAGAGACGAAAG
CGATGTTGATATTTCGTCTCAAATGTATAGATTTCCCGCCCAAGATACAC
TAAATGATTCGTCTAGAACTCCAACTAAACATTCTAATCGACGAAAAGTG
CAAATATCGAAGAGAATCGAAAGAAATAGCATGAATATTGAAGATAATAT
AGTCAACTCAATTACCAACACTCAAGATTTATCTAATCAAGTCGTCACAT
CTGATGATTTGAATGCCCATCATGTACTTTTGGGTGGAACGGTTATTGGC
TGGAGCCAAGAATCTGTCGTTTTGCTCTGGAAACGATGTATTGGATTATT
GGGCAATATCACTCTAATCAAAAATCCGAAAATGCTTCATTCTATTTGTC
AATATTTCTTGGAATTGACAGATTCATTCATAAAAATGAGAGAAAACATG
TGTATTCCAAACGGTAACCAAGTCACACCAACACCACCTTTGTATACTCC
ACCTATTGAGTACATAGTTCCATGGATGTTTCAGGTTTTTAAGTTGGATT
CAAATTTTGATAGTGTGAAATTGGTGGCAATGCGTATCCTTTGCAAATAA
CCATTAGGAAACTTGATATTGAGCCACATGTTGATCATTTGGCTCAATTC
TACAAGCTTATACATTCAGTTATTCAAAGTGAAAACAAACAATTTATCTT
TACCCTTATTAGTAACATAGGATTCCATTTCTTTTTAATACCCTTAGCAG
GATCTGAGGTTCTTATTCTTGACTTCATTAAGGCTTGTGAAATTGTTTTA
CAAACATCCGATGATCAAAATTTGGGAGTTGAAATTCCTAAATTGGAATC
GGTTTCATTGCTTGGATCCATGCTAAAATTTCAGGATCTGAACGCGAATT
TCAAAGTATTTGATGCCAATTCGAAAACCATTAATATCATTGATTCGGGT
TCATACAAAAGTGAAATTGTAAATATATTGATCAGTTCCGCAAAACAAGA
ACCTCGGATTGCCGCAAGAACTCTCAGCATCGTTTGTATTAGTTTACATT
GTTATACTGTACTCTCGTCGATTGAAACAACGACTTCAGACTTAAATGAT
ATTCGAAATTGTATTTTATTGCTGCTTAGCCTAATGAGATTCGACAATGT
GCATATAGCAACGATTTCCGTTGATATGATTCGCTTTTTAGTGAATATCT
GTAGTCAGATGCAAGAAAAATTGCCTTTGATCCCCGAAAAGATCATACAA
GTTTTATCTTGGAATATCAATCAGACGTGGCTCAAATGTCGAAAATCTAT
TAATTCCAACGATAAGAAATTTCTTACCTCTCTCATATTTACTCTAGTTG
ATTGGACTATGCATTTACCTTTAAGCCAGTTGCTAGAGTCTAATGACTTA
CATTCCAAAGGCCTCATTTATTTGGCTTTCAGTGCTTTAGAAAATGTTTT
AAAAGACAATGATATTATTAATGTAATGAAAAGTTCTACGAGTTTAAAAG
TTTCATCGGAGAAGAAGACCACGTTTGAATCCAAAAGAACATCAATGAAG
AATCCTGCTATTCATCAAGGTAATTTCAATGGACTCTCGGTAGATCCTTT
AGTTGAATACCCATACTTGTTTGATGTTAAGCCTGTCGAAGGTGTTACAC
AAGAAGTGAATTCGCCAGAAGTTACTTTTAGGAGTCAGTACGAATTTGTT
AAATTGGCAGCGAGAGTAGCGCTCTGTCACTTAATAAATAATATTGGACA
ATATCCAAAAAATAATGTTTTGGGTGGCCTTAGTAGCTGTGTACAAGAAC
ATCATGACTTTCAAGTAGTAAAGGCAAAATCTTCACCAGATGGTTCTCCA
GAGAATGTGACATATGATGATTTATCTCGAGAGGTGTTCAATACTCCTGA
ATTGCAAATGTTTGTAGTTAACGGTTCGATGCTTGTCTCTTTTGTTACAC
TGCATTCCAAACTTACAAAATCCTTTAATCAATCAGCACCCGGTGGCCCA
CCAATTACTAAACAAATGACAGACATTTATTCACAAGAATCTGAGGTTAG
ATTGATTATTCGTGACTTGTGTGGGAAATATTGCTGGGATGTTGCTTTTG
TACACAAATACGAAAATAACAACGTAATTTTTAAATCGTCCGAAGAACAA
GAAAATATGCCTCCTTCGCCACCACCTCGAAGGACTCTTCCGACAAATTT
AAATAACGAGAAATCTCTCAATTTAAAAGTTCTAAAACCAGAAAAGCCAG
TAATAGACTACGTGGACAATTTACTCGTGGAATTGACCGAAATGAATCCA
GAAATCTTCAGCAATCAATTCCCCAAACCGTCTGCCGTAGAATCTGGTCA
AACAAGCTTGGAGTCATTATCTAAGCGCCAAATTATAGAACAGAGTATTG
TTGAGAATAACTTATTTGATAATCATCATTGTTTGAAAATTTCTCACCCA
AAATTAGTTGAAAAGAAACTGCGTTCTTTCGTTCCTTATGAAAATCCACC
GGAAATAACAACATTGAATACGAAATTTTATTTCTGTAGACAAATTCTCA
CACAACTTGGATTTTTATCGTGGAAAAGAAGAGCGTCTATTGATCTGGTT
CAGAAGTCTAACATTTTCCTTCATTTGAAGAACATTGATCAGCGTCGAGG
GCGAGAAACTCACAAAATCGCTGTGCTATATGTGGCTTGGGGTCAGGAAG
ACAAAGAATCAATATTAGGAAATACTACCGGAAGTCTAGAGTTTAATACA
TTCATCAGTGGTCTGGGCTGGACAGTTAATTTAGAAAATCACAAAGGATT
TATGGGCGGTCTTGAATCTAGCGGCCGAAATGGATTTTTTGCACCATATT
ATGCGAATTCCACTTTGGAAATTATGTTTCACGTGTCAACATGGATGCCT
TCAGAAAACCCTGGCGATAAACCAAATAAATTTAAACATTTGGGAAATGA
TGAAGTAATGGTGATCTGGAGTGAAAATTATCGGGACTACCGATTTCATA
TCACTAGGACGGGATTCGGGGATGTTATGATCATCATTTATCCCCTCAGG
AATGGGCTCTTTGGAATCAATATCAAGACTAAAACTGAGATTATGTTATT
TGGGCCACTTTTTGATGGAGCGGTTGTTGGAGAAAAAGAATTACCTGTTC
TAGTTCGTGCAACTGCAATAAATGCCGGGCGAAGAATTCGTGAATGTAGA
CCTCACTATCAAGAATTCTTTGTCGAAAGAGCGAATTATTTAGAAAAAGC
CATAAAGGAATTCTGTGAGCCAATGTCTTTTGAAGATTTTGCGGAACATA
TTTATGGAATACCGGCTTTGAATCAAGATGATTCGTTTCAAGCCAATTCT
TCAACAGAATTGTCACCATTAACAAACACATCAGATAATATTAAAAATAC
AGGATTCACAACTAGTGAATTAACTTCATCAATGTCTAATGTTGATGGAA
GTAGTAAAGGCAGAGATTCTGTAATTTCTATAGATTGGCCGAATGCTCGA
GTTAACGATATCCGTAAATAGGAGTAACTCTTCGACACAGCAGCTCGCCG
AAGTTCAATCAATTCCTCACCATTGATCGATCTCAATATTCGTTTGATGA
ATCCGTCACCATACGTAAACATTCTAAAAGTTATAAATCCACAAAATGAT
TCTTTTTGATCGGAATTTGTGACAGCCCGAGAGTTTCAAAATTATTTTTA
GCGTTCTTTCATCTTTTATTCTTTATAAATGTATCATAAATGATGTTAAA
ATAAACAT
back to top

protein sequence of SMED30004017-orf-1

>SMED30004017-orf-1 ID=SMED30004017-orf-1|Name=SMED30004017-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=416bp
KMMGKILYNVDMNDLPLDKKEKRGRRAKKTASSKPLKKLSMNDESILTAP
HNQESNIHSYKTNTMTGILNFQPHTAFIDGLNHNLEDSAASNVEQKNNVN
IKSDVKESNQGEFNKGVLYENNEMDAGSFAYSSHEETSSYMSAEDSSSPH
CKDKNIEPNTGAHSDNEFIPLSSSGGDTSIEGNSSFDNSIKPIYKDESED
LNIDADDESEGENVENAYFEVESKSATLTRDESDVDISSQMYRFPAQDTL
NDSSRTPTKHSNRRKVQISKRIERNSMNIEDNIVNSITNTQDLSNQVVTS
DDLNAHHVLLGGTVIGWSQESVVLLWKRCIGLLGNITLIKNPKMLHSICQ
YFLELTDSFIKMRENMCIPNGNQVTPTPPLYTPPIEYIVPWMFQVFKLDS
NFDSVKLVAMRILCK*
back to top

protein sequence of SMED30004017-orf-2

>SMED30004017-orf-2 ID=SMED30004017-orf-2|Name=SMED30004017-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=884bp
MLKFQDLNANFKVFDANSKTINIIDSGSYKSEIVNILISSAKQEPRIAAR
TLSIVCISLHCYTVLSSIETTTSDLNDIRNCILLLLSLMRFDNVHIATIS
VDMIRFLVNICSQMQEKLPLIPEKIIQVLSWNINQTWLKCRKSINSNDKK
FLTSLIFTLVDWTMHLPLSQLLESNDLHSKGLIYLAFSALENVLKDNDII
NVMKSSTSLKVSSEKKTTFESKRTSMKNPAIHQGNFNGLSVDPLVEYPYL
FDVKPVEGVTQEVNSPEVTFRSQYEFVKLAARVALCHLINNIGQYPKNNV
LGGLSSCVQEHHDFQVVKAKSSPDGSPENVTYDDLSREVFNTPELQMFVV
NGSMLVSFVTLHSKLTKSFNQSAPGGPPITKQMTDIYSQESEVRLIIRDL
CGKYCWDVAFVHKYENNNVIFKSSEEQENMPPSPPPRRTLPTNLNNEKSL
NLKVLKPEKPVIDYVDNLLVELTEMNPEIFSNQFPKPSAVESGQTSLESL
SKRQIIEQSIVENNLFDNHHCLKISHPKLVEKKLRSFVPYENPPEITTLN
TKFYFCRQILTQLGFLSWKRRASIDLVQKSNIFLHLKNIDQRRGRETHKI
AVLYVAWGQEDKESILGNTTGSLEFNTFISGLGWTVNLENHKGFMGGLES
SGRNGFFAPYYANSTLEIMFHVSTWMPSENPGDKPNKFKHLGNDEVMVIW
SENYRDYRFHITRTGFGDVMIIIYPLRNGLFGINIKTKTEIMLFGPLFDG
AVVGEKELPVLVRATAINAGRRIRECRPHYQEFFVERANYLEKAIKEFCE
PMSFEDFAEHIYGIPALNQDDSFQANSSTELSPLTNTSDNIKNTGFTTSE
LTSSMSNVDGSSKGRDSVISIDWPNARVNDIRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0043547positive regulation of GTPase activity
GO:0051056regulation of small GTPase mediated signal transduction
GO:0006355regulation of transcription, DNA-templated
GO:0090630activation of GTPase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027107Tuberin/Ral-act_asu
IPR000331Rap_GAP_dom
Vocabulary: molecular function
TermDefinition
GO:0005096GTPase activator activity
GO:0046982protein heterodimerization activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 243..264
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 131..146
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 131..151
NoneNo IPR availablePANTHERPTHR10063:SF2RAL GTPASE-ACTIVATING PROTEIN SUBUNIT ALPHA-2coord: 5..415
IPR027107Tuberin/Ral GTPase-activating protein subunit alphaPANTHERPTHR10063TUBERINcoord: 5..415