Peptidyl-prolyl cis-trans isomerase

Overview
NamePeptidyl-prolyl cis-trans isomerase
Smed IDSMED30004016
Length (bp)1515
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidyl-prolyl cis-trans isomerase (SMED30004016) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidyl-prolyl cis-trans isomerase (SMED30004016) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidyl-prolyl cis-trans isomerase (SMED30004016) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidyl-prolyl cis-trans isomerase (SMED30004016) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004016

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30004016h1SMcG0001801 dd_Smed_v4_5960_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004016h1SMcG0001801 dd_Smed_v4_5960_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIL4 (peptidylprolyl isomerase like 4 [Source:HGNC Symbol;Acc:HGNC:15702])

HSP 1 Score: 383.645 bits (984), Expect = 3.947e-128
Identity = 194/320 (60.62%), Postives = 249/320 (77.81%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGE--TYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVS 1002
            M+V+ ET++G+  IDLY +ERPR C NFLKLCK+KYYNY L H++Q   + Q GDPTGTG GG SI+ Q+ G+  ++F  E  P+IKH+K G +SMVNNG ++HGSQF IT   NLDYLDG+HTVFGE+++G+ I+  +N  +VDK  +P +++RI HT+ILDDPF D P L+ P+ SPEPT  QL S RIGA+E+I+D  G + EE +EI+  KEAK  A +L ++GD+PD DIKPPENVLFVC LNP+TT EDLE+IFS+FG I SCEVIRD+KTG SL YAFIEFE ++ CE A++ M+ VLIDDRRIHVDFSQSV+
Sbjct:    1 MAVLLETTLGDVVIDLYTEERPRACLNFLKLCKIKYYNYCLIHNVQRDFIIQTGDPTGTGRGGESIFGQLYGDQASFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGENLDYLDGVHTVFGEVTEGMDIIKKINETFVDKDFVPYQDIRINHTVILDDPFDDPPDLLIPDRSPEPTREQLDSGRIGADEEIDDFKGRSAEEVEEIKAEKEAKTQAILLEMVGDLPDADIKPPENVLFVCKLNPVTTDEDLEIIFSRFGPIRSCEVIRDWKTGESLCYAFIEFEKEEDCEKAFFKMDNVLIDDRRIHVDFSQSVA 320          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIL3 (peptidylprolyl isomerase like 3 [Source:HGNC Symbol;Acc:HGNC:9262])

HSP 1 Score: 127.872 bits (320), Expect = 3.572e-34
Identity = 70/165 (42.42%), Postives = 95/165 (57.58%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYV-DKANIPLREVRIYHTIILDDPF 540
            MSV   T VG+  I+++ +  P+ CENFL LC   YYN  +FH      + Q GDPTGTG GG+SIW +      F +E    +KH   G++SM NNG N +GSQFFIT      +LD  +TVFG++ DG+  +D L  + V +K   PL +V I    I  +PF
Sbjct:    1 MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGK-----KFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQ-PHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPF 159          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIL3 (peptidylprolyl isomerase like 3 [Source:HGNC Symbol;Acc:HGNC:9262])

HSP 1 Score: 125.561 bits (314), Expect = 4.359e-33
Identity = 69/164 (42.07%), Postives = 94/164 (57.32%), Query Frame = 1
Query:   52 SVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYV-DKANIPLREVRIYHTIILDDPF 540
            SV   T VG+  I+++ +  P+ CENFL LC   YYN  +FH      + Q GDPTGTG GG+SIW +      F +E    +KH   G++SM NNG N +GSQFFIT      +LD  +TVFG++ DG+  +D L  + V +K   PL +V I    I  +PF
Sbjct:   21 SVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGK-----KFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQ-PHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPF 178          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIL1 (peptidylprolyl isomerase like 1 [Source:HGNC Symbol;Acc:HGNC:9260])

HSP 1 Score: 124.79 bits (312), Expect = 4.576e-33
Identity = 62/153 (40.52%), Postives = 94/153 (61.44%), Query Frame = 1
Query:   52 SVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRI 510
            +V  ETS+G   ++LY K  P+ C+NF +L +  YYN T FH I    + Q GDPTGTG GG SI+ +      F +EL P +K   +G+++M N G + +GSQFF+TL+    +LDG HT+FG +  GI +V+ +  V  +  + P+ +V+I
Sbjct:   13 NVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGK-----QFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPT-QWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKI 159          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: CWC27 (CWC27 spliceosome associated cyclophilin [Source:HGNC Symbol;Acc:HGNC:10664])

HSP 1 Score: 118.242 bits (295), Expect = 4.508e-28
Identity = 60/165 (36.36%), Postives = 96/165 (58.18%), Query Frame = 1
Query:   55 VIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEIS-DGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPD 546
            V+ +T+ G+  I+L+ KE P+ C NF++LC   YY+ T+FH +    + Q GDPTGTG+GG SI+        F +E   +++  + GL++M N G + +GSQFF TL    D L+  HT+FG+++ D +  +  L+ V +D    P    +I    +L +PF D
Sbjct:   15 VLLKTTAGDIDIELWSKEAPKACRNFIQLCLEAYYDNTIFHRVVPGFIVQGGDPTGTGSGGESIYG-----APFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLG-RADELNNKHTIFGKVTGDTVYNMLRLSEVDIDDDERPHNPHKIKSCEVLFNPFDD 173          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: sig-7 (Peptidyl-prolyl cis-trans isomerase sig-7 [Source:UniProtKB/Swiss-Prot;Acc:G5EEW6])

HSP 1 Score: 375.555 bits (963), Expect = 2.593e-126
Identity = 180/334 (53.89%), Postives = 240/334 (71.86%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGET--YFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLI-SNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVSKQWKYYKDYQRQK 1041
            M+V+ ET++G+  IDL++KERPRC  NFLKLCK KYYN   FHSI+   VAQ GDPTGTG GG S++  + GE   YF  E  PK++H + G++S VNNG N  GSQFFITL  NLDYLD  HT+FG++++G+  ++ LN    D  N P +++RI HTI+LDDPF +   + FP  SP PT   L+ +++I  +E  ++D G T EE  E  + +E    AQIL ++GD+ D D  PPENVLFVC LNP+TT EDLE+IFS+FG+I +CE++RD ++G+SLQYAFIEF+N K CE A++ M+ VLIDDRRIHVDFSQSVS+ +KY    Q+Q+
Sbjct:    1 MAVLIETTLGDLIIDLFVKERPRCSLNFLKLCKKKYYNLNQFHSIERNYVAQTGDPTGTGKGGESVYSDMYGEQGRYFEREDLPKMRHTRMGIVSFVNNGDNMLGSQFFITLGENLDYLDDQHTIFGQVTEGLETLEKLNEQLADTNNRPFKDIRISHTIVLDDPFDEDARISFPPRSPSPTYEMLVKTDQIALDEKEDEDEGKTAEEIAEELQQREMAEQAQILEMVGDLKDADEVPPENVLFVCKLNPVTTDEDLEIIFSRFGKINNCEIVRDRRSGDSLQYAFIEFDNAKSCEQAFFKMDNVLIDDRRIHVDFSQSVSQNYKYKPKSQQQE 334          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: sig-7 (Peptidyl-prolyl cis-trans isomerase sig-7 [Source:UniProtKB/Swiss-Prot;Acc:G5EEW6])

HSP 1 Score: 375.555 bits (963), Expect = 2.593e-126
Identity = 180/334 (53.89%), Postives = 240/334 (71.86%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGET--YFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLI-SNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVSKQWKYYKDYQRQK 1041
            M+V+ ET++G+  IDL++KERPRC  NFLKLCK KYYN   FHSI+   VAQ GDPTGTG GG S++  + GE   YF  E  PK++H + G++S VNNG N  GSQFFITL  NLDYLD  HT+FG++++G+  ++ LN    D  N P +++RI HTI+LDDPF +   + FP  SP PT   L+ +++I  +E  ++D G T EE  E  + +E    AQIL ++GD+ D D  PPENVLFVC LNP+TT EDLE+IFS+FG+I +CE++RD ++G+SLQYAFIEF+N K CE A++ M+ VLIDDRRIHVDFSQSVS+ +KY    Q+Q+
Sbjct:    1 MAVLIETTLGDLIIDLFVKERPRCSLNFLKLCKKKYYNLNQFHSIERNYVAQTGDPTGTGKGGESVYSDMYGEQGRYFEREDLPKMRHTRMGIVSFVNNGDNMLGSQFFITLGENLDYLDDQHTIFGQVTEGLETLEKLNEQLADTNNRPFKDIRISHTIVLDDPFDEDARISFPPRSPSPTYEMLVKTDQIALDEKEDEDEGKTAEEIAEELQQREMAEQAQILEMVGDLKDADEVPPENVLFVCKLNPVTTDEDLEIIFSRFGKINNCEIVRDRRSGDSLQYAFIEFDNAKSCEQAFFKMDNVLIDDRRIHVDFSQSVSQNYKYKPKSQQQE 334          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: sig-7 (Peptidyl-prolyl cis-trans isomerase sig-7 [Source:UniProtKB/Swiss-Prot;Acc:G5EEW6])

HSP 1 Score: 280.411 bits (716), Expect = 2.644e-90
Identity = 136/258 (52.71%), Postives = 185/258 (71.71%), Query Frame = 1
Query:  271 YFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLI-SNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVSKQWKYYKDYQRQK 1041
            YF  E  PK++H + G++S VNNG N  GSQFFITL  NLDYLD  HT+FG++++G+  ++ LN    D  N P +++RI HTI+LDDPF +   + FP  SP PT   L+ +++I  +E  ++D G T EE  E  + +E    AQIL ++GD+ D D  PPENVLFVC LNP+TT EDLE+IFS+FG+I +CE++RD ++G+SLQYAFIEF+N K CE A++ M+ VLIDDRRIHVDFSQSVS+ +KY    Q+Q+
Sbjct:    8 YFEREDLPKMRHTRMGIVSFVNNGDNMLGSQFFITLGENLDYLDDQHTIFGQVTEGLETLEKLNEQLADTNNRPFKDIRISHTIVLDDPFDEDARISFPPRSPSPTYEMLVKTDQIALDEKEDEDEGKTAEEIAEELQQREMAEQAQILEMVGDLKDADEVPPENVLFVCKLNPVTTDEDLEIIFSRFGKINNCEIVRDRRSGDSLQYAFIEFDNAKSCEQAFFKMDNVLIDDRRIHVDFSQSVSQNYKYKPKSQQQE 265          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-12 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:Q18445])

HSP 1 Score: 132.494 bits (332), Expect = 3.216e-36
Identity = 64/152 (42.11%), Postives = 95/152 (62.50%), Query Frame = 1
Query:   55 VIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRI 510
            VI +T++G+  ++LY    PR C+NF +L K  YYN T+FH I    + Q GDPTGTG GG SI+        F +E+  ++KH  +G++SM N G N +GSQFFITL+    +LDG HT+FG ++ G+ ++ ++  V  D  + P  E+RI
Sbjct:   12 VILDTTMGKIALELYWNHAPRTCQNFSQLAKRNYYNGTIFHRIIADFMIQGGDPTGTGRGGASIYGD-----KFSDEIDERLKHTGAGILSMANAGPNTNGSQFFITLAPT-QHLDGKHTIFGRVAAGMKVIANMGRVDTDNHDRPKIEIRI 157          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-10 (Peptidyl-prolyl cis-trans isomerase 10 [Source:UniProtKB/Swiss-Prot;Acc:P52017])

HSP 1 Score: 119.783 bits (299), Expect = 1.201e-31
Identity = 62/164 (37.80%), Postives = 90/164 (54.88%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPF 540
            MSV   T+ G+  I+LY+ + P+ CENFL LC   YYN  +FH      + Q GDPT +G GG SIW        F +E    +KH   G +SM NNG + + SQFFIT +    +LD  +T+FG++ DG   ++ +  + VD    PL + +I +  I  +P 
Sbjct:    1 MSVTLHTTSGDIKIELYVDDAPKACENFLALCASDYYNGCIFHRNIKDFMVQTGDPTHSGKGGESIWGGP-----FEDEFVSALKHDSRGCVSMANNGPDSNRSQFFITYAKQA-HLDMKYTLFGKVIDGFDTLEEIETIKVDNKYRPLVQQKIQNVTIHANPM 158          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG5808 (gene:FBgn0027617 transcript:FBtr0084738)

HSP 1 Score: 379.407 bits (973), Expect = 9.865e-125
Identity = 178/325 (54.77%), Postives = 237/325 (72.92%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQING--ETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVSK-QWK 1014
            MSV+ ET++G+ T+DL+I ERP  C NFLKLC++KYYN+ LFH++Q   +AQ GDP+G G GG SIW  + G  + +F  E  PKI H  +G++S+V+ G+N  GSQFF+TL  NL  LDG H V GE+ +G  ++  LN+  VD +  P +++RI HT++L+DPFP+   L  P  SP P+  +L + RI A+EDI+D  G+T EE QE+   +EAK  A IL ++GD+PD D+ PPENVLFVC LNP+TT +DLE+IFS FG +  CEVIRD KTG+SLQYAF+EFE++K CE AY+ M+ VLIDDRRIHVDFSQSVSK  W+
Sbjct:    1 MSVVIETTMGDLTVDLFISERPIACLNFLKLCRLKYYNFNLFHTVQQGFIAQTGDPSGAGDGGSSIWGVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQFFLTLGENLTSLDGNHCVIGEVVEGHEVLRKLNDAIVDDSFRPYQDIRITHTVVLEDPFPNPRGLQAPSRSPSPSAERLKNGRIAADEDIDDTDGMTAEEMQEMLAEREAKARATILEIVGDLPDADMAPPENVLFVCKLNPVTTDDDLEIIFSSFGVLKGCEVIRDRKTGDSLQYAFVEFEDQKSCEAAYFKMDNVLIDDRRIHVDFSQSVSKVTWR 325          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: Cypl (gene:FBgn0035141 transcript:FBtr0072564)

HSP 1 Score: 131.339 bits (329), Expect = 1.527e-35
Identity = 65/152 (42.76%), Postives = 93/152 (61.18%), Query Frame = 1
Query:   55 VIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRI 510
            V  ETS+GE T++LY K  P  C NF +L +  YYN  +FH I    + Q GDPTGTG GG SI+      + F +EL   ++H  +G++SM N+G + +GSQFFITL+    +LDG HT+FG +  G+ +V  +  V  DK + P+  +RI
Sbjct:   23 VTLETSMGEITVELYWKHAPNTCRNFAELSRRGYYNNVVFHRIIRDFMIQGGDPTGTGRGGASIYG-----SEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPT-QWLDGKHTIFGRVYTGMEVVKRIGMVETDKNDRPVDPLRI 168          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG7747 (gene:FBgn0034109 transcript:FBtr0087179)

HSP 1 Score: 134.42 bits (337), Expect = 9.002e-34
Identity = 64/183 (34.97%), Postives = 103/183 (56.28%), Query Frame = 1
Query:   55 VIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLI 603
            V   T++G   ++L+  + PR C+NF+K C   YYN  +FH      + Q GDPTG+G+GG SIW +      F +E KP + H   G++SM N+G N +GSQFFIT   +  +LDG HT+FG++  G+  +  + N+ VD  + P+ ++ I  + +  +PF +    +  E   E   ++ I
Sbjct:  282 VRLNTNLGPLNLELFCDQTPRACDNFIKHCANGYYNNVMFHRSIRNFIVQGGDPTGSGSGGESIWGK-----KFEDEFKPNLTHTGRGVLSMANSGPNTNGSQFFITY-RSCKHLDGKHTIFGKLVGGLDTLQKMENIEVDNKDRPIEDIIIESSQVFVNPFAEAAEQLAKEREEEAAGKEEI 458          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG11777 (gene:FBgn0033527 transcript:FBtr0088273)

HSP 1 Score: 113.235 bits (282), Expect = 3.131e-29
Identity = 61/146 (41.78%), Postives = 80/146 (54.79%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKAN 486
            MSV   T VG+  I+L+    P+ CENFL LC   YY+  +F       + Q GDPT TG  G SIW Q      F +E K  IKH   G++SM NNG N + SQFFIT +   + LD  +T+FG + DG   +D L  + V+  N
Sbjct:    1 MSVTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTGKNGQSIWGQ-----KFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPN-LDLKYTLFGRVIDGFDALDELEKLPVNPKN 140          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG10907 (gene:FBgn0036207 transcript:FBtr0076029)

HSP 1 Score: 118.242 bits (295), Expect = 2.911e-28
Identity = 68/194 (35.05%), Postives = 106/194 (54.64%), Query Frame = 1
Query:   55 VIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEIS-DGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEP--------TERQLISN 609
            V+ +T+VG+  I+L+ +E P+ C NF++LC   YY  T FH +    + Q GDP G GTGG SI+ Q      F +E   ++++ + GL+ M N+G++ +GSQFF T +   + L   +T+FG+I+ D I  +  L +  VD    P+   RI  T +L +PF D    + P I  +P         ERQ + N
Sbjct:   15 VLLKTTVGDIDIELWARECPKACRNFVQLCLEGYYKNTEFHRLVKGFIVQGGDPNGDGTGGESIYGQP-----FKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPE-LQNKNTLFGKITGDTIYNMLKLEDGIVDHQERPMHAHRIVSTEVLSNPFDD----IVPRILSQPSTKSKKTKKERQGVKN 198          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppil4 (peptidylprolyl isomerase (cyclophilin)-like 4 [Source:ZFIN;Acc:ZDB-GENE-030131-6251])

HSP 1 Score: 396.741 bits (1018), Expect = 4.646e-134
Identity = 190/320 (59.38%), Postives = 244/320 (76.25%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGET--YFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVS 1002
            M+V+ ET++G+  IDLY +ERP+   NFLKLCK+KYYNY L H++Q   + Q GDPTGTG GG S++ ++ G+   +F +E  P+IKHRK G +SMVNNG ++HGSQF IT   N+DYLDG+HTVFGE+++G+ ++  +N  +VD   IP +++RI HT+ILDDPF D   L  P+ SPEPT++QL S RIGA+E INDD G   EE  E+ K KEAK  A +L ++GD+PD DIKPPENVLFVC LNP+TT EDLE+IFS+FG I  CE+IRD+KTG SL YAFIEFE ++ CE AY+ M+ VLIDDRRIHVDFSQSVS
Sbjct:    1 MAVLLETTLGDIVIDLYTEERPKASLNFLKLCKIKYYNYCLIHNVQRDFIIQTGDPTGTGRGGESVFCKLYGDQARFFESEKMPRIKHRKKGTVSMVNNGSDQHGSQFLITTGENVDYLDGVHTVFGEVTEGMDVLAKINETFVDNDFIPFQDIRINHTVILDDPFDDPAGLPVPDRSPEPTKQQLDSGRIGADEAINDDEGKDPEELDELIKDKEAKTQAILLEMVGDLPDADIKPPENVLFVCKLNPVTTDEDLEIIFSRFGLIKCCEIIRDWKTGESLCYAFIEFEKEEDCEKAYFKMDNVLIDDRRIHVDFSQSVS 320          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppil4 (peptidylprolyl isomerase (cyclophilin)-like 4 [Source:ZFIN;Acc:ZDB-GENE-030131-6251])

HSP 1 Score: 396.741 bits (1018), Expect = 4.646e-134
Identity = 190/320 (59.38%), Postives = 244/320 (76.25%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGET--YFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVS 1002
            M+V+ ET++G+  IDLY +ERP+   NFLKLCK+KYYNY L H++Q   + Q GDPTGTG GG S++ ++ G+   +F +E  P+IKHRK G +SMVNNG ++HGSQF IT   N+DYLDG+HTVFGE+++G+ ++  +N  +VD   IP +++RI HT+ILDDPF D   L  P+ SPEPT++QL S RIGA+E INDD G   EE  E+ K KEAK  A +L ++GD+PD DIKPPENVLFVC LNP+TT EDLE+IFS+FG I  CE+IRD+KTG SL YAFIEFE ++ CE AY+ M+ VLIDDRRIHVDFSQSVS
Sbjct:    1 MAVLLETTLGDIVIDLYTEERPKASLNFLKLCKIKYYNYCLIHNVQRDFIIQTGDPTGTGRGGESVFCKLYGDQARFFESEKMPRIKHRKKGTVSMVNNGSDQHGSQFLITTGENVDYLDGVHTVFGEVTEGMDVLAKINETFVDNDFIPFQDIRINHTVILDDPFDDPAGLPVPDRSPEPTKQQLDSGRIGADEAINDDEGKDPEELDELIKDKEAKTQAILLEMVGDLPDADIKPPENVLFVCKLNPVTTDEDLEIIFSRFGLIKCCEIIRDWKTGESLCYAFIEFEKEEDCEKAYFKMDNVLIDDRRIHVDFSQSVS 320          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppil3 (peptidylprolyl isomerase (cyclophilin)-like 3 [Source:ZFIN;Acc:ZDB-GENE-040625-159])

HSP 1 Score: 125.176 bits (313), Expect = 1.876e-33
Identity = 65/165 (39.39%), Postives = 95/165 (57.58%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANI-PLREVRIYHTIILDDPF 540
            M+V   T +G+  I+L+ ++ P+ CENFL LC   +YN  +FH      + Q GDPTGTG GG SIW +      F +E    +KH   G+++M NNG N + SQFF T +    +LD  +TVFG+I DG+  +D +  + V++    PL +VRI    I  +PF
Sbjct:    1 MAVTLHTDLGDMKIELFCEKAPKSCENFLALCAGGFYNGCIFHRNIKGFIVQTGDPTGTGKGGTSIWGR-----KFEDEFSEHLKHNVRGVVAMANNGPNTNASQFFFTYAKQ-PHLDMKYTVFGKIIDGLETLDEIEKLPVNEKTFRPLNDVRIKDVTIHANPF 159          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppil1 (peptidylprolyl isomerase (cyclophilin)-like 1 [Source:ZFIN;Acc:ZDB-GENE-051009-1])

HSP 1 Score: 118.242 bits (295), Expect = 9.800e-31
Identity = 55/153 (35.95%), Postives = 93/153 (60.78%), Query Frame = 1
Query:   52 SVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRI 510
            +V  +T++G   ++LY    P+ C+NF +L +  YYN T FH I    + Q GDPTGTG GG SI+ +      F +E  P++K   +G+++M N G + +GSQFF++L+    +LDG HT+FG +  GI +++ +  V  +  + P+ +++I
Sbjct:   13 TVSLDTTMGTIVLELYWNHAPKTCKNFAELGRRGYYNSTKFHRIIKDFMVQGGDPTGTGRGGASIYGK-----QFEDEFHPELKFTGAGILAMANAGPDTNGSQFFLSLAPT-QWLDGKHTIFGRVCQGIGVLNRIGMVETNSQDRPVDDIKI 159          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppil1 (peptidylprolyl isomerase (cyclophilin)-like 1 [Source:ZFIN;Acc:ZDB-GENE-051009-1])

HSP 1 Score: 118.242 bits (295), Expect = 9.800e-31
Identity = 55/153 (35.95%), Postives = 93/153 (60.78%), Query Frame = 1
Query:   52 SVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRI 510
            +V  +T++G   ++LY    P+ C+NF +L +  YYN T FH I    + Q GDPTGTG GG SI+ +      F +E  P++K   +G+++M N G + +GSQFF++L+    +LDG HT+FG +  GI +++ +  V  +  + P+ +++I
Sbjct:   13 TVSLDTTMGTIVLELYWNHAPKTCKNFAELGRRGYYNSTKFHRIIKDFMVQGGDPTGTGRGGASIYGK-----QFEDEFHPELKFTGAGILAMANAGPDTNGSQFFLSLAPT-QWLDGKHTIFGRVCQGIGVLNRIGMVETNSQDRPVDDIKI 159          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: ankrd34b (ankyrin repeat domain 34B [Source:Xenbase;Acc:XB-GENE-985821])

HSP 1 Score: 409.068 bits (1050), Expect = 1.579e-138
Identity = 193/320 (60.31%), Postives = 247/320 (77.19%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGE--TYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVS 1002
            M+V+ ET++G+  IDLY +ERPR C NFLKLCK+KYYNY L HS+Q   + Q GDPTGTG GG S++ +I G+   +F +E  P+IKH+K G +SMVNNG ++HGSQF IT   NLDYLDG+HTVFGE+++G+++V  +N  +VDK  +P +++RI HT+ILDDPF D   L  P+ SP PT+ QL S RIGA+EDI DD G T EE +E+   K+AK  A +L ++GDIPD DI+PPENVLFVC LNP+TT EDLE+IFS+FG I SCE+IRD+KTG SL YAFIEFE ++ CE AY+ M+ VLIDDRRIHVDFSQSV+
Sbjct:    1 MAVLLETTLGDIVIDLYTEERPRACLNFLKLCKIKYYNYCLIHSVQKDFIIQTGDPTGTGRGGESLYCKIYGDQAKFFESEKVPRIKHKKFGTVSMVNNGNDQHGSQFLITTGENLDYLDGVHTVFGEVTEGMNVVKKINEAFVDKEFVPYQDIRINHTVILDDPFDDPSGLTIPDSSPGPTKEQLDSGRIGADEDICDDKGKTAEEVEEMIAEKDAKTQAVLLEMVGDIPDADIRPPENVLFVCKLNPVTTDEDLEIIFSRFGSIKSCEIIRDWKTGESLCYAFIEFEKEQDCEKAYFKMDNVLIDDRRIHVDFSQSVA 320          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: ankrd34b (ankyrin repeat domain 34B [Source:Xenbase;Acc:XB-GENE-985821])

HSP 1 Score: 404.06 bits (1037), Expect = 3.192e-137
Identity = 193/320 (60.31%), Postives = 247/320 (77.19%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGE--TYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVS 1002
            M+V+ ET++G+  IDLY +ERPR C NFLKLCK+KYYNY L HS+Q   + Q GDPTGTG GG S++ +I G+   +F +E  P+IKH+K G +SMVNNG ++HGSQF IT   NLDYLDG+HTVFGE+++G+++V  +N  +VDK  +P +++RI HT+ILDDPF D   L  P+ SP PT+ QL S RIGA+EDI DD G T EE +E+   K+AK  A +L ++GDIPD DI+PPENVLFVC LNP+TT EDLE+IFS+FG I SCE+IRD+KTG SL YAFIEFE ++ CE AY+ M+ VLIDDRRIHVDFSQSV+
Sbjct:    1 MAVLLETTLGDIVIDLYTEERPRACLNFLKLCKIKYYNYCLIHSVQKDFIIQTGDPTGTGRGGESLYCKIYGDQAKFFESEKVPRIKHKKFGTVSMVNNGNDQHGSQFLITTGENLDYLDGVHTVFGEVTEGMNVVKKINEAFVDKEFVPYQDIRINHTVILDDPFDDPSGLTIPDSSPGPTKEQLDSGRIGADEDICDDKGKTAEEVEEMIAEKDAKTQAVLLEMVGDIPDADIRPPENVLFVCKLNPVTTDEDLEIIFSRFGSIKSCEIIRDWKTGESLCYAFIEFEKEQDCEKAYFKMDNVLIDDRRIHVDFSQSVA 320          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: ankrd34b (ankyrin repeat domain 34B [Source:Xenbase;Acc:XB-GENE-985821])

HSP 1 Score: 361.303 bits (926), Expect = 8.485e-120
Identity = 179/320 (55.94%), Postives = 232/320 (72.50%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGE--TYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVS 1002
            M+V+ ET++G+  IDLY +ERPR       +    Y      HS     + Q GDPTGTG GG S++ +I G+   +F +E  P+IKH+K G +SMVNNG ++HGSQF IT   NLDYLDG+HTVFGE+++G+++V  +N  +VDK  +P +++RI HT+ILDDPF D   L  P+ SP PT+ QL S RIGA+EDI DD G T EE +E+   K+AK  A +L ++GDIPD DI+PPENVLFVC LNP+TT EDLE+IFS+FG I SCE+IRD+KTG SL YAFIEFE ++ CE AY+ M+ VLIDDRRIHVDFSQSV+
Sbjct:    1 MAVLLETTLGDIVIDLYTEERPRGAVINTSILFKVYSRCITDHS--KDFIIQTGDPTGTGRGGESLYCKIYGDQAKFFESEKVPRIKHKKFGTVSMVNNGNDQHGSQFLITTGENLDYLDGVHTVFGEVTEGMNVVKKINEAFVDKEFVPYQDIRINHTVILDDPFDDPSGLTIPDSSPGPTKEQLDSGRIGADEDICDDKGKTAEEVEEMIAEKDAKTQAVLLEMVGDIPDADIRPPENVLFVCKLNPVTTDEDLEIIFSRFGSIKSCEIIRDWKTGESLCYAFIEFEKEQDCEKAYFKMDNVLIDDRRIHVDFSQSVA 318          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: crkl (v-crk avian sarcoma virus CT10 oncogene homolog-like [Source:Xenbase;Acc:XB-GENE-976114])

HSP 1 Score: 127.487 bits (319), Expect = 4.870e-34
Identity = 71/165 (43.03%), Postives = 93/165 (56.36%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYV-DKANIPLREVRIYHTIILDDPF 540
            MSV   T +GE  I+L+ +  P+  ENFL LC   YY   LFH      + Q GDPTGTG GG SIW +      F +E    +KH   G++SM NNG N + SQFFIT      +LD  +TVFG++ DG+  +D L  + V +K+  PL EVRI    I  +PF
Sbjct:    1 MSVTLHTDLGEIKIELFCERAPKASENFLALCASNYYTGCLFHRNIKGFMVQTGDPTGTGKGGQSIWGR-----KFEDEYSEFLKHSVRGVVSMANNGPNTNASQFFITYGKQ-PHLDMKYTVFGKVIDGLDTLDELEKLPVHEKSFRPLTEVRIKDATIHANPF 159          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: crkl (v-crk avian sarcoma virus CT10 oncogene homolog-like [Source:Xenbase;Acc:XB-GENE-976114])

HSP 1 Score: 116.701 bits (291), Expect = 3.172e-30
Identity = 65/152 (42.76%), Postives = 86/152 (56.58%), Query Frame = 1
Query:   88 IDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYV-DKANIPLREVRIYHTIILDDPF 540
            I+L+ +  P+  ENFL LC   YY   LFH      + Q GDPTGTG GG SIW +      F +E    +KH   G++SM NNG N + SQFFIT      +LD  +TVFG++ DG+  +D L  + V +K+  PL EVRI    I  +PF
Sbjct:    7 IELFCERAPKASENFLALCASNYYTGCLFHRNIKGFMVQTGDPTGTGKGGQSIWGR-----KFEDEYSEFLKHSVRGVVSMANNGPNTNASQFFITYGKQ-PHLDMKYTVFGKVIDGLDTLDELEKLPVHEKSFRPLTEVRIKDATIHANPF 152          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppil4 (peptidylprolyl isomerase (cyclophilin)-like 4 [Source:MGI Symbol;Acc:MGI:1914668])

HSP 1 Score: 382.489 bits (981), Expect = 7.416e-128
Identity = 195/320 (60.94%), Postives = 250/320 (78.12%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGE--TYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVS 1002
            M+V+ ET++G+  IDLY +ERPR C NFLKLCK+KYYNY L H++Q   + Q GDPTGTG GG SI+ Q+ G+  ++F  E  P+IKH+K G +SMVNNG ++HGSQF IT   NLDYLDG+HTVFGE+++G+ IV  +N  +VDK  +P +++RI HT+ILDDPF D P L+ P+ SPEPT+ QL S RIGA+E+I+D  G + EE +EI+  KEAK  A +L ++GD+PD DIKPPENVLFVC LNP+TT EDLE+IFS+FG I SCEVIRD+KTG SL YAFIEFE ++ CE A++ M+ VLIDDRRIHVDFSQSV+
Sbjct:    1 MAVLLETTLGDVVIDLYTEERPRACLNFLKLCKIKYYNYCLIHNVQRDFIIQTGDPTGTGRGGESIFGQLYGDQASFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGENLDYLDGVHTVFGEVTEGMDIVKKINETFVDKDFVPYQDIRINHTVILDDPFDDPPDLLIPDRSPEPTKEQLDSGRIGADEEIDDFKGRSAEEVEEIKAEKEAKTQAILLEMVGDLPDADIKPPENVLFVCKLNPVTTDEDLEIIFSRFGPIRSCEVIRDWKTGESLCYAFIEFEKEEDCEKAFFKMDNVLIDDRRIHVDFSQSVA 320          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppil3 (peptidylprolyl isomerase (cyclophilin)-like 3 [Source:MGI Symbol;Acc:MGI:1917475])

HSP 1 Score: 127.872 bits (320), Expect = 2.607e-34
Identity = 70/165 (42.42%), Postives = 94/165 (56.97%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYV-DKANIPLREVRIYHTIILDDPF 540
            MSV   T VG+  I+++ +  P+ CENFL LC   YYN  +FH      + Q GDPTGTG GG SIW +      F +E    +KH   G++SM NNG N +GSQFFIT      +LD  +TVFG++ DG+  +D L  + V +K   PL +V I    I  +PF
Sbjct:    1 MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCVFHRNIKGFMVQTGDPTGTGRGGSSIWAK-----KFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQ-PHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPF 159          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppil3 (peptidylprolyl isomerase (cyclophilin)-like 3 [Source:MGI Symbol;Acc:MGI:1917475])

HSP 1 Score: 127.872 bits (320), Expect = 2.607e-34
Identity = 70/165 (42.42%), Postives = 94/165 (56.97%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYV-DKANIPLREVRIYHTIILDDPF 540
            MSV   T VG+  I+++ +  P+ CENFL LC   YYN  +FH      + Q GDPTGTG GG SIW +      F +E    +KH   G++SM NNG N +GSQFFIT      +LD  +TVFG++ DG+  +D L  + V +K   PL +V I    I  +PF
Sbjct:    1 MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCVFHRNIKGFMVQTGDPTGTGRGGSSIWAK-----KFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQ-PHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPF 159          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppil3 (peptidylprolyl isomerase (cyclophilin)-like 3 [Source:MGI Symbol;Acc:MGI:1917475])

HSP 1 Score: 127.872 bits (320), Expect = 2.607e-34
Identity = 70/165 (42.42%), Postives = 94/165 (56.97%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYV-DKANIPLREVRIYHTIILDDPF 540
            MSV   T VG+  I+++ +  P+ CENFL LC   YYN  +FH      + Q GDPTGTG GG SIW +      F +E    +KH   G++SM NNG N +GSQFFIT      +LD  +TVFG++ DG+  +D L  + V +K   PL +V I    I  +PF
Sbjct:    1 MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCVFHRNIKGFMVQTGDPTGTGRGGSSIWAK-----KFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQ-PHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPF 159          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppil1 (peptidylprolyl isomerase (cyclophilin)-like 1 [Source:MGI Symbol;Acc:MGI:1916066])

HSP 1 Score: 125.176 bits (313), Expect = 2.363e-33
Identity = 62/153 (40.52%), Postives = 94/153 (61.44%), Query Frame = 1
Query:   52 SVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRI 510
            +V  ETS+G   ++LY K  P+ C+NF +L +  YYN T FH I    + Q GDPTGTG GG SI+ +      F +EL P +K   +G+++M N G + +GSQFF+TL+    +LDG HT+FG +  GI +V+ +  V  +  + P+ +V+I
Sbjct:   13 NVYLETSMGVIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGK-----QFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPT-QWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKI 159          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|Q8WUA2|PPIL4_HUMAN (Peptidyl-prolyl cis-trans isomerase-like 4 OS=Homo sapiens OX=9606 GN=PPIL4 PE=1 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 1.895e-127
Identity = 194/320 (60.62%), Postives = 249/320 (77.81%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGE--TYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVS 1002
            M+V+ ET++G+  IDLY +ERPR C NFLKLCK+KYYNY L H++Q   + Q GDPTGTG GG SI+ Q+ G+  ++F  E  P+IKH+K G +SMVNNG ++HGSQF IT   NLDYLDG+HTVFGE+++G+ I+  +N  +VDK  +P +++RI HT+ILDDPF D P L+ P+ SPEPT  QL S RIGA+E+I+D  G + EE +EI+  KEAK  A +L ++GD+PD DIKPPENVLFVC LNP+TT EDLE+IFS+FG I SCEVIRD+KTG SL YAFIEFE ++ CE A++ M+ VLIDDRRIHVDFSQSV+
Sbjct:    1 MAVLLETTLGDVVIDLYTEERPRACLNFLKLCKIKYYNYCLIHNVQRDFIIQTGDPTGTGRGGESIFGQLYGDQASFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGENLDYLDGVHTVFGEVTEGMDIIKKINETFVDKDFVPYQDIRINHTVILDDPFDDPPDLLIPDRSPEPTREQLDSGRIGADEEIDDFKGRSAEEVEEIKAEKEAKTQAILLEMVGDLPDADIKPPENVLFVCKLNPVTTDEDLEIIFSRFGPIRSCEVIRDWKTGESLCYAFIEFEKEEDCEKAFFKMDNVLIDDRRIHVDFSQSVA 320          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|Q9CXG3|PPIL4_MOUSE (Peptidyl-prolyl cis-trans isomerase-like 4 OS=Mus musculus OX=10090 GN=Ppil4 PE=1 SV=2)

HSP 1 Score: 382.489 bits (981), Expect = 5.188e-127
Identity = 195/320 (60.94%), Postives = 250/320 (78.12%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGE--TYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVS 1002
            M+V+ ET++G+  IDLY +ERPR C NFLKLCK+KYYNY L H++Q   + Q GDPTGTG GG SI+ Q+ G+  ++F  E  P+IKH+K G +SMVNNG ++HGSQF IT   NLDYLDG+HTVFGE+++G+ IV  +N  +VDK  +P +++RI HT+ILDDPF D P L+ P+ SPEPT+ QL S RIGA+E+I+D  G + EE +EI+  KEAK  A +L ++GD+PD DIKPPENVLFVC LNP+TT EDLE+IFS+FG I SCEVIRD+KTG SL YAFIEFE ++ CE A++ M+ VLIDDRRIHVDFSQSV+
Sbjct:    1 MAVLLETTLGDVVIDLYTEERPRACLNFLKLCKIKYYNYCLIHNVQRDFIIQTGDPTGTGRGGESIFGQLYGDQASFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGENLDYLDGVHTVFGEVTEGMDIVKKINETFVDKDFVPYQDIRINHTVILDDPFDDPPDLLIPDRSPEPTKEQLDSGRIGADEEIDDFKGRSAEEVEEIKAEKEAKTQAILLEMVGDLPDADIKPPENVLFVCKLNPVTTDEDLEIIFSRFGPIRSCEVIRDWKTGESLCYAFIEFEKEEDCEKAFFKMDNVLIDDRRIHVDFSQSVA 320          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|G5EEW6|SIG7_CAEEL (Peptidyl-prolyl cis-trans isomerase sig-7 OS=Caenorhabditis elegans OX=6239 GN=sig-7 PE=1 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 3.299e-125
Identity = 180/334 (53.89%), Postives = 240/334 (71.86%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGET--YFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLI-SNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVSKQWKYYKDYQRQK 1041
            M+V+ ET++G+  IDL++KERPRC  NFLKLCK KYYN   FHSI+   VAQ GDPTGTG GG S++  + GE   YF  E  PK++H + G++S VNNG N  GSQFFITL  NLDYLD  HT+FG++++G+  ++ LN    D  N P +++RI HTI+LDDPF +   + FP  SP PT   L+ +++I  +E  ++D G T EE  E  + +E    AQIL ++GD+ D D  PPENVLFVC LNP+TT EDLE+IFS+FG+I +CE++RD ++G+SLQYAFIEF+N K CE A++ M+ VLIDDRRIHVDFSQSVS+ +KY    Q+Q+
Sbjct:    1 MAVLIETTLGDLIIDLFVKERPRCSLNFLKLCKKKYYNLNQFHSIERNYVAQTGDPTGTGKGGESVYSDMYGEQGRYFEREDLPKMRHTRMGIVSFVNNGDNMLGSQFFITLGENLDYLDDQHTIFGQVTEGLETLEKLNEQLADTNNRPFKDIRISHTIVLDDPFDEDARISFPPRSPSPTYEMLVKTDQIALDEKEDEDEGKTAEEIAEELQQREMAEQAQILEMVGDLKDADEVPPENVLFVCKLNPVTTDEDLEIIFSRFGKINNCEIVRDRRSGDSLQYAFIEFDNAKSCEQAFFKMDNVLIDDRRIHVDFSQSVSQNYKYKPKSQQQE 334          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|P0C1I6|PPIL4_RHIO9 (Peptidyl-prolyl cis-trans isomerase-like 4 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=cyp13 PE=3 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 2.896e-115
Identity = 179/345 (51.88%), Postives = 239/345 (69.28%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNK------HGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVSKQWKYYKDYQRQKKGNAGNQN 1065
            MSV+ ETS+G+  IDLY +E P+   NFLKLCK+KYYN+  F ++Q   +AQ GDPTG G  G S++  + G  YF  E+ P +KH + G++SM              GSQFFITL  NLDYLDG +T+FGEI++G  ++D +N  Y D+   P R++RI HT++LDDPFPD   LV P+ SP PT+ QL S RIG +ED+ +      EE ++  + +EAK +A  L +IGD+P  ++KPPENVLFVC LNP+T  EDLE+IFS+FG I SCE+IRD +TG+SL YAF+EFENK+  E AY+ M+ VLIDDRRIHVDFSQSVS   K +KD+  ++ G AG ++
Sbjct:    1 MSVLIETSLGDIVIDLYTEECPKTTLNFLKLCKIKYYNFAPFFNVQKDFMAQTGDPTGKGDQGQSVYGILGGSRYFPAEIHPTLKHVRRGMVSMAVAADASIETGGVSGSQFFITLGENLDYLDGKYTLFGEIAEGFDVLDKINEAYCDEQGRPFRDIRIKHTVVLDDPFPDPDGLVIPDESPLPTKEQLESMRIGEDEDLEEMG--DPEELEKRVRAREAKAHALTLEMIGDLPFAEVKPPENVLFVCKLNPVTRDEDLEMIFSRFGLIHSCEIIRDRQTGDSLSYAFVEFENKEDAEEAYFKMQSVLIDDRRIHVDFSQSVS---KLHKDWIAKRTG-AGKES 339          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|Q6Q151|CYP59_ARATH (Peptidyl-prolyl cis-trans isomerase CYP59 OS=Arabidopsis thaliana OX=3702 GN=CYP59 PE=1 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 2.324e-112
Identity = 176/353 (49.86%), Postives = 242/353 (68.56%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGET--YFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSL--VFPEISPEPTERQLISNRIGAEED-INDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVSKQWKYYKDYQRQK-KGNA----GNQNEIVK 1077
            MSV+  TS+G+  IDL+  + P  C+NFLKLCK+KYYN  LFH++Q    AQ GDPTGTG GG SI++ + GE   ++ +E+   +KH K+G ++M + G+N + SQF+ TL ++LDYLDG HTVFG+I++G   +  +N  YVD  N P + +RI HT ILDDPF D P L  + P+ SPE   ++ + + +  E+D +  D  L  +E +E+ + K A  +A +L  IGDIP+ ++KPP+NVLFVC LNP+T  EDL  IFS+FG ++S +VIRD+KTG+SL YAFIEFENK+ CE AY+ M+  LIDDRRIHVDFSQSVSK W  ++    QK KGN     G+ + I K
Sbjct:    1 MSVLIVTSLGDIVIDLHSDKCPLTCKNFLKLCKIKYYNGCLFHTVQKDFTAQTGDPTGTGAGGDSIYKFLYGEQARFYKDEIHLDLKHSKTGTVAMASGGENLNASQFYFTLRDDLDYLDGKHTVFGQIAEGFDTLTRINEAYVDPKNRPYKNIRIKHTHILDDPFDDPPQLAEMMPDASPEGKPKEEVKDDVRLEDDWVPMDEELGAQELEEVIREKAAHSSAVVLESIGDIPEAEVKPPDNVLFVCKLNPVTEDEDLHTIFSRFGTVVSADVIRDFKTGDSLCYAFIEFENKESCEQAYFKMDNALIDDRRIHVDFSQSVSKLWSQFRQKDSQKGKGNGCFKCGSTDHIAK 353          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A267EBU8 (Peptidyl-prolyl cis-trans isomerase (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014417g1 PE=3 SV=1)

HSP 1 Score: 449.129 bits (1154), Expect = 9.708e-150
Identity = 204/339 (60.18%), Postives = 267/339 (78.76%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLI-SNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVSKQWKYYKDYQRQKKGNAGNQ 1062
            MSV+ ETS+G+ T+DLY +ERPRCCENFLKLCK+KYYN+ LFHS+Q  LVAQ GDPTG+G+GG +++  + GE YF  EL+PK+KH + G +SMVN+G ++HGSQFFITL +++D LDG+HTVFG++++G  I+D LN VY D+ + P ++VRIYHTI+LDDPFPD P LV P+ SPEP+  QL  ++RIGAE+ I+D  GLT+EE  E  + +EA+ NA++L +IGD+PDED+KPP+NVLFVC LNP+TT +DL  IFS+FGEI SCEVIR  +TG SLQYAFIEF+    CE AY+ M+ VLIDDRRIHVDF QSV+K W   +D++R K   A  +
Sbjct:    3 MSVLIETSLGDITVDLYCRERPRCCENFLKLCKVKYYNWCLFHSVQRGLVAQTGDPTGSGSGGEAVYAMLGGEKYFDRELRPKMKHLRRGCVSMVNSGSDRHGSQFFITLGDSIDSLDGVHTVFGQVAEGFDILDKLNEVYCDRDHRPFQDVRIYHTIVLDDPFPDPPGLVIPDRSPEPSAEQLARTDRIGAEDAIDDTEGLTQEEAAEYHRQREAQSNARLLAMIGDLPDEDVKPPDNVLFVCKLNPVTTDDDLNTIFSRFGEIHSCEVIRSKRTGESLQYAFIEFDKADDCEAAYFKMDNVLIDDRRIHVDFCQSVAKVW---RDFRRDKATAAAGK 338          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A1I8J707 (Peptidyl-prolyl cis-trans isomerase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 447.588 bits (1150), Expect = 9.951e-150
Identity = 204/339 (60.18%), Postives = 267/339 (78.76%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLI-SNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVSKQWKYYKDYQRQKKGNAGNQ 1062
            MSV+ ETS+G+ T+DLY +ERPRCCENFLKLCK+KYYN+ LFHS+Q  LVAQ GDPTG+G+GG +++  + GE YF  EL+PK+KH + G +SMVN+G ++HGSQFFITL +++D LDG+HTVFG++++G  I+D LN VY D+ + P ++VRIYHTI+LDDPFPD P LV P+ SPEP+  QL  ++RIGAE+ I+D  GLT+EE  E  + +EA+ NA++L +IGD+PDED+KPP+NVLFVC LNP+TT +DL  IFS+FGEI SCEVIR  +TG SLQYAFIEF+    CE AY+ M+ VLIDDRRIHVDF QSV+K W   +D++R K   A  +
Sbjct:    1 MSVLIETSLGDITVDLYCRERPRCCENFLKLCKVKYYNWCLFHSVQRGLVAQTGDPTGSGSGGEAVYAMLGGEKYFDRELRPKMKHLRRGCVSMVNSGSDRHGSQFFITLGDSIDSLDGVHTVFGQVAEGFDILDKLNEVYCDRDHRPFQDVRIYHTIVLDDPFPDPPGLVIPDRSPEPSAEQLARTDRIGAEDAIDDTEGLTQEEAAEYHRQREAQSNARLLAMIGDLPDEDVKPPDNVLFVCKLNPVTTDDDLNTIFSRFGEIHSCEVIRSKRTGESLQYAFIEFDKADDCEAAYFKMDNVLIDDRRIHVDFCQSVAKVW---RDFRRDKATAAAGK 336          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A267H428 (Peptidyl-prolyl cis-trans isomerase (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017414g4 PE=3 SV=1)

HSP 1 Score: 446.432 bits (1147), Expect = 2.299e-149
Identity = 204/339 (60.18%), Postives = 267/339 (78.76%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLI-SNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVSKQWKYYKDYQRQKKGNAGNQ 1062
            MSV+ ETS+G+ T+DLY +ERPRCCENFLKLCK+KYYN+ LFHS+Q  LVAQ GDPTG+G+GG +++  + GE YF  EL+PK+KH + G +SMVN+G ++HGSQFFITL +++D LDG+HTVFG++++G  I+D LN VY D+ + P ++VRIYHTI+LDDPFPD P LV P+ SPEP+  QL  ++RIGAE+ I+D  GLT+EE  E  + +EA+ NA++L +IGD+PDED+KPP+NVLFVC LNP+TT +DL  IFS+FGEI SCEVIR  +TG SLQYAFIEF+    CE AY+ M+ VLIDDRRIHVDF QSV+K W   +D++R K   A  +
Sbjct:    3 MSVLIETSLGDITVDLYCRERPRCCENFLKLCKVKYYNWCLFHSVQRGLVAQTGDPTGSGSGGEAVYAMLGGEKYFDRELRPKMKHLRRGCVSMVNSGSDRHGSQFFITLGDSIDSLDGVHTVFGQVAEGFDILDKLNEVYCDRDHRPFQDVRIYHTIVLDDPFPDPPGLVIPDRSPEPSAEQLARTDRIGAEDAIDDTEGLTQEEAAEYHRQREAQSNARLLAMIGDLPDEDVKPPDNVLFVCKLNPVTTDDDLNTIFSRFGEIHSCEVIRSKRTGESLQYAFIEFDKADDCEAAYFKMDNVLIDDRRIHVDFCQSVAKVW---RDFRRDKATAAAGK 338          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A2T7P3J6 (Peptidyl-prolyl cis-trans isomerase OS=Pomacea canaliculata OX=400727 GN=C0Q70_10574 PE=3 SV=1)

HSP 1 Score: 439.884 bits (1130), Expect = 4.482e-147
Identity = 208/321 (64.80%), Postives = 262/321 (81.62%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGET--YFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVSK 1005
            MSVI ETS+G+ TIDLY +ERPRC ENFLKLCK+KYYN++LFHS+Q  LVAQ GDPT TG GG S++ +I GE   +F  E  P+IKH+K GL+SMVNNG   HGSQFFITL  +LDYLDG HTVFGE+++G  ++D LN+ Y D+ + P R++RIYHT+ILDDPF D   L+FP+ SPEPT+  L S+RIGA+E+I+D  G+TE+E +E+ + +EAK NAQ+L ++GDIP+ D+KPP+NVLFVC LNP+TT+EDLE+IFS+FG ILSCEVI+D KTG SLQYAFIEFE  + CENAY+ M+ VLIDDRRIHVDFSQSV+K
Sbjct:    1 MSVIIETSIGDLTIDLYTEERPRCSENFLKLCKLKYYNFSLFHSVQKNLVAQTGDPTATGRGGDSVYSKIYGEQARFFDMEQVPRIKHKKRGLLSMVNNGSGMHGSQFFITLGEDLDYLDGKHTVFGEVAEGFEVLDKLNDAYCDEHHRPYRDIRIYHTVILDDPFDDPRGLIFPDKSPEPTKEMLESDRIGADEEIDDTKGMTEQEIKEMVEEREAKANAQLLEMVGDIPEADVKPPDNVLFVCKLNPVTTAEDLEIIFSRFGSILSCEVIKDQKTGESLQYAFIEFEKPEDCENAYFKMDNVLIDDRRIHVDFSQSVAK 321          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A1S3HZ13 (Peptidyl-prolyl cis-trans isomerase OS=Lingula unguis OX=7574 GN=LOC106159153 PE=3 SV=1)

HSP 1 Score: 429.869 bits (1104), Expect = 5.538e-143
Identity = 204/325 (62.77%), Postives = 256/325 (78.77%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGET--YFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVSK-QWK 1014
            M+VI ETSVG+ TIDLY +ERPR C NFLKLCK+KYYN++LFHSIQ  LVAQ GDPTG+G GG +I++++ GE   +F  E+KP +KH+K G +SMVNNG + HGSQFFIT  +NLDYLDG+HTVFGE+S+G   +  +N  + D+ N P +++RI HTIILDDP+PD P L  PE SPEP+   L S RIG +E+I+D  G +  E +E+ K +EAK NAQIL ++GD+PD D+KP +NVLFVC LNP+TT EDLE+IFS+FG ILSCEVI+D KTGNSLQYAFIEFE    CENAY+ M+ VLIDDRRIHVDFSQSV+K +W+
Sbjct:    1 MAVILETSVGDLTIDLYTEERPRSCLNFLKLCKIKYYNFSLFHSIQRNLVAQTGDPTGSGRGGAAIFEKLYGEQARFFEREVKPILKHKKMGTVSMVNNGNDMHGSQFFITTGDNLDYLDGVHTVFGEVSEGFDTLSKINEAHCDQENRPFQDIRILHTIILDDPYPDPPGLEIPERSPEPSREMLDSGRIGFDEEIDDTKGKSMAEIEEMMKEREAKANAQILEMVGDLPDVDVKPEDNVLFVCKLNPVTTGEDLEIIFSRFGNILSCEVIKDQKTGNSLQYAFIEFEKASECENAYFKMDNVLIDDRRIHVDFSQSVAKIKWR 325          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppil4 (peptidylprolyl isomerase like 4 [Source:NCBI gene;Acc:103037319])

HSP 1 Score: 392.504 bits (1007), Expect = 4.161e-132
Identity = 188/320 (58.75%), Postives = 242/320 (75.62%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGET--YFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVS 1002
            M+V+ ET++G+  +DLY +ERP+   NFLKLCK+K+YNY L H++Q   + Q GDPTGTG GG S++ ++ G+   +F  E  P+IKHRK G +SMVNNG ++HGSQF IT   NLDYLDG+HTVFGE+S+G+ ++  +N  +VDK  IP +++RI HT+ILDDPF D P L  P+ SPEPT+ QL S RIGA+E I D  G  +EE  E+ K KEAK  A +L ++GD+PD D++PPENVLFVC LNP+TT EDLE+IFS+FG I  CE+IRD+KTG SL YAFIEFE  + CE AY+ M+ VLIDDRRIHVDFSQSVS
Sbjct:    1 MAVLLETTLGDIVVDLYTEERPKASLNFLKLCKIKFYNYCLIHNVQRDFIIQTGDPTGTGRGGESVFCKLYGDQARFFDAEKVPRIKHRKKGTVSMVNNGSDQHGSQFLITTGENLDYLDGVHTVFGEVSEGMDVLAKINEAFVDKDFIPFQDIRINHTVILDDPFDDPPGLPVPDRSPEPTKEQLDSGRIGADEAIVDGEGKDQEELDELIKDKEAKTQAILLEMVGDLPDADVRPPENVLFVCKLNPVTTDEDLEIIFSRFGTIECCEIIRDWKTGESLCYAFIEFEKVEDCEKAYFKMDNVLIDDRRIHVDFSQSVS 320          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppil4 (peptidylprolyl isomerase like 4 [Source:NCBI gene;Acc:103037319])

HSP 1 Score: 341.658 bits (875), Expect = 8.563e-115
Identity = 166/289 (57.44%), Postives = 217/289 (75.09%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGET--YFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFE 909
            M+V+ ET++G+  +DLY +ERP+   NFLKLCK+K+YNY L H++Q   + Q GDPTGTG GG S++ ++ G+   +F  E  P+IKHRK G +SMVNNG ++HGSQF IT   NLDYLDG+HTVFGE+S+G+ ++  +N  +VDK  IP +++RI HT+ILDDPF D P L  P+ SPEPT+ QL S RIGA+E I D  G  +EE  E+ K KEAK  A +L ++GD+PD D++PPENVLFVC LNP+TT EDLE+IFS+FG I  CE+IRD+KTG SL YAFIEFE
Sbjct:    1 MAVLLETTLGDIVVDLYTEERPKASLNFLKLCKIKFYNYCLIHNVQRDFIIQTGDPTGTGRGGESVFCKLYGDQARFFDAEKVPRIKHRKKGTVSMVNNGSDQHGSQFLITTGENLDYLDGVHTVFGEVSEGMDVLAKINEAFVDKDFIPFQDIRINHTVILDDPFDDPPGLPVPDRSPEPTKEQLDSGRIGADEAIVDGEGKDQEELDELIKDKEAKTQAILLEMVGDLPDADVRPPENVLFVCKLNPVTTDEDLEIIFSRFGTIECCEIIRDWKTGESLCYAFIEFE 289          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppil3 (peptidylprolyl isomerase (cyclophilin)-like 3 [Source:ZFIN;Acc:ZDB-GENE-040625-159])

HSP 1 Score: 124.405 bits (311), Expect = 4.674e-33
Identity = 66/171 (38.60%), Postives = 95/171 (55.56%), Query Frame = 1
Query:   31 IITFFLMSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANI-PLREVRIYHTIILDDPF 540
            + +  L +V   T +GE  I+L+ +  PR CENFL LC   +YN  +FH      + Q GDPTGTG GG SIW +      F +E    +KH   G+++M NNG N + SQF+ T +    +LD  +TVFG+I DG+  +D L  + V++    PL +V I    I  +PF
Sbjct:    1 MFSILLRAVTLHTDLGEIKIELFCERAPRSCENFLALCASGFYNGCIFHRNIKGFMVQTGDPTGTGKGGTSIWGR-----KFEDEFSEHLKHNVRGVVAMANNGPNTNASQFYFTYAKQ-PHLDMKYTVFGKIIDGLETLDELEKLPVNEKTFRPLNDVHIKDVTIHANPF 165          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppil1 (peptidylprolyl isomerase (cyclophilin)-like 1 [Source:ZFIN;Acc:ZDB-GENE-051009-1])

HSP 1 Score: 120.553 bits (301), Expect = 1.178e-31
Identity = 57/153 (37.25%), Postives = 93/153 (60.78%), Query Frame = 1
Query:   52 SVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRI 510
            +V  ET++G   ++LY +  P+ C+NF +L +  YYN T FH I    + Q GDPTGTG GG SI+ +      F +EL P++K   +G+++M N G + +GSQFF+TL     +LDG H++FG +  GI +++ +  V  +  + P  +++I
Sbjct:   23 TVSLETTMGTIVVELYWRHAPKTCKNFAELGRRGYYNNTKFHRIIKDFMVQGGDPTGTGRGGASIYGK-----QFEDELHPELKFTGAGILAMANAGPDTNGSQFFLTLGPT-QWLDGKHSIFGRVYQGIGVLNRIGMVETNSQDRPADDIKI 169          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppwd1 (peptidylprolyl isomerase domain and WD repeat containing 1 [Source:NCBI gene;Acc:103040581])

HSP 1 Score: 106.686 bits (265), Expect = 4.675e-24
Identity = 61/159 (38.36%), Postives = 88/159 (55.35%), Query Frame = 1
Query:   52 SVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVD-KANIPLREVRIYHTII 525
            S I  T++G+  I L+  E P+  ENF    +  YYN  +FH +    + Q GDPTGTG GG SIW    GE  F +E    ++H +   +SM N G   +GSQFF+T+     +LD  HTVFG  + G+ +V  ++NV V+ K + P  +V I +  I
Sbjct:  470 SAIIHTTMGDVHIKLFPVECPKTVENFCVHSRNGYYNGHVFHRVIKGFMIQTGDPTGTGMGGESIW---GGE--FEDEFHATLRHDRPYTLSMANAGAGTNGSQFFVTVVPT-PWLDNKHTVFGRTTKGMEVVQRISNVKVNPKTDKPYEDVSIINITI 622          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ppil1 (peptidylprolyl isomerase (cyclophilin)-like 1 [Source:ZFIN;Acc:ZDB-GENE-051009-1])

HSP 1 Score: 123.25 bits (308), Expect = 2.249e-33
Identity = 63/161 (39.13%), Postives = 93/161 (57.76%), Query Frame = 1
Query:   52 SVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGT-GTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILD 531
            ++  ET++G   ++LY    PR C NF +L +  YYN T FH I    + Q GDPTGT G GG SI+ +     +F +E+ P +KH  +G+ISM N+G N +GSQFFITL     +LDG H++F  ++ G+S V+ +  V     + P+ E+ I      D
Sbjct:   13 TITLETTMGTVVLELYWMHAPRTCRNFAELARRGYYNGTRFHRIIRGFMIQGGDPTGTAGRGGASIYGK-----HFEDEIHPDLKHTGAGIISMANSGPNTNGSQFFITLGPT-QWLDGKHSIFARVARGMSTVNRIGLVETVAQDRPVEEISIIRATCSD 167          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004654.1 (pep scaffold:Pmarinus_7.0:GL489343:42315:43690:-1 gene:ENSPMAG00000004243.1 transcript:ENSPMAT00000004654.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.3445 bits (207), Expect = 5.975e-19
Identity = 55/171 (32.16%), Postives = 84/171 (49.12%), Query Frame = 1
Query:   37 TFFLMSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKY---YNYTLFHSIQHQLVAQAGDPTG-TGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDP 537
            T FL     +  +G  +I+L+    PR  ENF  LC  ++   Y  +  H +    + Q GD T   GTGG SI+++   +  F      KI H ++G++SM N+G+N + SQFFITL     +LD  H  FG +  G+SIV ++  +     N   + V      +  DP
Sbjct:   57 TVFLDVAADDEPLGRISIELFANVVPRTAENFRALCTHEHGFGYRNSTIHRVIPGFMCQGGDFTNHNGTGGRSIYEKPFEDESF------KILHSRAGILSMANSGRNTNTSQFFITL-RATSHLDHKHVAFGAVRSGMSIVRAMEELGSQSGNTTKKIVVTDSGEVARDP 220          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ppifb (peptidylprolyl isomerase Fb [Source:ZFIN;Acc:ZDB-GENE-051030-126])

HSP 1 Score: 80.4925 bits (197), Expect = 4.587e-18
Identity = 50/146 (34.25%), Postives = 76/146 (52.05%), Query Frame = 1
Query:   73 VGEFTIDLYIKERPRCCENFLKLCKMKY---YNYTLFHSIQHQLVAQAGDPT-GTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLR 498
            +G  T+ L     P+  ENF  LC  ++   Y  ++FH I    + Q GD T   GTGG SI+     +  F+      +KH   G++SM N G+N +GSQFFI  +   ++LDG H VFG ++ G+ IV  +  +   K ++  R
Sbjct:   27 LGRITLKLRADVVPKTAENFRALCTGEHGFGYKGSIFHRIIPNFMCQGGDFTRNNGTGGVSIYGTTFRDENFI------LKHTGPGILSMANAGKNTNGSQFFI-CTELTNWLDGKHVVFGHVTSGMDIVKKMEKLGSSKGDVKGR 165          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ppig (peptidylprolyl isomerase G (cyclophilin G) [Source:ZFIN;Acc:ZDB-GENE-040426-2822])

HSP 1 Score: 84.7297 bits (208), Expect = 1.233e-17
Identity = 53/170 (31.18%), Postives = 79/170 (46.47%), Query Frame = 1
Query:   43 FLMSVIFETSVGEFTIDLYIKERPRCCENFLKLC-----------KMKYYNYTLFHSIQHQLVAQAGD-PTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYH 516
            F    I     G    +L+    P+ CENF  LC           K  ++  T FH I    + Q GD   G G GG SI+        F  +   ++KH +  L+SM N G++ +GSQFFIT +    +LDG H VFG +  G  ++  + N   D  ++P  ++R+ H
Sbjct:   10 FFDIAINRIPAGRIVFELFFDVCPKTCENFRCLCTGERGIGKITRKPLHFRSTSFHRIVKNFMVQGGDFSEGNGRGGESIY------GGFFEDENFQLKHDQEFLLSMANRGKDTNGSQFFIT-TKPAPHLDGEHVVFGRVLSGQDLLKEIENQKTDANSLPYADIRVVH 172          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006086.1 (pep scaffold:Pmarinus_7.0:GL479902:31682:44317:-1 gene:ENSPMAG00000005502.1 transcript:ENSPMAT00000006086.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 7.536e-16
Identity = 38/112 (33.93%), Postives = 65/112 (58.04%), Query Frame = 1
Query:  229 TGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVD-KANIPLREVRIYHTIILDDPFPDHPSLV 561
            TGG S W +      F +E KP + H+  G++SM N+G N +GSQFFIT   +  +LD  H VFG +  G+ ++ ++  +  + K + P +E++I    +L +PF +  +L+
Sbjct:    1 TGGESAWGK-----PFKDEFKPNLCHQGRGVLSMANSGPNSNGSQFFITF-RSCTHLDRKHAVFGRLIGGLEVLQAIEKIDANPKTDRPEKEIKIEKMTVLVNPFEEGDALL 106          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR2 (Peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; potential role in the secretory pathway; seamless-GFP and mCherry fusion proteins localize to the vacuole, while SWAT-GFP fusion localizes to both the endoplasmic reticulum and vacuole; suppresses toxicity of slow-folding human Z-type alpha1-antitrypsin variant associated with liver cirrhosis and emphysema [Source:SGD;Acc:S000001099])

HSP 1 Score: 95.5153 bits (236), Expect = 3.187e-23
Identity = 58/154 (37.66%), Postives = 85/154 (55.19%), Query Frame = 1
Query:   64 ETSVGEFTIDLYIKERPRCCENFLKLCKM----KYYNYTLFHSIQHQLVAQAGDPT-GTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRI 510
            E  VG   I LY K  P+  +NF KL       K +  + FH +    + Q GD T GTG GG SI+    G+T+   +    +KH + G +SM N G++ +GSQFFIT +    +LDG H VFG++ DG+ +V+ + +V  D  + PL  V+I
Sbjct:   46 EEKVGRIVIGLYGKVCPKTAKNFYKLSTTTNSKKGFIGSTFHRVIPNFMVQGGDFTDGTGVGGKSIY----GDTF--PDENFTLKHDRKGRLSMANRGKDTNGSQFFITTTEEASWLDGKHVVFGQVVDGMDVVNYIQHVSRDANDKPLEAVKI 193          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR5 (Peptidyl-prolyl cis-trans isomerase (cyclophilin) of the ER; catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; transcriptionally induced in response to unfolded proteins in the ER; CPR5 has a paralog, CPR2, that arose from the whole genome duplication [Source:SGD;Acc:S000002712])

HSP 1 Score: 93.9745 bits (232), Expect = 2.147e-22
Identity = 59/152 (38.82%), Postives = 83/152 (54.61%), Query Frame = 1
Query:   73 VGEFTIDLYIKERPRCCENFLKLC-----KMKYYNYTLFHSIQHQLVAQAGDPT-GTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRI 510
            +G   + LY    P+  ENF +L      KM Y N ++FH +    + Q GD T  +G GG SI+     +  F       +KH K G +SM N G+N +GSQFFIT +    +LDG H VFGE+ DG+ +V  + NV  D  N+P++EV I
Sbjct:   47 IGRIVMGLYGLTTPQTVENFYQLTISRDPKMGYLN-SIFHRVIPNFMIQGGDFTHRSGIGGKSIFGNTFKDENF------DVKHDKPGRLSMANRGKNTNGSQFFIT-TVPCPWLDGKHVVFGEVLDGMDVVHYIENVKTDSRNMPVKEVII 190          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR3 (Mitochondrial peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; involved in protein refolding after import into mitochondria [Source:SGD;Acc:S000004543])

HSP 1 Score: 82.8037 bits (203), Expect = 5.818e-19
Identity = 58/160 (36.25%), Postives = 79/160 (49.38%), Query Frame = 1
Query:   43 FLMSVIFETSVGEFTIDLYIKERPRCCENFLKLC---KMKYYNYTLFHSIQHQLVAQAGDPTGT-GTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRI 510
            F    +  T +G    +LY    P+  ENF  LC   K   Y    FH I    + Q GD   T G GG SI+     +  F+       KH K+GL+SM N G N +GSQFFIT +    +LDG H VFGE++ G+ IV ++ + Y   +  P  E+ I
Sbjct:   25 FFDPAVNGTKIGRIEFELYDNVVPKTAENFRALCTGEKGWGYKGVPFHRIIPDFMIQGGDTDLTNGFGGKSIYGSKFADENFVK------KHDKAGLLSMANAGPNTNGSQFFIT-TVPCPWLDGKHVVFGEVTKGMDIVKAIES-YGTASGKPRAEIVI 176          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR6 (Peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; plays a role in determining prion variants; binds to Hsp82p and contributes to chaperone activity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004206])

HSP 1 Score: 85.8853 bits (211), Expect = 9.506e-19
Identity = 65/182 (35.71%), Postives = 89/182 (48.90%), Query Frame = 1
Query:   37 TFFLMSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKY------------YNYTLFHSIQHQLVAQAGDPTG-TGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKA-NIPLREVRIYHTIILDDPF 540
            TFF +S+  +   G    +LY    P+  ENFLKLC+               Y  ++FH +    + Q GD T   GTGG SI+ +   +  F       +KH K  L+SM N G N +GSQ FIT      +LDG H VFGE+  G  IV  + N   D+  N PLR+V+I    +L D +
Sbjct:    6 TFFDISIGGKPQ-GRIVFELYNDIVPKTAENFLKLCEGNAGMAKTKPDVPLSYKGSIFHRVIKDFMCQFGDFTNFNGTGGESIYDEKFEDENFT------VKHDKPFLLSMANAGPNTNGSQAFITCVPT-PHLDGKHVVFGEVIQGKRIVRLIENQQCDQENNKPLRDVKIDDCGVLPDDY 179          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR1 (Cytoplasmic peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; binds the drug cyclosporin A; N-terminally propionylated in vivo; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000002562])

HSP 1 Score: 77.411 bits (189), Expect = 2.466e-17
Identity = 53/136 (38.97%), Postives = 69/136 (50.74%), Query Frame = 1
Query:   73 VGEFTIDLYIKERPRCCENFLKLC---KMKYYNYTLFHSIQHQLVAQAGDPT-GTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNV 468
            +G     LY    P+  ENF  LC   K   Y  + FH +    + Q GD T G GTGG SI+     +  F      K  H + GL+SM N G N +GSQFFIT +    +LDG H VFGE+ DG  IV  + ++
Sbjct:   15 IGRVVFKLYNDIVPKTAENFRALCTGEKGFGYAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENF------KKHHDRPGLLSMANAGPNTNGSQFFIT-TVPCPWLDGKHVVFGEVVDGYDIVKKVESL 143          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO44008 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWQ2])

HSP 1 Score: 398.282 bits (1022), Expect = 5.158e-137
Identity = 193/321 (60.12%), Postives = 242/321 (75.39%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGE--TYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVSK 1005
            MSVI ET+VG+  +DL+  ERPR C NFLKLCK+K+YNY LFHS+Q    AQ GDP GTG GG S+++ + G+   +F  E KP++KH+  G +SMVNNG N HGSQFFITL++ LDYLDG HTVFGE+S+G  ++D +N         P +++RI HT+ILDDPF D   L  P+ SPEPT+ QL S  IGA+E++++  G T EE +++ + +E K  AQ+L +IGDIPD DIKPP+NVLFVC LNP+TT EDLE+IFS+FG ILSCEVIRD KTG SLQYAFIEFE  + CE AY+ M+ VLIDDRRIHVDFSQSVSK
Sbjct:    1 MSVILETTVGDIVVDLFTDERPRACLNFLKLCKIKFYNYCLFHSVQRNFTAQTGDPQGTGKGGESVFRVLYGDQAKFFNAEAKPQLKHKNKGTVSMVNNGDNMHGSQFFITLADGLDYLDGEHTVFGEVSEGFDVLDKINEAICTDEFRPYQDIRITHTVILDDPFDDPEGLPIPDRSPEPTKEQLESGLIGADEEVDETKGKTMEEIEDMIEEREEKAGAQLLEMIGDIPDADIKPPDNVLFVCKLNPVTTDEDLEIIFSRFGTILSCEVIRDQKTGESLQYAFIEFEKDEDCERAYFKMDNVLIDDRRIHVDFSQSVSK 321          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO38908 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7SBP4])

HSP 1 Score: 133.265 bits (334), Expect = 8.583e-37
Identity = 68/170 (40.00%), Postives = 99/170 (58.24%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANI-PLREVRIYHTIILDDPFPDHPS 555
            MSV  +T +G+  I+L+ ++ PR CENFL LC   YY+  +FH      + Q GDPTG+G GG SIW +      F +EL P ++H   G +SM NNG N +GSQFFI       +LD  +T+FG++  G+  +D L  + V++ N  PL EVRI    I  +P  ++ +
Sbjct:    1 MSVTLQTDIGDLKIELFCEDTPRTCENFLALCASHYYDNCVFHRNIKGFMVQTGDPTGSGKGGKSIWGK-----KFEDELSPSLRHNARGTVSMANNGPNSNGSQFFICYGKQ-PHLDMKYTMFGKVIGGLETLDDLEKLPVNEKNYRPLTEVRIKSVTIHANPIAENAA 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO35998 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7SJU0])

HSP 1 Score: 124.02 bits (310), Expect = 1.511e-33
Identity = 63/155 (40.65%), Postives = 96/155 (61.94%), Query Frame = 1
Query:   55 VIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHT 519
            V  ETS+G F ++LY +  P+ C NF +L +  Y+N   FH +    + Q GDPTGTG GG SI+    G T F +E+  ++KH  +G++SM N+G N +GSQFF+TL+    +LDG HT+FG I+ G+ +V  +  V  +  + PL +V I ++
Sbjct:   11 VFIETSMGSFEVELYWRHAPKTCRNFTELAQRGYFNNCKFHRVIRDFMIQTGDPTGTGRGGASIY----GPT-FEDEVTRELKHTGAGILSMANSGPNTNGSQFFVTLAPT-QWLDGKHTIFGRINKGLEVVKRIGLVETNADDRPLHDVYIVNS 159          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO30357 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T112])

HSP 1 Score: 127.102 bits (318), Expect = 5.955e-33
Identity = 61/164 (37.20%), Postives = 96/164 (58.54%), Query Frame = 1
Query:   55 VIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPD 546
            V  +T+ G+  ++L+ +  P+ CENF+KLC   YY  T+FH      + Q GDPTGTG GG S W    GE  F +E KP + H+  G++SM N+G N + SQFFIT   +  +LD  H+VFG +  G+  ++++  +  D+ + P   ++I   ++  DPF +
Sbjct:  154 VRIQTTHGDLNLELHCEMVPKACENFMKLCAKGYYENTVFHRSIKNFMIQGGDPTGTGRGGESAW---GGE--FKDEFKPNLIHQGRGILSMANSGPNTNKSQFFITY-RSCRHLDQKHSVFGRVVGGLETLNAMERIECDEKDRPKETIKIKKAVVFVDPFAE 311          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO46195 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQN6])

HSP 1 Score: 126.716 bits (317), Expect = 1.143e-31
Identity = 66/166 (39.76%), Postives = 103/166 (62.05%), Query Frame = 1
Query:   55 VIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVD--SLNNVYVDKANIPLREVRIYHTIILDDPFPD 546
            V+  TSVG+  I+L+ KE P+ C NF++LC   YY+ T+FH I      Q GDPTGTG GG +I+    G++ F +E   ++K  + GL++M N+G N + SQFF TL +  D L+G HT+FG+++ G +I +   + ++ VD  + PL   ++  T +L +PF D
Sbjct:   15 VLLVTSVGDIDIELWGKETPKACRNFIQLCLEGYYDNTIFHRIVKGFCIQGGDPTGTGLGGENIY----GQSGFKDEFHQRLKFNRRGLVAMANSGPNDNRSQFFFTL-DRADELNGKHTIFGKVT-GNTIYNMIKMADMEVDDNDHPLYPPKVIRTEVLSNPFDD 174          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ppil4 (peptidylprolyl isomerase like 4 [Source:NCBI gene;Acc:101168759])

HSP 1 Score: 381.333 bits (978), Expect = 1.026e-127
Identity = 189/320 (59.06%), Postives = 249/320 (77.81%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGET--YFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVS 1002
            M+V+ ET++G+  IDL+ +ERP+ C NFLKLCK+KYYNY LFH++Q   +AQ GDPTGTG GG SI+ ++ G+   +F  E  P+IKH+K G +SMVNNG ++HGSQF +T   NLDYLDG+HTVFGE+++G+ I+  +N  +VDK  +P +++RI HT+IL+DPF D P L  P+ SPEPT+ QL S RIGA+E+I D  G + EE +E  K KEAK  A +L ++GD+PD D+KPPENVLFVC LNP+TT EDLE+IFS+FG I SCE+IRD+K+G+SL YAFIEFE ++ CE AY+ M+ VLIDDRRIHVDFSQSV+
Sbjct:   18 MAVLLETTLGDIVIDLFTEERPKACLNFLKLCKIKYYNYCLFHNVQRDFIAQTGDPTGTGRGGESIYSKLYGDQARFFDAEKVPRIKHKKKGTVSMVNNGNDQHGSQFLMTTGENLDYLDGVHTVFGEVTEGMDILKKINETFVDKDFVPFQDIRINHTVILEDPFDDPPDLPVPDRSPEPTKEQLDSGRIGADEEIVDTDGRSAEELEERLKEKEAKTQAILLEMVGDLPDADMKPPENVLFVCKLNPVTTDEDLEIIFSRFGSIKSCEIIRDWKSGDSLCYAFIEFEKQEDCEKAYFKMDNVLIDDRRIHVDFSQSVA 337          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ppil4 (peptidylprolyl isomerase like 4 [Source:NCBI gene;Acc:101168759])

HSP 1 Score: 337.806 bits (865), Expect = 1.123e-111
Identity = 177/320 (55.31%), Postives = 235/320 (73.44%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGET--YFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVS 1002
            M+V+ ET++G+  IDL+ +ERP+ C NFLKLCK+KYYNY LFH++Q                  S+   + G+   +F  E  P+IKH+K G +SMVNNG ++HGSQF +T   NLDYLDG+HTVFGE+++G+ I+  +N  +VDK  +P +++RI HT+IL+DPF D P L  P+ SPEPT+ QL S RIGA+E+I D  G + EE +E  K KEAK  A +L ++GD+PD D+KPPENVLFVC LNP+TT EDLE+IFS+FG I SCE+IRD+K+G+SL YAFIEFE ++ CE AY+ M+ VLIDDRRIHVDFSQSV+
Sbjct:    1 MAVLLETTLGDIVIDLFTEERPKACLNFLKLCKIKYYNYCLFHNVQV-----------------SVRDCLYGDQARFFDAEKVPRIKHKKKGTVSMVNNGNDQHGSQFLMTTGENLDYLDGVHTVFGEVTEGMDILKKINETFVDKDFVPFQDIRINHTVILEDPFDDPPDLPVPDRSPEPTKEQLDSGRIGADEEIVDTDGRSAEELEERLKEKEAKTQAILLEMVGDLPDADMKPPENVLFVCKLNPVTTDEDLEIIFSRFGSIKSCEIIRDWKSGDSLCYAFIEFEKQEDCEKAYFKMDNVLIDDRRIHVDFSQSVA 303          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ENSORLT00000000980.2 (peptidylprolyl isomerase like 3 [Source:NCBI gene;Acc:101162216])

HSP 1 Score: 126.331 bits (316), Expect = 7.742e-34
Identity = 65/165 (39.39%), Postives = 95/165 (57.58%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANI-PLREVRIYHTIILDDPF 540
            M+V F T +G+  I+L+ +  P+ CENFL LC   +YN  +FH      + Q GDPTGTG GG SIW +      F +E    +KH   G++SM N+G N +GSQFF T +    +LD  +T+FG+I DG+  +D L  + V++    P+ + RI    I  +PF
Sbjct:    1 MAVTFHTDLGDLKIELFCERTPKACENFLALCASGFYNGCVFHRNIKGFMVQTGDPTGTGKGGTSIWGR-----KFEDEFSEHLKHNVRGVVSMANSGPNTNGSQFFFTYAKQ-PHLDMKYTIFGKIIDGLETLDELEKLPVNEKTFRPITDTRIKDVTIHANPF 159          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ppil1 (peptidylprolyl isomerase like 1 [Source:NCBI gene;Acc:101159184])

HSP 1 Score: 125.176 bits (313), Expect = 1.980e-33
Identity = 59/158 (37.34%), Postives = 94/158 (59.49%), Query Frame = 1
Query:   52 SVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTII 525
            +V  ET++G   ++LY    P  C+NF +L +  YYN T FH I    + Q GDPTGTG GG SI+ +      F +EL P++K   +G+++M N G + +GSQFF+TL+    +LDG H++FG +  G+ +++ +  V  D  + P  ++RI  T +
Sbjct:   13 TVALETTMGTLVVELYWNHAPNTCKNFAELARRGYYNDTRFHRIIKDFMVQGGDPTGTGRGGASIFGK-----QFEDELHPELKFTGAGILAMANAGPDTNGSQFFLTLAPT-QWLDGKHSIFGRVCQGMGVLNRIGMVETDSQDRPTDDIRILRTTL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ENSORLT00000044034.1 (peptidylprolyl isomerase like 3 [Source:NCBI gene;Acc:101162216])

HSP 1 Score: 117.472 bits (293), Expect = 9.560e-31
Identity = 61/158 (38.61%), Postives = 91/158 (57.59%), Query Frame = 1
Query:   70 SVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANI-PLREVRIYHTIILDDPF 540
            ++G+  I+L+ +  P+ CENFL LC   +YN  +FH      + Q GDPTGTG GG SIW +      F +E    +KH   G++SM N+G N +GSQFF T +    +LD  +T+FG+I DG+  +D L  + V++    P+ + RI    I  +PF
Sbjct:    5 NLGDLKIELFCERTPKACENFLALCASGFYNGCVFHRNIKGFMVQTGDPTGTGKGGTSIWGR-----KFEDEFSEHLKHNVRGVVSMANSGPNTNGSQFFFTYAKQ-PHLDMKYTIFGKIIDGLETLDELEKLPVNEKTFRPITDTRIKDVTIHANPF 156          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000023600.1 (SMESG000023600.1)

HSP 1 Score: 759.214 bits (1959), Expect = 0.000e+0
Identity = 443/444 (99.77%), Postives = 443/444 (99.77%), Query Frame = 1
Query:   49 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSGLTXXXXXXXXXXXXXXINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVSKQWKYYKDYQRQKKGNAGNQNEIVKVDEKIKKHRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXVKSRSNDRNDSRATNRKQSEYNKRKDYSETDLDM 1380
            MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSGLTEEEKQEIEKMKEAKINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVSKQWKYYKDYQRQKKGNAGNQNEIVKVDEKIKKHRNSREKDKSRSVERKERRNRSNEKKPNERNRERSRSINRQDKSRERNRKSRSRDRNPKRVKSRSNDRNDSRATNRKQSEYNKRKDYSETDL M
Sbjct:    1 MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSGLTEEEKQEIEKMKEAKINAQILTVIGDIPDEDIKPPENVLFVCSLNPITTSEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHMERVLIDDRRIHVDFSQSVSKQWKYYKDYQRQKKGNAGNQNEIVKVDEKIKKHRNSREKDKSRSVERKERRNRSNEKKPNERNRERSRSINRQDKSRERNRKSRSRDRNPKRVKSRSNDRNDSRATNRKQSEYNKRKDYSETDLGM 444          

HSP 2 Score: 51.2174 bits (121), Expect = 1.419e-6
Identity = 23/24 (95.83%), Postives = 23/24 (95.83%), Query Frame = 2
Query: 1415 AGQIERKENGLNLTSETKDKHFCK 1486
             GQIERKENGLNLTSETKDKHFCK
Sbjct:  456 GGQIERKENGLNLTSETKDKHFCK 479          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000072690.1 (SMESG000072690.1)

HSP 1 Score: 125.946 bits (315), Expect = 8.129e-34
Identity = 62/152 (40.79%), Postives = 88/152 (57.89%), Query Frame = 1
Query:   55 VIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRI 510
            +   T++G   ++LY    P  C NF +L K  YYN T+FH I    + Q GDPTG G GG SI+       YF +E  P++KH  +G++SM N+G N +GSQF+ITL     +LD  HT+FG I+ G+ +V  +  V  D    PL ++RI
Sbjct:   16 ITLNTTLGVIVVELYWNHAPNTCNNFYQLAKRGYYNNTIFHRIVRNFMIQGGDPTGVGNGGASIYGH-----YFEDEFHPELKHTGAGILSMANSGPNTNGSQFYITLIPT-PWLDNCHTIFGRIASGMIVVKQMGLVETDPNEKPLHDIRI 161          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000019956.1 (SMESG000019956.1)

HSP 1 Score: 129.798 bits (325), Expect = 4.074e-32
Identity = 65/162 (40.12%), Postives = 90/162 (55.56%), Query Frame = 1
Query:   55 VIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLREVRIYHTIILDDPF 540
            V   T+ G    +LY +  P+ CENF+KLC  KYYN T+FH +    V Q GDPTG G GG SIW +      F +E  PK  H   G++SM N+G NK+ SQFFI L      LD  H++FG +  G+ ++D +  +  D  + P+  + I  T +  DPF
Sbjct:  273 VTLITNFGRINFELYCELVPKTCENFIKLCLSKYYNNTVFHRLIRHFVLQGGDPTGKGNGGQSIWGKP-----FADEFLPKHSHDSRGVLSMANSGPNKNTSQFFILL-RPAKQLDKKHSIFGRVVGGMKVLDEIEKIESDNKDRPIEPIEILCTEVFVDPF 428          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000036294.1 (SMESG000036294.1)

HSP 1 Score: 105.916 bits (263), Expect = 1.062e-26
Identity = 58/152 (38.16%), Postives = 81/152 (53.29%), Query Frame = 1
Query:   94 LYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYV-DKANIPLREVRIYHTIILDDPFPD 546
            ++  E P   ENFL LC   YY+  +FH      + Q GDPTGTG GG SIW++      F +E    +KH   G++SM N+G N + SQFFIT       LD   TVFG++ DG  ++D    + V +K   PL  V+I    +  +PF +
Sbjct:    1 MFCTEVPLATENFLALCASGYYDNCIFHRNVKGFIIQTGDPTGTGKGGQSIWKKP-----FKDEFHEDLKHNTRGIVSMANSGPNINSSQFFITYCKQ-SMLDMKFTVFGKVIDGFEVLDEFEKLPVEEKTYRPLTNVKIKSVTMHANPFAE 146          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000022142.1 (SMESG000022142.1)

HSP 1 Score: 104.76 bits (260), Expect = 3.941e-24
Identity = 61/167 (36.53%), Postives = 92/167 (55.09%), Query Frame = 1
Query:   55 VIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLVAQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQNKHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLN--NVYVDK-ANIPLREVRIYHTIILDDPFPD 546
            VI  T+ GE  I+L+ KE P  C NF++LC   YY+ T+FH +  + + Q GDP+GTG GG SI+    GE + + E+  +++  + GL++M  +     GSQFF TL    + L G HT+ G +  G +I + +N     +DK    PL    I    I+ +PF D
Sbjct:   15 VILNTTCGEIEIELWAKETPMACRNFIQLCMEGYYDNTIFHRVVKKFIIQGGDPSGTGDGGDSIY----GEPFKM-EIHSRLRFNRRGLVAMSCSNNRVDGSQFFFTLKETPE-LQGNHTIIGTVV-GKTIYNMVNLGEGLIDKQTERPLYPKEILSVTIISNPFDD 174          
The following BLAST results are available for this feature:
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPIL43.947e-12860.63peptidylprolyl isomerase like 4 [Source:HGNC Symbo... [more]
PPIL33.572e-3442.42peptidylprolyl isomerase like 3 [Source:HGNC Symbo... [more]
PPIL34.359e-3342.07peptidylprolyl isomerase like 3 [Source:HGNC Symbo... [more]
PPIL14.576e-3340.52peptidylprolyl isomerase like 1 [Source:HGNC Symbo... [more]
CWC274.508e-2836.36CWC27 spliceosome associated cyclophilin [Source:H... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sig-72.593e-12653.89Peptidyl-prolyl cis-trans isomerase sig-7 [Source... [more]
sig-72.593e-12653.89Peptidyl-prolyl cis-trans isomerase sig-7 [Source... [more]
sig-72.644e-9052.71Peptidyl-prolyl cis-trans isomerase sig-7 [Source... [more]
cyn-123.216e-3642.11Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
cyn-101.201e-3137.80Peptidyl-prolyl cis-trans isomerase 10 [Source:Un... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG58089.865e-12554.77gene:FBgn0027617 transcript:FBtr0084738[more]
Cypl1.527e-3542.76gene:FBgn0035141 transcript:FBtr0072564[more]
CG77479.002e-3434.97gene:FBgn0034109 transcript:FBtr0087179[more]
CG117773.131e-2941.78gene:FBgn0033527 transcript:FBtr0088273[more]
CG109072.911e-2835.05gene:FBgn0036207 transcript:FBtr0076029[more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppil44.646e-13459.38peptidylprolyl isomerase (cyclophilin)-like 4 [Sou... [more]
ppil44.646e-13459.38peptidylprolyl isomerase (cyclophilin)-like 4 [Sou... [more]
ppil31.876e-3339.39peptidylprolyl isomerase (cyclophilin)-like 3 [Sou... [more]
ppil19.800e-3135.95peptidylprolyl isomerase (cyclophilin)-like 1 [Sou... [more]
ppil19.800e-3135.95peptidylprolyl isomerase (cyclophilin)-like 1 [Sou... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankrd34b1.579e-13860.31ankyrin repeat domain 34B [Source:Xenbase;Acc:XB-G... [more]
ankrd34b3.192e-13760.31ankyrin repeat domain 34B [Source:Xenbase;Acc:XB-G... [more]
ankrd34b8.485e-12055.94ankyrin repeat domain 34B [Source:Xenbase;Acc:XB-G... [more]
crkl4.870e-3443.03v-crk avian sarcoma virus CT10 oncogene homolog-li... [more]
crkl3.172e-3042.76v-crk avian sarcoma virus CT10 oncogene homolog-li... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppil47.416e-12860.94peptidylprolyl isomerase (cyclophilin)-like 4 [Sou... [more]
Ppil32.607e-3442.42peptidylprolyl isomerase (cyclophilin)-like 3 [Sou... [more]
Ppil32.607e-3442.42peptidylprolyl isomerase (cyclophilin)-like 3 [Sou... [more]
Ppil32.607e-3442.42peptidylprolyl isomerase (cyclophilin)-like 3 [Sou... [more]
Ppil12.363e-3340.52peptidylprolyl isomerase (cyclophilin)-like 1 [Sou... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8WUA2|PPIL4_HUMAN1.895e-12760.63Peptidyl-prolyl cis-trans isomerase-like 4 OS=Homo... [more]
sp|Q9CXG3|PPIL4_MOUSE5.188e-12760.94Peptidyl-prolyl cis-trans isomerase-like 4 OS=Mus ... [more]
sp|G5EEW6|SIG7_CAEEL3.299e-12553.89Peptidyl-prolyl cis-trans isomerase sig-7 OS=Caeno... [more]
sp|P0C1I6|PPIL4_RHIO92.896e-11551.88Peptidyl-prolyl cis-trans isomerase-like 4 OS=Rhiz... [more]
sp|Q6Q151|CYP59_ARATH2.324e-11249.86Peptidyl-prolyl cis-trans isomerase CYP59 OS=Arabi... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EBU89.708e-15060.18Peptidyl-prolyl cis-trans isomerase (Fragment) OS=... [more]
A0A1I8J7079.951e-15060.18Peptidyl-prolyl cis-trans isomerase OS=Macrostomum... [more]
A0A267H4282.299e-14960.18Peptidyl-prolyl cis-trans isomerase (Fragment) OS=... [more]
A0A2T7P3J64.482e-14764.80Peptidyl-prolyl cis-trans isomerase OS=Pomacea can... [more]
A0A1S3HZ135.538e-14362.77Peptidyl-prolyl cis-trans isomerase OS=Lingula ung... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppil44.161e-13258.75peptidylprolyl isomerase like 4 [Source:NCBI gene;... [more]
ppil48.563e-11557.44peptidylprolyl isomerase like 4 [Source:NCBI gene;... [more]
ppil34.674e-3338.60peptidylprolyl isomerase (cyclophilin)-like 3 [Sou... [more]
ppil11.178e-3137.25peptidylprolyl isomerase (cyclophilin)-like 1 [Sou... [more]
ppwd14.675e-2438.36peptidylprolyl isomerase domain and WD repeat cont... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppil12.249e-3339.13peptidylprolyl isomerase (cyclophilin)-like 1 [Sou... [more]
ENSPMAT00000004654.15.975e-1932.16pep scaffold:Pmarinus_7.0:GL489343:42315:43690:-1 ... [more]
ppifb4.587e-1834.25peptidylprolyl isomerase Fb [Source:ZFIN;Acc:ZDB-G... [more]
ppig1.233e-1731.18peptidylprolyl isomerase G (cyclophilin G) [Source... [more]
ENSPMAT00000006086.17.536e-1633.93pep scaffold:Pmarinus_7.0:GL479902:31682:44317:-1 ... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CPR23.187e-2337.66Peptidyl-prolyl cis-trans isomerase (cyclophilin);... [more]
CPR52.147e-2238.82Peptidyl-prolyl cis-trans isomerase (cyclophilin) ... [more]
CPR35.818e-1936.25Mitochondrial peptidyl-prolyl cis-trans isomerase ... [more]
CPR69.506e-1935.71Peptidyl-prolyl cis-trans isomerase (cyclophilin);... [more]
CPR12.466e-1738.97Cytoplasmic peptidyl-prolyl cis-trans isomerase (c... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO440085.158e-13760.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389088.583e-3740.00Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
EDO359981.511e-3340.65Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
EDO303575.955e-3337.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461951.143e-3139.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppil41.026e-12759.06peptidylprolyl isomerase like 4 [Source:NCBI gene;... [more]
ppil41.123e-11155.31peptidylprolyl isomerase like 4 [Source:NCBI gene;... [more]
ENSORLT00000000980.27.742e-3439.39peptidylprolyl isomerase like 3 [Source:NCBI gene;... [more]
ppil11.980e-3337.34peptidylprolyl isomerase like 1 [Source:NCBI gene;... [more]
ENSORLT00000044034.19.560e-3138.61peptidylprolyl isomerase like 3 [Source:NCBI gene;... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023600.11.419e-699.77SMESG000023600.1[more]
SMESG000072690.18.129e-3440.79SMESG000072690.1[more]
SMESG000019956.14.074e-3240.12SMESG000019956.1[more]
SMESG000036294.11.062e-2638.16SMESG000036294.1[more]
SMESG000022142.13.941e-2436.53SMESG000022142.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004016 ID=SMED30004016|Name=Peptidyl-prolyl cis-trans isomerase|organism=Schmidtea mediterranea sexual|type=transcript|length=1515bp
ATGCATATTAACTAAAAATATAAAAATATAATTATCACCTTTTTTTTGAT
GTCTGTAATATTTGAAACTTCAGTTGGTGAATTTACTATTGATTTATATA
TCAAAGAACGTCCAAGATGCTGTGAAAATTTCTTAAAGCTCTGTAAAATG
AAATATTATAATTACACATTGTTTCATTCGATACAGCATCAACTTGTGGC
TCAGGCAGGTGATCCAACTGGCACAGGAACCGGTGGTCATTCTATTTGGC
AGCAGATTAATGGTGAGACATATTTCCTAAACGAACTCAAACCAAAAATT
AAGCACCGTAAATCTGGTTTAATATCCATGGTTAATAACGGTCAAAATAA
ACATGGATCTCAATTTTTTATAACATTATCTAATAATTTGGATTATCTCG
ATGGAATTCACACGGTATTCGGTGAAATTTCCGATGGAATTTCAATTGTC
GATAGCCTAAATAACGTCTATGTTGATAAAGCTAACATTCCTCTTCGAGA
AGTTCGAATTTATCACACAATAATTCTCGATGATCCTTTTCCCGATCATC
CATCTTTGGTTTTCCCTGAGATATCACCAGAGCCGACTGAAAGACAATTG
ATATCGAACCGAATCGGTGCCGAGGAAGATATTAATGATGACAGTGGATT
AACAGAGGAAGAAAAACAGGAAATTGAAAAGATGAAAGAAGCAAAAATCA
ATGCTCAAATCCTCACTGTAATCGGTGACATTCCCGATGAGGATATCAAA
CCGCCGGAAAATGTTTTATTCGTTTGTAGTCTCAATCCTATCACTACAAG
CGAAGATTTGGAAGTGATTTTCTCACAATTCGGTGAAATATTGAGCTGTG
AGGTGATCAGAGATTATAAAACCGGCAACAGCTTGCAGTACGCTTTCATT
GAATTCGAGAATAAAAAGTTTTGTGAAAATGCTTATTACCACATGGAGCG
GGTGCTGATCGATGACAGGCGAATCCACGTCGATTTCTCGCAATCGGTCT
CTAAGCAATGGAAATATTACAAAGATTATCAGAGACAAAAGAAAGGAAAT
GCTGGAAATCAAAATGAAATTGTAAAAGTTGACGAGAAAATAAAGAAACA
CAGAAATAGTAGAGAAAAAGATAAAAGCAGATCGGTTGAAAGAAAAGAAA
GACGAAATCGATCAAATGAGAAAAAACCAAACGAAAGGAACCGAGAAAGA
AGTCGGTCAATTAATCGGCAAGATAAATCAAGGGAAAGAAACAGAAAAAG
CCGCTCGAGAGATAGAAATCCGAAACGAGTTAAAAGCAGGTCTAATGATA
GGAATGACAGCAGGGCAACCAATAGGAAGCAGTCGGAATATAACAAGCGA
AAAGATTATTCAGAAACCGATTTGGACATGAGAGAAAGACATTCTCGTCG
ATCGCATTCAAATGGCAGGTCAAATCGAACGGAAAGAAAACGGTCTCAAT
CTCACAAGCGAAACAAAAGATAAACATTTTTGTAAATAAATTTTTTGCAA
TTTGTTAAAAAAAAA
back to top

protein sequence of SMED30004016-orf-1

>SMED30004016-orf-1 ID=SMED30004016-orf-1|Name=SMED30004016-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=475bp
MSVIFETSVGEFTIDLYIKERPRCCENFLKLCKMKYYNYTLFHSIQHQLV
AQAGDPTGTGTGGHSIWQQINGETYFLNELKPKIKHRKSGLISMVNNGQN
KHGSQFFITLSNNLDYLDGIHTVFGEISDGISIVDSLNNVYVDKANIPLR
EVRIYHTIILDDPFPDHPSLVFPEISPEPTERQLISNRIGAEEDINDDSG
LTEEEKQEIEKMKEAKINAQILTVIGDIPDEDIKPPENVLFVCSLNPITT
SEDLEVIFSQFGEILSCEVIRDYKTGNSLQYAFIEFENKKFCENAYYHME
RVLIDDRRIHVDFSQSVSKQWKYYKDYQRQKKGNAGNQNEIVKVDEKIKK
HRNSREKDKSRSVERKERRNRSNEKKPNERNRERSRSINRQDKSRERNRK
SRSRDRNPKRVKSRSNDRNDSRATNRKQSEYNKRKDYSETDLDMRERHSR
RSHSNGRSNRTERKRSQSHKRNKR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR035542CRIP
IPR035538Cyclophilin_PPIL4
IPR035979RBD_domain_sf
IPR029000Cyclophilin-like_dom_sf
IPR012677Nucleotide-bd_a/b_plait_sf
IPR002130Cyclophilin-type_PPIase_dom
IPR000504RRM_dom
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
GO:0000413protein peptidyl-prolyl isomerization
Vocabulary: molecular function
TermDefinition
GO:0003755peptidyl-prolyl cis-trans isomerase activity
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0016853isomerase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 202..222
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 410..458
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 342..401
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 331..474
NoneNo IPR availableCDDcd12235RRM_PPIL4coord: 235..317
e-value: 1.34856E-55
score: 177.84
IPR002130Cyclophilin-type peptidyl-prolyl cis-trans isomerase domainPRINTSPR00153CSAPPISMRASEcoord: 90..105
score: 52.91
coord: 42..54
score: 34.53
coord: 16..31
score: 40.55
coord: 119..134
score: 44.91
IPR002130Cyclophilin-type peptidyl-prolyl cis-trans isomerase domainPFAMPF00160Pro_isomerasecoord: 3..156
e-value: 3.9E-35
score: 121.4
IPR002130Cyclophilin-type peptidyl-prolyl cis-trans isomerase domainPROSITEPS50072CSA_PPIASE_2coord: 1..159
score: 24.014
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 239..312
e-value: 2.4E-19
score: 80.3
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 240..310
e-value: 2.5E-15
score: 56.0
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 238..316
score: 15.579
IPR029000Cyclophilin-like domain superfamilyGENE3DG3DSA:2.40.100.10coord: 1..170
e-value: 7.3E-54
score: 184.1
IPR029000Cyclophilin-like domain superfamilySUPERFAMILYSSF50891Cyclophilin-likecoord: 1..178
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 178..323
e-value: 2.0E-23
score: 85.1
IPR035542Cyclophilin-RNA interacting proteinPANTHERPTHR45843FAMILY NOT NAMEDcoord: 1..440
IPR035538PPIL4-like, cyclophilin domainCDDcd01921cyclophilin_RRMcoord: 6..166
e-value: 1.48656E-71
score: 222.216
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 222..337