SMED30003997

Overview
NameSMED30003997
Smed IDSMED30003997
Length (bp)669
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30003997 (SMED30003997) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30003997 (SMED30003997) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30003997 (SMED30003997) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30003997 (SMED30003997) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003997

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30003997h1SMcG0013623 dd_Smed_v4_244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003997h1SMcG0013623 dd_Smed_v4_244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30003997h1SMcG0013623 dd_Smed_v4_483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30003997h1SMcG0013623 dd_Smed_v4_483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30003997h1SMcG0013623 dd_Smed_v4_483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003997h1SMcG0013623 dd_Smed_v4_483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003997h1SMcG0013623 dd_Smed_v4_483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003997h1SMcG0013623 dd_Smed_v4_483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30003997h1SMcG0013623 dd_Smed_v4_483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30003997 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000393:3628..4368 +3228
Homology
BLAST of SMED30003997 vs. Ensembl Human
Match: CNBP (CCHC-type zinc finger nucleic acid binding protein [Source:HGNC Symbol;Acc:HGNC:13164])

HSP 1 Score: 67.781 bits (164), Expect = 1.353e-13
Identity = 51/187 (27.27%), Postives = 74/187 (39.57%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTESK-------------RYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            EC+ CG+ GH++REC                 ++ S S P  CY CGE+GH++KDC   E                                                  CY+CG+ GHI+  C +  R                +++  CYNC + GH++R+C +   E+KCY C   GHI +DCT
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRGFQFVSSSLPDICYRCGESGHLAKDCDLQE----------------------------------------------DVEACYNCGRGGHIAKDCKEPKR----------------EREQCCYNCGKPGHLARDCDHA-DEQKCYSCGEFGHIQKDCT 128          

HSP 2 Score: 59.6918 bits (143), Expect = 1.226e-10
Identity = 47/173 (27.17%), Postives = 71/173 (41.04%), Query Frame = 1
Query:   88 CYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            CY CG+ GH +++C   +         ACYNCG  GHI+KDC + +R   +                                             CY+CG+ GH++  C          + G +     +  +VKCY C + GH++  C    SE  CY+C  +GH+AR+CT
Sbjct:   47 CYRCGESGHLAKDCDLQE------DVEACYNCGRGGHIAKDCKEPKREREQ--------------------------------------------CCYNCGKPGHLARDCDHADEQK-CYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 167          

HSP 3 Score: 46.9802 bits (110), Expect = 4.092e-6
Identity = 25/80 (31.25%), Postives = 41/80 (51.25%), Query Frame = 1
Query:  376 CYSCGQSGHISSYCPQGSRNNDSRNRGS--YKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTD 609
            C+ CG+SGH +  CP G             ++F   +   + CY C ++GH++++C      + CY C   GHIA+DC +
Sbjct:    6 CFKCGRSGHWARECPTGGGRGRGMRSRGRGFQFVSSSLPDI-CYRCGESGHLAKDCDLQEDVEACYNCGRGGHIAKDCKE 84          
BLAST of SMED30003997 vs. Ensembl Human
Match: CNBP (CCHC-type zinc finger nucleic acid binding protein [Source:HGNC Symbol;Acc:HGNC:13164])

HSP 1 Score: 67.781 bits (164), Expect = 1.472e-13
Identity = 51/187 (27.27%), Postives = 74/187 (39.57%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTESK-------------RYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            EC+ CG+ GH++REC                 ++ S S P  CY CGE+GH++KDC   E                                                  CY+CG+ GHI+  C +  R                +++  CYNC + GH++R+C +   E+KCY C   GHI +DCT
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRGFQFVSSSLPDICYRCGESGHLAKDCDLQE------------------------------------------------DACYNCGRGGHIAKDCKEPKR----------------EREQCCYNCGKPGHLARDCDHA-DEQKCYSCGEFGHIQKDCT 126          

HSP 2 Score: 60.077 bits (144), Expect = 9.204e-11
Identity = 47/173 (27.17%), Postives = 71/173 (41.04%), Query Frame = 1
Query:   88 CYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            CY CG+ GH +++C          +  ACYNCG  GHI+KDC + +R   +                                             CY+CG+ GH++  C          + G +     +  +VKCY C + GH++  C    SE  CY+C  +GH+AR+CT
Sbjct:   47 CYRCGESGHLAKDCD--------LQEDACYNCGRGGHIAKDCKEPKREREQ--------------------------------------------CCYNCGKPGHLARDCDHADEQK-CYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 165          
BLAST of SMED30003997 vs. Ensembl Human
Match: CNBP (CCHC-type zinc finger nucleic acid binding protein [Source:HGNC Symbol;Acc:HGNC:13164])

HSP 1 Score: 65.4698 bits (158), Expect = 1.148e-12
Identity = 51/194 (26.29%), Postives = 75/194 (38.66%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTESK--------------------RYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            EC+ CG+ GH++REC                        ++ S S P  CY CGE+GH++KDC   E  +                                               CY+CG+ GHI+  C +  R                +++  CYNC + GH++R+C +   E+KCY C   GHI +DCT
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDLQEDVE----------------------------------------------ACYNCGRGGHIAKDCKEPKR----------------EREQCCYNCGKPGHLARDCDHA-DEQKCYSCGEFGHIQKDCT 135          

HSP 2 Score: 60.077 bits (144), Expect = 1.160e-10
Identity = 47/173 (27.17%), Postives = 71/173 (41.04%), Query Frame = 1
Query:   88 CYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            CY CG+ GH +++C   +         ACYNCG  GHI+KDC + +R   +                                             CY+CG+ GH++  C          + G +     +  +VKCY C + GH++  C    SE  CY+C  +GH+AR+CT
Sbjct:   54 CYRCGESGHLAKDCDLQE------DVEACYNCGRGGHIAKDCKEPKREREQ--------------------------------------------CCYNCGKPGHLARDCDHADEQK-CYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 174          
BLAST of SMED30003997 vs. Ensembl Human
Match: CNBP (CCHC-type zinc finger nucleic acid binding protein [Source:HGNC Symbol;Acc:HGNC:13164])

HSP 1 Score: 65.0846 bits (157), Expect = 1.304e-12
Identity = 51/194 (26.29%), Postives = 74/194 (38.14%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTESK--------------------RYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            EC+ CG+ GH++REC                        ++ S S P  CY CGE+GH++KDC   E                                                  CY+CG+ GHI+  C +  R                +++  CYNC + GH++R+C +   E+KCY C   GHI +DCT
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDLQE------------------------------------------------DACYNCGRGGHIAKDCKEPKR----------------EREQCCYNCGKPGHLARDCDHA-DEQKCYSCGEFGHIQKDCT 133          

HSP 2 Score: 60.077 bits (144), Expect = 9.175e-11
Identity = 47/173 (27.17%), Postives = 71/173 (41.04%), Query Frame = 1
Query:   88 CYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            CY CG+ GH +++C          +  ACYNCG  GHI+KDC + +R   +                                             CY+CG+ GH++  C          + G +     +  +VKCY C + GH++  C    SE  CY+C  +GH+AR+CT
Sbjct:   54 CYRCGESGHLAKDCD--------LQEDACYNCGRGGHIAKDCKEPKREREQ--------------------------------------------CCYNCGKPGHLARDCDHADEQK-CYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 172          
BLAST of SMED30003997 vs. Ensembl Human
Match: CNBP (CCHC-type zinc finger nucleic acid binding protein [Source:HGNC Symbol;Acc:HGNC:13164])

HSP 1 Score: 65.0846 bits (157), Expect = 1.369e-12
Identity = 51/194 (26.29%), Postives = 74/194 (38.14%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTESK--------------------RYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            EC+ CG+ GH++REC                        ++ S S P  CY CGE+GH++KDC   E                                                  CY+CG+ GHI+  C +  R                +++  CYNC + GH++R+C +   E+KCY C   GHI +DCT
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDLQEDE-----------------------------------------------ACYNCGRGGHIAKDCKEPKR----------------EREQCCYNCGKPGHLARDCDHA-DEQKCYSCGEFGHIQKDCT 134          

HSP 2 Score: 63.1586 bits (152), Expect = 6.774e-12
Identity = 49/178 (27.53%), Postives = 69/178 (38.76%), Query Frame = 1
Query:   73 QRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            Q    CYNCG+ GH +++C E KR     +   CYNCG+ GH+++DC   + +                                                CYSCG+ GHI   C                       +VKCY C + GH++  C    SE  CY+C  +GH+AR+CT
Sbjct:   70 QEDEACYNCGRGGHIAKDCKEPKR----EREQCCYNCGKPGHLARDCDHADEQK-----------------------------------------------CYSCGEFGHIQKDCT----------------------KVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 173          
BLAST of SMED30003997 vs. Ensembl Celegans
Match: K08D12.3 (pep chromosome:WBcel235:IV:1710265:1711127:1 gene:WBGene00019537.1 transcript:K08D12.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K08D12.3)

HSP 1 Score: 52.7582 bits (125), Expect = 1.219e-8
Identity = 32/71 (45.07%), Postives = 39/71 (54.93%), Query Frame = 1
Query:  397 GHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPS--EKKCYKCQNTGHIARDC 603
            GH S  CP       S   G       +    KCYNC ++GH+SREC    S  EK+CY+CQ TGHI+RDC
Sbjct:   76 GHYSRDCPSARSEGGSGGYGGRGGEGRSFGGQKCYNCGRSGHISRECTESGSAEEKRCYQCQETGHISRDC 146          

HSP 2 Score: 49.2914 bits (116), Expect = 1.934e-7
Identity = 25/44 (56.82%), Postives = 30/44 (68.18%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCP 216
            +CYNCG+ GH SRECTES      ++   CY C E GHIS+DCP
Sbjct:  108 KCYNCGRSGHISRECTES----GSAEEKRCYQCQETGHISRDCP 147          

HSP 3 Score: 45.0542 bits (105), Expect = 6.273e-6
Identity = 23/45 (51.11%), Postives = 26/45 (57.78%), Query Frame = 1
Query:  496 CYNCNQNGHMSRECPNGPSE---------KKCYKCQNTGHIARDC 603
            CY C Q GH+SR CPNG S+           CY CQ TGH +RDC
Sbjct:    6 CYKCQQPGHISRNCPNGESDGGRRGGGGGSTCYNCQETGHFSRDC 50          
BLAST of SMED30003997 vs. Ensembl Fly
Match: CNBP (gene:FBgn0034802 transcript:FBtr0303464)

HSP 1 Score: 59.6918 bits (143), Expect = 4.799e-11
Identity = 48/181 (26.52%), Postives = 64/181 (35.36%), Query Frame = 1
Query:   67 MSQRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTD 609
            M + R +CY C Q GH++R C E            CY C   GHISKDC Q +                                                  CY C ++GH    CP+        N             V CY CN+ GH+S+ CP   + K CY C  +GH+ R+C +
Sbjct:   50 MRRNREKCYKCNQFGHFARACPEEAE--------RCYRCNGIGHISKDCTQADNP-----------------------------------------------TCYRCNKTGHWVRNCPEAVNERGPTN-------------VSCYKCNRTGHISKNCPE--TSKTCYGCGKSGHLRRECDE 160          
BLAST of SMED30003997 vs. Ensembl Fly
Match: CNBP (gene:FBgn0034802 transcript:FBtr0071994)

HSP 1 Score: 59.6918 bits (143), Expect = 4.799e-11
Identity = 48/181 (26.52%), Postives = 64/181 (35.36%), Query Frame = 1
Query:   67 MSQRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTD 609
            M + R +CY C Q GH++R C E            CY C   GHISKDC Q +                                                  CY C ++GH    CP+        N             V CY CN+ GH+S+ CP   + K CY C  +GH+ R+C +
Sbjct:   50 MRRNREKCYKCNQFGHFARACPEEAE--------RCYRCNGIGHISKDCTQADNP-----------------------------------------------TCYRCNKTGHWVRNCPEAVNERGPTN-------------VSCYKCNRTGHISKNCPE--TSKTCYGCGKSGHLRRECDE 160          
BLAST of SMED30003997 vs. Ensembl Zebrafish
Match: cnbpb (CCHC-type zinc finger, nucleic acid binding protein b [Source:ZFIN;Acc:ZDB-GENE-030131-7782])

HSP 1 Score: 62.7734 bits (151), Expect = 4.560e-12
Identity = 49/175 (28.00%), Postives = 75/175 (42.86%), Query Frame = 1
Query:   88 CYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTDD 612
            CY CG+ GH +R+C  ++         ACYNCG  GHIS+DC + ++   +                                            VCY+CG++GH++  C   +        G      G +K VKCY C + GH++ +C    SE  CY C  +GH+A++CT +
Sbjct:   38 CYRCGEPGHVARDCERTE--------DACYNCGRGGHISRDCKEPKKEREQ--------------------------------------------VCYNCGKAGHMARDCDHANEQKCYSCGGFGHIQKGCEK-VKCYRCGEIGHVAVQCSK-ASEVNCYNCGKSGHVAKECTIE 158          

HSP 2 Score: 53.1434 bits (126), Expect = 1.384e-8
Identity = 45/177 (25.42%), Postives = 69/177 (38.98%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTESKRYGSGSKPGA----CYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDC 603
            EC+ CG+ GH+ + C  + R     +       CY CGE GH+++DC + E                                                  CY+CG+ GHIS  C +  +                +++  CYNC + GHM+R+C +  +E+KCY C   GHI + C
Sbjct:    5 ECFGCGRTGHWIKNCPNAGRGRGKGRGRGKDLFCYRCGEPGHVARDCERTED------------------------------------------------ACYNCGRGGHISRDCKEPKK----------------EREQVCYNCGKAGHMARDCDH-ANEQKCYSCGGFGHIQKGC 116          
BLAST of SMED30003997 vs. Ensembl Zebrafish
Match: cnbpb (CCHC-type zinc finger, nucleic acid binding protein b [Source:ZFIN;Acc:ZDB-GENE-030131-7782])

HSP 1 Score: 62.7734 bits (151), Expect = 4.560e-12
Identity = 49/175 (28.00%), Postives = 75/175 (42.86%), Query Frame = 1
Query:   88 CYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTDD 612
            CY CG+ GH +R+C  ++         ACYNCG  GHIS+DC + ++   +                                            VCY+CG++GH++  C   +        G      G +K VKCY C + GH++ +C    SE  CY C  +GH+A++CT +
Sbjct:   38 CYRCGEPGHVARDCERTE--------DACYNCGRGGHISRDCKEPKKEREQ--------------------------------------------VCYNCGKAGHMARDCDHANEQKCYSCGGFGHIQKGCEK-VKCYRCGEIGHVAVQCSK-ASEVNCYNCGKSGHVAKECTIE 158          

HSP 2 Score: 53.1434 bits (126), Expect = 1.384e-8
Identity = 45/177 (25.42%), Postives = 69/177 (38.98%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTESKRYGSGSKPGA----CYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDC 603
            EC+ CG+ GH+ + C  + R     +       CY CGE GH+++DC + E                                                  CY+CG+ GHIS  C +  +                +++  CYNC + GHM+R+C +  +E+KCY C   GHI + C
Sbjct:    5 ECFGCGRTGHWIKNCPNAGRGRGKGRGRGKDLFCYRCGEPGHVARDCERTED------------------------------------------------ACYNCGRGGHISRDCKEPKK----------------EREQVCYNCGKAGHMARDCDH-ANEQKCYSCGGFGHIQKGC 116          
BLAST of SMED30003997 vs. Ensembl Zebrafish
Match: cnbpa (CCHC-type zinc finger, nucleic acid binding protein a [Source:ZFIN;Acc:ZDB-GENE-030131-5045])

HSP 1 Score: 61.6178 bits (148), Expect = 1.499e-11
Identity = 49/178 (27.53%), Postives = 66/178 (37.08%), Query Frame = 1
Query:   73 QRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            Q    CYNC + GH SR+C E K+     +   CYNCG+ GH+++DC     +                                                CYSCG  GHI   C                       +VKCY C + GH++ +C    +E  CY C  TGH+ARDC+
Sbjct:   55 QTEDACYNCHRSGHISRDCKEPKK----EREQCCYNCGKAGHVARDCDHANEQK-----------------------------------------------CYSCGGFGHIQKLCD----------------------KVKCYRCGEIGHVAVQCSK-ATEVNCYNCGKTGHLARDCS 158          

HSP 2 Score: 47.7506 bits (112), Expect = 1.194e-6
Identity = 27/78 (34.62%), Postives = 38/78 (48.72%), Query Frame = 1
Query:  376 CYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTD 609
            C+ CG+SGH    CP   R                 K + CY C + GH++R+C    +E  CY C  +GHI+RDC +
Sbjct:    8 CFGCGRSGHWIKNCPNAGRGRGRGRGRG--------KDLFCYRCGEQGHIARDCEQ--TEDACYNCHRSGHISRDCKE 75          
BLAST of SMED30003997 vs. Ensembl Zebrafish
Match: cnbpa (CCHC-type zinc finger, nucleic acid binding protein a [Source:ZFIN;Acc:ZDB-GENE-030131-5045])

HSP 1 Score: 61.6178 bits (148), Expect = 1.499e-11
Identity = 49/178 (27.53%), Postives = 66/178 (37.08%), Query Frame = 1
Query:   73 QRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            Q    CYNC + GH SR+C E K+     +   CYNCG+ GH+++DC     +                                                CYSCG  GHI   C                       +VKCY C + GH++ +C    +E  CY C  TGH+ARDC+
Sbjct:   55 QTEDACYNCHRSGHISRDCKEPKK----EREQCCYNCGKAGHVARDCDHANEQK-----------------------------------------------CYSCGGFGHIQKLCD----------------------KVKCYRCGEIGHVAVQCSK-ATEVNCYNCGKTGHLARDCS 158          

HSP 2 Score: 47.7506 bits (112), Expect = 1.194e-6
Identity = 27/78 (34.62%), Postives = 38/78 (48.72%), Query Frame = 1
Query:  376 CYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTD 609
            C+ CG+SGH    CP   R                 K + CY C + GH++R+C    +E  CY C  +GHI+RDC +
Sbjct:    8 CFGCGRSGHWIKNCPNAGRGRGRGRGRG--------KDLFCYRCGEQGHIARDCEQ--TEDACYNCHRSGHISRDCKE 75          
BLAST of SMED30003997 vs. Ensembl Zebrafish
Match: cnbpa (CCHC-type zinc finger, nucleic acid binding protein a [Source:ZFIN;Acc:ZDB-GENE-030131-5045])

HSP 1 Score: 61.6178 bits (148), Expect = 1.499e-11
Identity = 49/178 (27.53%), Postives = 66/178 (37.08%), Query Frame = 1
Query:   73 QRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            Q    CYNC + GH SR+C E K+     +   CYNCG+ GH+++DC     +                                                CYSCG  GHI   C                       +VKCY C + GH++ +C    +E  CY C  TGH+ARDC+
Sbjct:   55 QTEDACYNCHRSGHISRDCKEPKK----EREQCCYNCGKAGHVARDCDHANEQK-----------------------------------------------CYSCGGFGHIQKLCD----------------------KVKCYRCGEIGHVAVQCSK-ATEVNCYNCGKTGHLARDCS 158          

HSP 2 Score: 47.7506 bits (112), Expect = 1.194e-6
Identity = 27/78 (34.62%), Postives = 38/78 (48.72%), Query Frame = 1
Query:  376 CYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTD 609
            C+ CG+SGH    CP   R                 K + CY C + GH++R+C    +E  CY C  +GHI+RDC +
Sbjct:    8 CFGCGRSGHWIKNCPNAGRGRGRGRGRG--------KDLFCYRCGEQGHIARDCEQ--TEDACYNCHRSGHISRDCKE 75          
BLAST of SMED30003997 vs. Ensembl Mouse
Match: Cnbp (cellular nucleic acid binding protein [Source:MGI Symbol;Acc:MGI:88431])

HSP 1 Score: 67.781 bits (164), Expect = 1.011e-13
Identity = 51/187 (27.27%), Postives = 74/187 (39.57%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTESK-------------RYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            EC+ CG+ GH++REC                 ++ S S P  CY CGE+GH++KDC   E                                                  CY+CG+ GHI+  C +  R                +++  CYNC + GH++R+C +   E+KCY C   GHI +DCT
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRGFQFVSSSLPDICYRCGESGHLAKDCDLQE------------------------------------------------DACYNCGRGGHIAKDCKEPKR----------------EREQCCYNCGKPGHLARDCDHA-DEQKCYSCGEFGHIQKDCT 126          

HSP 2 Score: 60.077 bits (144), Expect = 6.319e-11
Identity = 47/173 (27.17%), Postives = 71/173 (41.04%), Query Frame = 1
Query:   88 CYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            CY CG+ GH +++C          +  ACYNCG  GHI+KDC + +R   +                                             CY+CG+ GH++  C          + G +     +  +VKCY C + GH++  C    SE  CY+C  +GH+AR+CT
Sbjct:   47 CYRCGESGHLAKDCD--------LQEDACYNCGRGGHIAKDCKEPKREREQ--------------------------------------------CCYNCGKPGHLARDCDHADEQK-CYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 165          
BLAST of SMED30003997 vs. Ensembl Mouse
Match: Cnbp (cellular nucleic acid binding protein [Source:MGI Symbol;Acc:MGI:88431])

HSP 1 Score: 67.0106 bits (162), Expect = 1.653e-13
Identity = 51/188 (27.13%), Postives = 74/188 (39.36%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTESK--------------RYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            EC+ CG+ GH++REC                  ++ S S P  CY CGE+GH++KDC   E                                                  CY+CG+ GHI+  C +  R                +++  CYNC + GH++R+C +   E+KCY C   GHI +DCT
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFQFVSSSLPDICYRCGESGHLAKDCDLQE------------------------------------------------DACYNCGRGGHIAKDCKEPKR----------------EREQCCYNCGKPGHLARDCDHA-DEQKCYSCGEFGHIQKDCT 127          

HSP 2 Score: 60.077 bits (144), Expect = 6.831e-11
Identity = 47/173 (27.17%), Postives = 71/173 (41.04%), Query Frame = 1
Query:   88 CYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            CY CG+ GH +++C          +  ACYNCG  GHI+KDC + +R   +                                             CY+CG+ GH++  C          + G +     +  +VKCY C + GH++  C    SE  CY+C  +GH+AR+CT
Sbjct:   48 CYRCGESGHLAKDCD--------LQEDACYNCGRGGHIAKDCKEPKREREQ--------------------------------------------CCYNCGKPGHLARDCDHADEQK-CYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 166          
BLAST of SMED30003997 vs. Ensembl Mouse
Match: Cnbp (cellular nucleic acid binding protein [Source:MGI Symbol;Acc:MGI:88431])

HSP 1 Score: 65.0846 bits (157), Expect = 8.952e-13
Identity = 51/194 (26.29%), Postives = 74/194 (38.14%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTESK--------------------RYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            EC+ CG+ GH++REC                        ++ S S P  CY CGE+GH++KDC   E                                                  CY+CG+ GHI+  C +  R                +++  CYNC + GH++R+C +   E+KCY C   GHI +DCT
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDLQE------------------------------------------------DACYNCGRGGHIAKDCKEPKR----------------EREQCCYNCGKPGHLARDCDHA-DEQKCYSCGEFGHIQKDCT 133          

HSP 2 Score: 60.077 bits (144), Expect = 6.299e-11
Identity = 47/173 (27.17%), Postives = 71/173 (41.04%), Query Frame = 1
Query:   88 CYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            CY CG+ GH +++C          +  ACYNCG  GHI+KDC + +R   +                                             CY+CG+ GH++  C          + G +     +  +VKCY C + GH++  C    SE  CY+C  +GH+AR+CT
Sbjct:   54 CYRCGESGHLAKDCD--------LQEDACYNCGRGGHIAKDCKEPKREREQ--------------------------------------------CCYNCGKPGHLARDCDHADEQK-CYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 172          
BLAST of SMED30003997 vs. Ensembl Mouse
Match: Cnbp (cellular nucleic acid binding protein [Source:MGI Symbol;Acc:MGI:88431])

HSP 1 Score: 65.0846 bits (157), Expect = 8.952e-13
Identity = 51/194 (26.29%), Postives = 74/194 (38.14%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTESK--------------------RYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            EC+ CG+ GH++REC                        ++ S S P  CY CGE+GH++KDC   E                                                  CY+CG+ GHI+  C +  R                +++  CYNC + GH++R+C +   E+KCY C   GHI +DCT
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDLQE------------------------------------------------DACYNCGRGGHIAKDCKEPKR----------------EREQCCYNCGKPGHLARDCDHA-DEQKCYSCGEFGHIQKDCT 133          

HSP 2 Score: 60.077 bits (144), Expect = 6.299e-11
Identity = 47/173 (27.17%), Postives = 71/173 (41.04%), Query Frame = 1
Query:   88 CYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            CY CG+ GH +++C          +  ACYNCG  GHI+KDC + +R   +                                             CY+CG+ GH++  C          + G +     +  +VKCY C + GH++  C    SE  CY+C  +GH+AR+CT
Sbjct:   54 CYRCGESGHLAKDCD--------LQEDACYNCGRGGHIAKDCKEPKREREQ--------------------------------------------CCYNCGKPGHLARDCDHADEQK-CYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 172          
BLAST of SMED30003997 vs. Ensembl Mouse
Match: Cnbp (cellular nucleic acid binding protein [Source:MGI Symbol;Acc:MGI:88431])

HSP 1 Score: 65.0846 bits (157), Expect = 9.399e-13
Identity = 51/194 (26.29%), Postives = 74/194 (38.14%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTESK--------------------RYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            EC+ CG+ GH++REC                        ++ S S P  CY CGE+GH++KDC   E                                                  CY+CG+ GHI+  C +  R                +++  CYNC + GH++R+C +   E+KCY C   GHI +DCT
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDLQEDE-----------------------------------------------ACYNCGRGGHIAKDCKEPKR----------------EREQCCYNCGKPGHLARDCDHA-DEQKCYSCGEFGHIQKDCT 134          

HSP 2 Score: 63.1586 bits (152), Expect = 4.650e-12
Identity = 49/178 (27.53%), Postives = 69/178 (38.76%), Query Frame = 1
Query:   73 QRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            Q    CYNCG+ GH +++C E KR     +   CYNCG+ GH+++DC   + +                                                CYSCG+ GHI   C                       +VKCY C + GH++  C    SE  CY+C  +GH+AR+CT
Sbjct:   70 QEDEACYNCGRGGHIAKDCKEPKR----EREQCCYNCGKPGHLARDCDHADEQK-----------------------------------------------CYSCGEFGHIQKDCT----------------------KVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 173          
BLAST of SMED30003997 vs. UniProt/SwissProt
Match: sp|Q04832|HEXP_LEIMA (DNA-binding protein HEXBP OS=Leishmania major OX=5664 GN=HEXBP PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 8.639e-19
Identity = 61/189 (32.28%), Postives = 81/189 (42.86%), Query Frame = 1
Query:   64 KMSQRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQ---GSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPN------GPSEKKCYKCQNTGHIARDC 603
            K  +R + C+ CG++GH SREC    R G+      C+ CGE GH+S+DCP                                            + G+ +   CY CGQ GH+S  CP    GSR    + RG      G      CY C   GH+SR+CPN      G  ++ CYKC + GHI+RDC
Sbjct:   37 KGDERSTTCFRCGEEGHMSRECPNEARSGAAGAM-TCFRCGEAGHMSRDCPN-----------------------------------------SAKPGAAKGFECYKCGQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYSGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRTCYKCGDAGHISRDC 183          

HSP 2 Score: 80.4925 bits (197), Expect = 6.065e-17
Identity = 70/194 (36.08%), Postives = 87/194 (44.85%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTESK---RYGSGSKPG------------ACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPN----GPSEKKCYKCQNTGHIARDCTD 609
            ECY CGQ+GH SR+C  S+   R G G K G             CY CG+ GHIS+DCP G+     AGDR                                         CY CG +GHIS  CP G        +G Y  G G+    KCY C ++GHMSRECP+    G  ++ CYKC   GHI+R+C +
Sbjct:   98 ECYKCGQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYSGDRTCYKCGDAGHISRDCPNGQGGYSGAGDR----------------------------------------TCYKCGDAGHISRDCPNG--------QGGYS-GAGD---RKCYKCGESGHMSRECPSAGSTGSGDRACYKCGKPGHISRECPE 239          

HSP 3 Score: 55.4546 bits (132), Expect = 6.019e-8
Identity = 47/152 (30.92%), Postives = 63/152 (41.45%), Query Frame = 1
Query:   88 CYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPN 543
            CY CG  GH SR+C   +   SG+    CY CG+ GHIS+DCP G+     AGDR+     +     R+                           CY CG+ GHIS  CP+   +                    CY C + GH+SR+CP+
Sbjct:  142 CYKCGDAGHISRDCPNGQGGYSGAGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRKCYKCGESGHMSRECPSAGSTGSGDR--------------ACYKCGKPGHISRECPEAGGSYGGSR---------GGGDRTCYKCGEAGHISRDCPS 270          

HSP 4 Score: 51.9878 bits (123), Expect = 7.484e-7
Identity = 27/81 (33.33%), Postives = 38/81 (46.91%), Query Frame = 1
Query:  376 CYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPN-----GPSEKKCYKCQNTGHIARDC 603
            C +CG+ GH +  CP+     D R+               C+ C + GHMSRECPN           C++C   GH++RDC
Sbjct:   18 CRNCGKEGHYARECPEADSKGDERS-------------TTCFRCGEEGHMSRECPNEARSGAAGAMTCFRCGEAGHMSRDC 85          
BLAST of SMED30003997 vs. UniProt/SwissProt
Match: sp|Q3T0Q6|CNBP_BOVIN (Cellular nucleic acid-binding protein OS=Bos taurus OX=9913 GN=CNBP PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 7.070e-13
Identity = 51/187 (27.27%), Postives = 74/187 (39.57%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTESK-------------RYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            EC+ CG+ GH++REC                 ++ S S P  CY CGE+GH++KDC   E                                                  CY+CG+ GHI+  C +  R                +++  CYNC + GH++R+C +   E+KCY C   GHI +DCT
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRGFQFVSSSLPDICYRCGESGHLAKDCDLQE------------------------------------------------DACYNCGRGGHIAKDCKEPKR----------------EREQCCYNCGKPGHLARDCDHA-DEQKCYSCGEFGHIQKDCT 126          

HSP 2 Score: 60.077 bits (144), Expect = 4.420e-10
Identity = 47/173 (27.17%), Postives = 71/173 (41.04%), Query Frame = 1
Query:   88 CYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            CY CG+ GH +++C          +  ACYNCG  GHI+KDC + +R   +                                             CY+CG+ GH++  C          + G +     +  +VKCY C + GH++  C    SE  CY+C  +GH+AR+CT
Sbjct:   47 CYRCGESGHLAKDCD--------LQEDACYNCGRGGHIAKDCKEPKREREQ--------------------------------------------CCYNCGKPGHLARDCDHADEQK-CYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 165          
BLAST of SMED30003997 vs. UniProt/SwissProt
Match: sp|O42395|CNBP_CHICK (Cellular nucleic acid-binding protein OS=Gallus gallus OX=9031 GN=CNBP PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 8.753e-13
Identity = 51/188 (27.13%), Postives = 75/188 (39.89%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTESK--------------RYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            EC+ CG+ GH++REC                  ++ S S P  CY CGE+GH++KDC   E +                                                CY+CG+ GHI+  C +  R                +++  CYNC + GH++R+C +   E+KCY C   GHI +DCT
Sbjct:    5 ECFKCGRTGHWARECPTGIGRGRGMRSRGRAGFQFMSSSLPDICYRCGESGHLAKDCDLQEDK-----------------------------------------------ACYNCGRGGHIAKDCKEPKR----------------EREQCCYNCGKPGHLARDCDHA-DEQKCYSCGEFGHIQKDCT 128          

HSP 2 Score: 63.1586 bits (152), Expect = 3.549e-11
Identity = 49/178 (27.53%), Postives = 69/178 (38.76%), Query Frame = 1
Query:   73 QRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            Q    CYNCG+ GH +++C E KR     +   CYNCG+ GH+++DC   + +                                                CYSCG+ GHI   C                       +VKCY C + GH++  C    SE  CY+C  +GH+AR+CT
Sbjct:   64 QEDKACYNCGRGGHIAKDCKEPKR----EREQCCYNCGKPGHLARDCDHADEQK-----------------------------------------------CYSCGEFGHIQKDCT----------------------KVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 167          
BLAST of SMED30003997 vs. UniProt/SwissProt
Match: sp|P53849|GIS2_YEAST (Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIS2 PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 3.305e-12
Identity = 56/205 (27.32%), Postives = 77/205 (37.56%), Query Frame = 1
Query:   67 MSQRRSECYNCGQDGHYSRECTESKRYGSGSKPG---------------ACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQ-----------VKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDC 603
            MSQ+   CY CG+ GH + +C   +   + +KPG                CYNCGE GH+  +C                                                      C++C Q+GHIS  CP+  + +       YK G  N              +KCY C Q GHMSR+C N   ++ CY C  TGHI++DC
Sbjct:    1 MSQK--ACYVCGKIGHLAEDCDSERLCYNCNKPGHVQTDCTMPRTVEFKQCYNCGETGHVRSECTVQR--------------------------------------------------CFNCNQTGHISRECPEPKKTSRFSKVSCYKCGGPNHMAKDCMKEDGISGLKCYTCGQAGHMSRDCQN---DRLCYNCNETGHISKDC 150          

HSP 2 Score: 50.447 bits (119), Expect = 8.369e-7
Identity = 43/153 (28.10%), Postives = 58/153 (37.91%), Query Frame = 1
Query:   88 CYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNG 546
            C+NC Q GH SREC E K+    SK  +CY CG   H++KDC + +                                                  CY+CGQ+GH+S  C                    ND+   CYNCN+ GH+S++CP  
Sbjct:   67 CFNCNQTGHISRECPEPKKTSRFSKV-SCYKCGGPNHMAKDCMKEDGISGLK--------------------------------------------CYTCGQAGHMSRDCQ-------------------NDRL--CYNCNETGHISKDCPKA 153          

HSP 3 Score: 50.0618 bits (118), Expect = 1.334e-6
Identity = 30/87 (34.48%), Postives = 43/87 (49.43%), Query Frame = 1
Query:  373 VCYSCGQSGHISSYC--PQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGP-----SEKKCYKCQNTGHIARDCTDD 612
            +CY+C + GH+ + C  P+        N G            +C+NCNQ GH+SRECP        S+  CYKC    H+A+DC  +
Sbjct:   24 LCYNCNKPGHVQTDCTMPRTVEFKQCYNCGETGHVRSECTVQRCFNCNQTGHISRECPEPKKTSRFSKVSCYKCGGPNHMAKDCMKE 110          
BLAST of SMED30003997 vs. UniProt/SwissProt
Match: sp|P62634|CNBP_RAT (Cellular nucleic acid-binding protein OS=Rattus norvegicus OX=10116 GN=Cnbp PE=2 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 6.262e-12
Identity = 51/194 (26.29%), Postives = 74/194 (38.14%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTESK--------------------RYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            EC+ CG+ GH++REC                        ++ S S P  CY CGE+GH++KDC   E                                                  CY+CG+ GHI+  C +  R                +++  CYNC + GH++R+C +   E+KCY C   GHI +DCT
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDLQE------------------------------------------------DACYNCGRGGHIAKDCKEPKR----------------EREQCCYNCGKPGHLARDCDHA-DEQKCYSCGEFGHIQKDCT 133          

HSP 2 Score: 60.077 bits (144), Expect = 4.406e-10
Identity = 47/173 (27.17%), Postives = 71/173 (41.04%), Query Frame = 1
Query:   88 CYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCT 606
            CY CG+ GH +++C          +  ACYNCG  GHI+KDC + +R   +                                             CY+CG+ GH++  C          + G +     +  +VKCY C + GH++  C    SE  CY+C  +GH+AR+CT
Sbjct:   54 CYRCGESGHLAKDCD--------LQEDACYNCGRGGHIAKDCKEPKREREQ--------------------------------------------CCYNCGKPGHLARDCDHADEQK-CYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 172          
BLAST of SMED30003997 vs. TrEMBL
Match: A0A5D6XYH8 (Uncharacterized protein OS=Pythium brassicum OX=1485010 GN=PybrP1_002851 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.217e-19
Identity = 53/184 (28.80%), Postives = 78/184 (42.39%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTESKRYGSGSKPG---ACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCP---QGSRNNDSRNRGSYKFGDGND--KQVKCYNCNQNGHMSRECP--NGPSEKKCYKCQNTGHIARDCT 606
            +C+ CG  GH  R+C E+     G+  G    C+ CG+ GH+ +DCP G                                                   C++CG  GHI   CP   Q  + ++  N G  +    +D  +  KC++C  +GH+ R+CP  NGPS  KCY+C  +GH AR+CT
Sbjct:  599 KCHTCGNTGHLRRDCPEAPAQAEGAFAGNANTCFGCGKTGHLKRDCPTG------------------------------------------------GRACHNCGNVGHIRRDCPEDVQPPKCHNCGNTGHLRRDCPDDARESRKCHSCGNSGHLRRDCPEDNGPSADKCYQCGESGHWARNCT 734          

HSP 2 Score: 79.337 bits (194), Expect = 2.050e-13
Identity = 42/150 (28.00%), Postives = 65/150 (43.33%), Query Frame = 1
Query:  172 CYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRN-NDSRNRGSYKFGDGNDKQV-KCYNCNQNGHMSRECPNGPSE-KKCYKCQNTGHIARDCTDD 612
            C+ CG  GH+ +DCP+   +   A    ++                                      C+ CG++GH+   CP G R  ++  N G  +     D Q  KC+NC   GH+ R+CP+   E +KC+ C N+GH+ RDC +D
Sbjct:  600 CHTCGNTGHLRRDCPEAPAQAEGAFAGNAN-------------------------------------TCFGCGKTGHLKRDCPTGGRACHNCGNVGHIRRDCPEDVQPPKCHNCGNTGHLRRDCPDDARESRKCHSCGNSGHLRRDCPED 712          
BLAST of SMED30003997 vs. TrEMBL
Match: A0A1X0P815 (Universal minicircle sequence binding protein (UMSBP) OS=Trypanosoma theileri OX=67003 GN=TM35_000023440 PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.149e-17
Identity = 61/180 (33.89%), Postives = 75/180 (41.67%), Query Frame = 1
Query:   88 CYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPN--------GPSEKKCYKCQNTGHIARDC 603
            CYNCGQ GH SREC      G+G +  ACYNCGE GH+S++CP                                        +     G      CY+CG++GH+S  CP  +                      CYNC Q+GHMSRECPN         P  + CY CQ  GH+ARDC
Sbjct:   46 CYNCGQTGHMSRECPTKAPGGAGGR--ACYNCGETGHLSRECPT---------------------------------------KTAGGAGGAGGRACYNCGETGHLSRECPTKTAGGAG-----------GAGGRACYNCGQSGHMSRECPNRGGDGYRGAPRSRACYHCQQEGHLARDC 173          

HSP 2 Score: 78.5666 bits (192), Expect = 3.562e-14
Identity = 59/180 (32.78%), Postives = 78/180 (43.33%), Query Frame = 1
Query:   88 CYNCGQDGHYSREC-TESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPS-------EKKCYKCQNTGHIARDC 603
            CYNCG+ GH SREC T++     G+   ACYNCGE GH+S++CP                                        +     G      CY+CGQSGH+S  CP         NRG   +  G  +   CY+C Q GH++R+CP  P+       +  CY C   GHI+R C
Sbjct:   72 CYNCGETGHLSRECPTKTAGGAGGAGGRACYNCGETGHLSRECPT---------------------------------------KTAGGAGGAGGRACYNCGQSGHMSRECP---------NRGGDGY-RGAPRSRACYHCQQEGHLARDCPTAPAGGAPRGGDATCYNCGQPGHISRAC 202          
BLAST of SMED30003997 vs. TrEMBL
Match: A0A3S5IS77 (Universal minicircle sequence binding protein (UMSBP) OS=Trypanosoma conorhini OX=83891 GN=Tco025E_06913 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.192e-17
Identity = 60/184 (32.61%), Postives = 84/184 (45.65%), Query Frame = 1
Query:   67 MSQRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPS-----EKKCYKCQNTGHIARDC 603
            M++    CYNCGQ GH SREC      G+G    ACYNCG+ GH+S++CP                                             GG+     CY+CGQ GHIS  CP       +R+ G ++       +  CY+C Q GH++R+CPN P+     ++ CY C  TGH++R+C
Sbjct:    6 MTRGDRACYNCGQPGHLSRECPTRPPGGAGGDR-ACYNCGQTGHLSRECPT-----------------------------------------RLPGGAGGDRACYNCGQPGHISRDCP-------TRSAGGFR----GAVRGACYHCQQEGHLARDCPNAPAGGAGGDRACYNCGQTGHLSREC 136          
BLAST of SMED30003997 vs. TrEMBL
Match: S2JQ68 (Uncharacterized protein OS=Mucor circinelloides f. circinelloides (strain 1006PhL) OX=1220926 GN=HMPREF1544_08490 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.677e-17
Identity = 67/193 (34.72%), Postives = 84/193 (43.52%), Query Frame = 1
Query:   70 SQRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFG-DGNDKQVKCYNCNQNGHMSRECP----NGPSEKKCYKCQNTGHIARDCTDD*LIQTCF 633
            SQ  S CYNC Q GH S++CTE++          CY C + GHIS+DCP+    D                                               CYSCG+SGH+S  CP+G       N G Y  G  G      CY+C Q GHMSR+CP     G   +KCY C N+GHI+RDC      +TC+
Sbjct:   23 SQAESVCYNCQQGGHMSKDCTEAR------AEKKCYKCSQTGHISRDCPEASSNDGP--------------------------------------------ACYSCGKSGHMSRNCPEGG------NNGGYDSGRSGYGAPKSCYSCGQTGHMSRDCPSGGSGGYGGQKCYNCGNSGHISRDCDMPAQAKTCY 159          

HSP 2 Score: 60.077 bits (144), Expect = 1.577e-7
Identity = 32/79 (40.51%), Postives = 41/79 (51.90%), Query Frame = 1
Query:  373 VCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTD 609
            +CY CG+ GH +  C Q                     +  CYNC Q GHMS++C    +EKKCYKC  TGHI+RDC +
Sbjct:    8 ICYKCGEPGHQARDCSQA--------------------ESVCYNCQQGGHMSKDCTEARAEKKCYKCSQTGHISRDCPE 66          
BLAST of SMED30003997 vs. TrEMBL
Match: D3BUZ6 (Uncharacterized protein OS=Polysphondylium pallidum (strain ATCC 26659 / Pp 5 / PN500) OX=670386 GN=PPL_11968 PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 4.945e-17
Identity = 63/176 (35.80%), Postives = 79/176 (44.89%), Query Frame = 1
Query:   88 CYNCGQDGHYSRECTESKRYGSGSKPGA--CYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTD 609
            C+ CG+ GH SRECT+    G GS  G   C+NCG+ GHIS++CP G       G                                           CY+CG +GHIS  CP  S  ND           G D+   C+NC + GHMSR+C  G S   C+KC  TGHI+RDCT+
Sbjct:   39 CFKCGKPGHMSRECTQ----GGGSDRGGNNCFNCGKPGHISRECPDGAAGAGNTGS------------------------------------------CYNCGNTGHISRECPNKSERNDR---------SGGDRA--CFNCGKTGHMSRDCTQGGSSAGCFKCGKTGHISRDCTE 157          

HSP 2 Score: 75.8702 bits (185), Expect = 7.108e-13
Identity = 59/175 (33.71%), Postives = 78/175 (44.57%), Query Frame = 1
Query:   88 CYNCGQDGHYSREC-TESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSE-KKCYKCQNTGHIARDCT 606
            CYNCG  GH SREC  +S+R        AC+NCG+ GH+S+DC QG                                                S+ C+ CG++GHIS  C +          G    G G DK  KC+ CNQ GH+SR+CPN  S+   C+ C  +GH +R+CT
Sbjct:   91 CYNCGNTGHISRECPNKSERNDRSGGDRACFNCGKTGHMSRDCTQG----------------------------------------------GSSAGCFKCGKTGHISRDCTE---------SGGSDRGHGGDK--KCFKCNQTGHISRDCPNSDSQGPSCFNCGESGHKSRECT 208          

HSP 3 Score: 58.151 bits (139), Expect = 1.860e-6
Identity = 36/93 (38.71%), Postives = 46/93 (49.46%), Query Frame = 1
Query:  376 CYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPS-------EKKCYKCQNTGHIARDCTDD*LIQTCF 633
            C++CG+ GHIS  CP G+             G GN     CYNC   GH+SRECPN          ++ C+ C  TGH++RDCT       CF
Sbjct:   65 CFNCGKPGHISRECPDGA------------AGAGN--TGSCYNCGNTGHISRECPNKSERNDRSGGDRACFNCGKTGHMSRDCTQGGSSAGCF 143          
BLAST of SMED30003997 vs. Ensembl Cavefish
Match: cnbpa (cellular nucleic acid-binding protein-like [Source:NCBI gene;Acc:103024401])

HSP 1 Score: 63.929 bits (154), Expect = 2.118e-12
Identity = 55/186 (29.57%), Postives = 86/186 (46.24%), Query Frame = 1
Query:   67 MSQRRSECYNCGQDGHYSRECTESKRYGSGS----KPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTDD 612
            M    SEC+ CG+ GH+ + C  + R         K   CY CGE GHI++DC Q E  +  +   ++ +   R      D ++ +++  +                CY+CG++GH++  C   +        G        DK VKCY C + GH++ +C    SE  CY C  TGH+AR+CT +
Sbjct:    1 MDMSSSECFGCGRSGHWVKNCPNAGRGRGRGRGRGKDLFCYRCGEQGHIARDCEQTEDGEALSPFSQTCYNCHRSGHISRDCKEPKKEREQ---------------CCYNCGKAGHVARDCDHANEQKCYSCGGFGHIQKLCDK-VKCYRCGEIGHVAVQCSKA-SEVNCYNCGKTGHLARECTIE 169          
BLAST of SMED30003997 vs. Ensembl Cavefish
Match: ENSAMXT00000005562.2 (cellular nucleic acid-binding protein [Source:NCBI gene;Acc:103027392])

HSP 1 Score: 63.1586 bits (152), Expect = 2.963e-12
Identity = 49/175 (28.00%), Postives = 75/175 (42.86%), Query Frame = 1
Query:   88 CYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTDD 612
            CY CG+ GH +R+C  ++         ACYNCG  GHIS+DC + ++   +                                            VCY+CG++GH++  C   +        G      G +K VKCY C + GH++ +C    SE  CY C  +GH+A++CT +
Sbjct:   38 CYRCGEPGHVARDCERTE--------DACYNCGRGGHISRDCKEPKKEREQ--------------------------------------------VCYNCGKAGHVARDCDHANEQKCYSCGGFGHIQKGCEK-VKCYRCGEIGHVAVQCSK-ASEVNCYNCGKSGHLAKECTIE 158          

HSP 2 Score: 51.6026 bits (122), Expect = 4.446e-8
Identity = 44/177 (24.86%), Postives = 69/177 (38.98%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTESKRYGSGSKPGA----CYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDC 603
            EC+ CG+ GH+ + C  + R     +       CY CGE GH+++DC + E                                                  CY+CG+ GHIS  C +  +                +++  CYNC + GH++R+C +  +E+KCY C   GHI + C
Sbjct:    5 ECFGCGRTGHWIKNCPNAGRGRGKGRGRGKDLFCYRCGEPGHVARDCERTED------------------------------------------------ACYNCGRGGHISRDCKEPKK----------------EREQVCYNCGKAGHVARDCDH-ANEQKCYSCGGFGHIQKGC 116          
BLAST of SMED30003997 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003739.1 (pep scaffold:Pmarinus_7.0:GL499243:411:1384:-1 gene:ENSPMAG00000003418.1 transcript:ENSPMAT00000003739.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 3.781e-13
Identity = 50/187 (26.74%), Postives = 70/187 (37.43%), Query Frame = 1
Query:   85 ECYNCGQDGHYSREC----------TESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNG---PSEKKCYKCQNTGHIARDCT 606
            EC+ CG  GH++REC                G   +   CY CGE GHI+++CP  +                                                  CY+CG+ GHI+  CP+G ++                    CY C + GH++REC +G   P + KCY C   GH+ RDCT
Sbjct:    5 ECFRCGGSGHWARECPNGAGGGRGPGGPVGRGGRGRGDGCYRCGEGGHIARECPLPQD------------------------------------------------TCYNCGKGGHIARECPEGRQDRGG--------------GPSCYTCGKQGHLARECSSGGGGPGDNKCYGCGQRGHMQRDCT 129          
BLAST of SMED30003997 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010393.1 (pep scaffold:Pmarinus_7.0:GL485791:8073:10868:-1 gene:ENSPMAG00000009411.1 transcript:ENSPMAT00000010393.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 2.068e-11
Identity = 40/149 (26.85%), Postives = 56/149 (37.58%), Query Frame = 1
Query:  169 ACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNG---PSEKKCYKCQNTGHIARDCT 606
             CY CGE GHI+++CP  +                                                  CY+CG+ GHI+  CP+G ++                    CY C + GH++REC +G   P + KCY C   GH+ RDCT
Sbjct:    9 GCYRCGEGGHIARECPLPQDSVSSNTA-----------------------------------------ACYNCGKGGHIARECPEGRQDRGG--------------GPSCYTCGKQGHLARECSSGGGGPGDNKCYGCGQRGHMQRDCT 102          

HSP 2 Score: 53.1434 bits (126), Expect = 9.458e-10
Identity = 42/150 (28.00%), Postives = 56/150 (37.33%), Query Frame = 1
Query:   88 CYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSREC 537
            CY CG+ GH +REC   +   S S   ACYNCG+ GHI+++CP+G +                                                 CY+CG+ GH++  C  G                G     KCY C Q GHM R+C
Sbjct:   10 CYRCGEGGHIARECPLPQDSVS-SNTAACYNCGKGGHIARECPEGRQDRGGGPS------------------------------------------CYTCGKQGHLARECSSGG---------------GGPGDNKCYGCGQRGHMQRDC 101          

HSP 3 Score: 44.2838 bits (103), Expect = 1.403e-6
Identity = 23/52 (44.23%), Postives = 33/52 (63.46%), Query Frame = 1
Query:   67 MSQRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQG 222
            +S   + CYNCG+ GH +REC E  R   G  P +CY CG+ GH++++C  G
Sbjct:   30 VSSNTAACYNCGKGGHIARECPEG-RQDRGGGP-SCYTCGKQGHLARECSSG 79          
BLAST of SMED30003997 vs. Ensembl Yeast
Match: GIS2 (Translational activator for mRNAs with internal ribosome entry sites; associates with polysomes and binds to a specific subset of mRNAs; localizes to RNA processing bodies (P bodies) and to stress granules; may have a role in translation regulation under stress conditions; ortholog of human ZNF9/CNBP, a gene involved in myotonic dystrophy type 2 [Source:SGD;Acc:S000005199])

HSP 1 Score: 65.4698 bits (158), Expect = 4.759e-14
Identity = 56/205 (27.32%), Postives = 77/205 (37.56%), Query Frame = 1
Query:   67 MSQRRSECYNCGQDGHYSRECTESKRYGSGSKPG---------------ACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQ-----------VKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDC 603
            MSQ+   CY CG+ GH + +C   +   + +KPG                CYNCGE GH+  +C                                                      C++C Q+GHIS  CP+  + +       YK G  N              +KCY C Q GHMSR+C N   ++ CY C  TGHI++DC
Sbjct:    1 MSQK--ACYVCGKIGHLAEDCDSERLCYNCNKPGHVQTDCTMPRTVEFKQCYNCGETGHVRSECTVQR--------------------------------------------------CFNCNQTGHISRECPEPKKTSRFSKVSCYKCGGPNHMAKDCMKEDGISGLKCYTCGQAGHMSRDCQN---DRLCYNCNETGHISKDC 150          

HSP 2 Score: 50.447 bits (119), Expect = 1.205e-8
Identity = 43/153 (28.10%), Postives = 58/153 (37.91%), Query Frame = 1
Query:   88 CYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNG 546
            C+NC Q GH SREC E K+    SK  +CY CG   H++KDC + +                                                  CY+CGQ+GH+S  C                    ND+   CYNCN+ GH+S++CP  
Sbjct:   67 CFNCNQTGHISRECPEPKKTSRFSKV-SCYKCGGPNHMAKDCMKEDGISGLK--------------------------------------------CYTCGQAGHMSRDCQ-------------------NDRL--CYNCNETGHISKDCPKA 153          

HSP 3 Score: 50.0618 bits (118), Expect = 1.921e-8
Identity = 30/87 (34.48%), Postives = 43/87 (49.43%), Query Frame = 1
Query:  373 VCYSCGQSGHISSYC--PQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGP-----SEKKCYKCQNTGHIARDCTDD 612
            +CY+C + GH+ + C  P+        N G            +C+NCNQ GH+SRECP        S+  CYKC    H+A+DC  +
Sbjct:   24 LCYNCNKPGHVQTDCTMPRTVEFKQCYNCGETGHVRSECTVQRCFNCNQTGHISRECPEPKKTSRFSKVSCYKCGGPNHMAKDCMKE 110          

HSP 4 Score: 46.9802 bits (110), Expect = 2.470e-7
Identity = 30/90 (33.33%), Postives = 41/90 (45.56%), Query Frame = 1
Query:  373 VCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSREC--PNGPSEKKCYKCQNTGHIARDCTDD*LIQTCFN 636
             CY CG+ GH++  C                     D +  CYNCN+ GH+  +C  P     K+CY C  TGH+  +CT    +Q CFN
Sbjct:    5 ACYVCGKIGHLAEDC---------------------DSERLCYNCNKPGHVQTDCTMPRTVEFKQCYNCGETGHVRSECT----VQRCFN 69          

HSP 5 Score: 46.2098 bits (108), Expect = 4.152e-7
Identity = 23/46 (50.00%), Postives = 27/46 (58.70%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQG 222
            +CY CGQ GH SR+C   +          CYNC E GHISKDCP+ 
Sbjct:  117 KCYTCGQAGHMSRDCQNDR---------LCYNCNETGHISKDCPKA 153          
BLAST of SMED30003997 vs. Ensembl Nematostella
Match: EDO27708 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8H9])

HSP 1 Score: 63.5438 bits (153), Expect = 6.374e-12
Identity = 47/187 (25.13%), Postives = 68/187 (36.36%), Query Frame = 1
Query:   88 CYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGP------------SEKKCYKCQNTGHIARDCTDD 612
            C  CG+ GH++R+C +    G G     C+ C E GH +++CP  +    +                                             C+ C +SGH +  CP           GS            CY CN+ GH +RECPN              S+  C+KCQ TGH AR+C ++
Sbjct:   36 CRKCGESGHFARDCPQ----GGGGGSRTCHKCNEEGHFARECPNADSGGNK---------------------------------------------CFKCNESGHFARECPNSGGGGGGFGGGS--------SGSTCYKCNETGHFARECPNAESNGGGFGGGGGSSDSTCFKCQQTGHFARECPNE 165          
BLAST of SMED30003997 vs. Ensembl Nematostella
Match: EDO36176 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJG4])

HSP 1 Score: 46.9802 bits (110), Expect = 5.283e-7
Identity = 30/81 (37.04%), Postives = 42/81 (51.85%), Query Frame = 1
Query:  373 VCYSCGQSGHISSYCP-QGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKK---CYKCQNTGHIARDC 603
             C+ CG+ GH S  CP Q S+  + +      F     +   C+ C Q GH SRECPN   + +   C+KC  TGH +R+C
Sbjct:   53 ACHKCGKEGHFSRECPNQDSQRMNIQYLCQTHFSISGGR--NCHKCGQEGHFSRECPNQAIQGQSDTCHKCGETGHYSREC 131          

HSP 2 Score: 46.9802 bits (110), Expect = 5.949e-7
Identity = 43/160 (26.88%), Postives = 57/160 (35.62%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTES-------KRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPN 543
            +C+ CG+ GH+SREC          KR G G   GAC+ CG+ GH S++CP  + +          H                                     C+ CGQ GH S  CP  +    S                 C+ C + GH SRECP 
Sbjct:   21 DCHQCGEAGHFSRECPNKGNQGEPIKRMGGG---GACHKCGKEGHFSRECPNQDSQRMNIQYLCQTHFSISGGRN-----------------------------CHKCGQEGHFSRECPNQAIQGQSDT---------------CHKCGETGHYSRECPT 133          
BLAST of SMED30003997 vs. Ensembl Medaka
Match: cnbpa (CCHC-type zinc finger nucleic acid binding protein [Source:NCBI gene;Acc:101173222])

HSP 1 Score: 58.5362 bits (140), Expect = 1.357e-10
Identity = 47/175 (26.86%), Postives = 72/175 (41.14%), Query Frame = 1
Query:   88 CYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTDD 612
            CY CG  GH +R+C +++         ACYNC  +GHIS+DC + ++   +                                            +CY+CG++GH++  C   +        G        DK VKCY C + GH++  C    SE  CY C   GH+A++CT +
Sbjct:   43 CYRCGDQGHMARDCDQTE--------DACYNCHRSGHISRDCKEPKKEREQ--------------------------------------------LCYTCGKAGHMARDCDHANEQKCYSCGGFGHIQKLCDK-VKCYRCGEIGHVAVHCSKA-SETNCYNCGKAGHLAKECTIE 163          

HSP 2 Score: 53.5286 bits (127), Expect = 1.012e-8
Identity = 48/187 (25.67%), Postives = 73/187 (39.04%), Query Frame = 1
Query:   61 LKMSQRRSECYNCGQDGHYSRECTES------KRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDC 603
            ++MS   SEC+ CG+ GH+ + C  +       R     K   CY CG+ GH+++DC Q E                                                  CY+C +SGHIS  C +  +                +++  CY C + GHM+R+C +  +E+KCY C   GHI + C
Sbjct:    1 MEMSSN-SECFGCGRPGHWVKHCPNASGTRGRGRGRGRGKELFCYRCGDQGHMARDCDQTED------------------------------------------------ACYNCHRSGHISRDCKEPKK----------------EREQLCYTCGKAGHMARDCDHA-NEQKCYSCGGFGHIQKLC 121          

HSP 3 Score: 50.8322 bits (120), Expect = 8.707e-8
Identity = 27/78 (34.62%), Postives = 38/78 (48.72%), Query Frame = 1
Query:  376 CYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTD 609
            C+ CG+ GH   +CP  S                  K++ CY C   GHM+R+C    +E  CY C  +GHI+RDC +
Sbjct:    9 CFGCGRPGHWVKHCPNASGTRGRGRGRG------RGKELFCYRCGDQGHMARDCDQ--TEDACYNCHRSGHISRDCKE 78          
BLAST of SMED30003997 vs. Ensembl Medaka
Match: cnbpa (CCHC-type zinc finger nucleic acid binding protein [Source:NCBI gene;Acc:101173222])

HSP 1 Score: 57.3806 bits (137), Expect = 2.999e-10
Identity = 50/188 (26.60%), Postives = 78/188 (41.49%), Query Frame = 1
Query:   61 LKMSQRRSECYNCGQDGHYSRECTESK----RYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTDD 612
            ++MS   SEC+ CG+ GH+ + C  +     R     +  ACYNC  +GHIS+DC + ++   +                                            +CY+CG++GH++  C   +        G        DK VKCY C + GH++  C    SE  CY C   GH+A++CT +
Sbjct:    1 MEMSSN-SECFGCGRPGHWVKHCPNASGTRGRGRGRGRGKACYNCHRSGHISRDCKEPKKEREQ--------------------------------------------LCYTCGKAGHMARDCDHANEQKCYSCGGFGHIQKLCDK-VKCYRCGEIGHVAVHCSKA-SETNCYNCGKAGHLAKECTIE 141          
BLAST of SMED30003997 vs. Ensembl Medaka
Match: ENSORLT00000043369.1 (pep primary_assembly:ASM223467v1:17:15543647:15547570:1 gene:ENSORLG00000023375.1 transcript:ENSORLT00000043369.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 3.744e-6
Identity = 20/47 (42.55%), Postives = 27/47 (57.45%), Query Frame = 1
Query:   73 QRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDC 213
            + R +C+ CG+ GH SRECT +K          C NCG+ GH +K C
Sbjct:  212 EHRIKCFRCGRSGHLSRECTITKN-------KKCNNCGKEGHFAKMC 251          

HSP 2 Score: 47.3654 bits (111), Expect = 6.206e-6
Identity = 18/44 (40.91%), Postives = 27/44 (61.36%), Query Frame = 1
Query:  472 DGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDC 603
            +G + ++KC+ C ++GH+SREC      KKC  C   GH A+ C
Sbjct:  209 EGGEHRIKCFRCGRSGHLSREC-TITKNKKCNNCGKEGHFAKMC 251          
BLAST of SMED30003997 vs. Planmine SMEST
Match: SMESG000059318.1 (SMESG000059318.1)

HSP 1 Score: 249.595 bits (636), Expect = 1.447e-84
Identity = 177/194 (91.24%), Postives = 178/194 (91.75%), Query Frame = 1
Query:   67 MSQRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------------XXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTDD 612
            MSQRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGERRDRRAGDRRSDHRDDRRDDRRDDRRDDRRDDRR+  RDDRR              SQRSSVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTDD
Sbjct:    1 MSQRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGERRDRRAGDRRSDHRDDRRDDRRDDRRDDRRDDRRDDRRDDRRDDRREHPRDDRRGGSQRSSVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTDD 194          
BLAST of SMED30003997 vs. Planmine SMEST
Match: SMESG000059304.1 (SMESG000059304.1)

HSP 1 Score: 249.595 bits (636), Expect = 1.447e-84
Identity = 177/194 (91.24%), Postives = 178/194 (91.75%), Query Frame = 1
Query:   67 MSQRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------------XXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTDD 612
            MSQRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGERRDRRAGDRRSDHRDDRRDDRRDDRRDDRRDDRR+  RDDRR              SQRSSVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTDD
Sbjct:    1 MSQRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGERRDRRAGDRRSDHRDDRRDDRRDDRRDDRRDDRRDDRRDDRRDDRREHPRDDRRGGSQRSSVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTDD 194          
BLAST of SMED30003997 vs. Planmine SMEST
Match: SMESG000059283.1 (SMESG000059283.1)

HSP 1 Score: 137.887 bits (346), Expect = 5.246e-41
Identity = 90/196 (45.92%), Postives = 114/196 (58.16%), Query Frame = 1
Query:   67 MSQRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDG---------------NDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTD 609
            MS RR ECYNCG+DGH SR+CTESK+ GSG + GAC+NCGE+GH+S++CPQ   R            DDRR ++R                            CY+C +SGH+S  CP+  R+N  R+ G YK G+                 ++QVKCYNCNQNGHMSRECPNG SEKKCYKC   GH++R+C +
Sbjct:    1 MSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNGSRGGDRRGGYERRGDDRRGNQRGTE-------------------------CYNCHESGHMSRECPK-QRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 170          

HSP 2 Score: 72.7886 bits (177), Expect = 7.847e-16
Identity = 52/159 (32.70%), Postives = 73/159 (45.91%), Query Frame = 1
Query:  157 SKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGD---GNDKQVKCYNCNQNGHMSRECP----NGPSEKKCYKCQNTGHIARDCTDD 612
            S+   CYNCG++GH+S+DC + ++                                                 C++CG+SGH+S  CPQ       R  G  + GD   GN +  +CYNC+++GHMSRECP    NGP    CYKC  +GH+ARDC  +
Sbjct:    3 SRRMECYNCGKDGHMSRDCTESKKSGSGPRSG----------------------------------------ACFNCGESGHMSRECPQNGSRGGDRRGGYERRGDDRRGNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQE 121          
BLAST of SMED30003997 vs. Planmine SMEST
Match: SMESG000059283.1 (SMESG000059283.1)

HSP 1 Score: 130.568 bits (327), Expect = 3.827e-38
Identity = 86/190 (45.26%), Postives = 110/190 (57.89%), Query Frame = 1
Query:   85 ECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDG---------------NDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTD 609
            ECYNCG+DGH SR+CTESK+ GSG + GAC+NCGE+GH+S++CPQ   R            DDRR ++R                            CY+C +SGH+S  CP+  R+N  R+ G YK G+                 ++QVKCYNCNQNGHMSRECPNG SEKKCYKC   GH++R+C +
Sbjct:    2 ECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNGSRGGDRRGGYERRGDDRRGNQRGTE-------------------------CYNCHESGHMSRECPK-QRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 165          

HSP 2 Score: 71.633 bits (174), Expect = 1.779e-15
Identity = 51/154 (33.12%), Postives = 71/154 (46.10%), Query Frame = 1
Query:  172 CYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGD---GNDKQVKCYNCNQNGHMSRECP----NGPSEKKCYKCQNTGHIARDCTDD 612
            CYNCG++GH+S+DC + ++                                                 C++CG+SGH+S  CPQ       R  G  + GD   GN +  +CYNC+++GHMSRECP    NGP    CYKC  +GH+ARDC  +
Sbjct:    3 CYNCGKDGHMSRDCTESKKSGSGPRSG----------------------------------------ACFNCGESGHMSRECPQNGSRGGDRRGGYERRGDDRRGNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQE 116          

HSP 3 Score: 59.6918 bits (143), Expect = 4.616e-11
Identity = 48/155 (30.97%), Postives = 64/155 (41.29%), Query Frame = 1
Query:   73 QRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQNGHMSREC 537
            QR +ECYNC + GH SREC   K+  +G +   CY CGE+GH+++DC Q                                        +      +R   CY+C Q+GH+S  CP G                    + KCY CN+ GHMSREC
Sbjct:   69 QRGTECYNCHESGHMSRECP--KQRSNGPRSNGCYKCGESGHMARDCNQ----------------------------------------EGSDNRQERQVKCYNCNQNGHMSRECPNG------------------QSEKKCYKCNKIGHMSREC 163          
BLAST of SMED30003997 vs. Planmine SMEST
Match: SMESG000059266.1 (SMESG000059266.1)

HSP 1 Score: 119.013 bits (297), Expect = 2.228e-33
Identity = 85/228 (37.28%), Postives = 104/228 (45.61%), Query Frame = 1
Query:   61 LKMSQRRSECYNCGQDGHYSRECTESKRYGSGSKPGAC--------------------------------YNCGENGHISKDCPQGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGD------------GNDKQVKCYNCNQNGHMSRECPNGPSEKKCYKCQNTGHIARDCTDD 612
            +  +QR+ +CYNCG+DGH +R+CTE K+ GS  +  AC                                YNCGE GH+SKDC                                             R  + R + CY CG++GHIS  C Q    +  R    YK               GND+Q+KCYNC+QNGHMSRECPNGPSEKKCYKC N GH+ARDCTDD
Sbjct:    1 MSYNQRKLDCYNCGKDGHMARDCTEYKKSGSNQRTNACFNCGLNGHISKECPDNRRGGGNRRGGRSSVTCYNCGEAGHVSKDCSD----------------------------------------QGYRDNAPRGNTCYKCGEAGHISRNCTQNWSGD--RQMKCYKCNQLGHMSRDCNEDGGNDRQIKCYNCHQNGHMSRECPNGPSEKKCYKCNNPGHLARDCTDD 186          
The following BLAST results are available for this feature:
BLAST of SMED30003997 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNBP1.353e-1327.27CCHC-type zinc finger nucleic acid binding protein... [more]
CNBP1.472e-1327.27CCHC-type zinc finger nucleic acid binding protein... [more]
CNBP1.148e-1226.29CCHC-type zinc finger nucleic acid binding protein... [more]
CNBP1.304e-1226.29CCHC-type zinc finger nucleic acid binding protein... [more]
CNBP1.369e-1226.29CCHC-type zinc finger nucleic acid binding protein... [more]
back to top
BLAST of SMED30003997 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
K08D12.31.219e-845.07pep chromosome:WBcel235:IV:1710265:1711127:1 gene:... [more]
back to top
BLAST of SMED30003997 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CNBP4.799e-1126.52gene:FBgn0034802 transcript:FBtr0303464[more]
CNBP4.799e-1126.52gene:FBgn0034802 transcript:FBtr0071994[more]
back to top
BLAST of SMED30003997 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnbpb4.560e-1228.00CCHC-type zinc finger, nucleic acid binding protei... [more]
cnbpb4.560e-1228.00CCHC-type zinc finger, nucleic acid binding protei... [more]
cnbpa1.499e-1127.53CCHC-type zinc finger, nucleic acid binding protei... [more]
cnbpa1.499e-1127.53CCHC-type zinc finger, nucleic acid binding protei... [more]
cnbpa1.499e-1127.53CCHC-type zinc finger, nucleic acid binding protei... [more]
back to top
BLAST of SMED30003997 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003997 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cnbp1.011e-1327.27cellular nucleic acid binding protein [Source:MGI ... [more]
Cnbp1.653e-1327.13cellular nucleic acid binding protein [Source:MGI ... [more]
Cnbp8.952e-1326.29cellular nucleic acid binding protein [Source:MGI ... [more]
Cnbp8.952e-1326.29cellular nucleic acid binding protein [Source:MGI ... [more]
Cnbp9.399e-1326.29cellular nucleic acid binding protein [Source:MGI ... [more]
back to top
BLAST of SMED30003997 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q04832|HEXP_LEIMA8.639e-1932.28DNA-binding protein HEXBP OS=Leishmania major OX=5... [more]
sp|Q3T0Q6|CNBP_BOVIN7.070e-1327.27Cellular nucleic acid-binding protein OS=Bos tauru... [more]
sp|O42395|CNBP_CHICK8.753e-1327.13Cellular nucleic acid-binding protein OS=Gallus ga... [more]
sp|P53849|GIS2_YEAST3.305e-1227.32Zinc finger protein GIS2 OS=Saccharomyces cerevisi... [more]
sp|P62634|CNBP_RAT6.262e-1226.29Cellular nucleic acid-binding protein OS=Rattus no... [more]
back to top
BLAST of SMED30003997 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5D6XYH81.217e-1928.80Uncharacterized protein OS=Pythium brassicum OX=14... [more]
A0A1X0P8151.149e-1733.89Universal minicircle sequence binding protein (UMS... [more]
A0A3S5IS771.192e-1732.61Universal minicircle sequence binding protein (UMS... [more]
S2JQ682.677e-1734.72Uncharacterized protein OS=Mucor circinelloides f.... [more]
D3BUZ64.945e-1735.80Uncharacterized protein OS=Polysphondylium pallidu... [more]
back to top
BLAST of SMED30003997 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cnbpa2.118e-1229.57cellular nucleic acid-binding protein-like [Source... [more]
ENSAMXT00000005562.22.963e-1228.00cellular nucleic acid-binding protein [Source:NCBI... [more]
back to top
BLAST of SMED30003997 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000003739.13.781e-1326.74pep scaffold:Pmarinus_7.0:GL499243:411:1384:-1 gen... [more]
ENSPMAT00000010393.12.068e-1126.85pep scaffold:Pmarinus_7.0:GL485791:8073:10868:-1 g... [more]
back to top
BLAST of SMED30003997 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GIS24.759e-1427.32Translational activator for mRNAs with internal ri... [more]
back to top
BLAST of SMED30003997 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO277086.374e-1225.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361765.283e-737.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30003997 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cnbpa1.357e-1026.86CCHC-type zinc finger nucleic acid binding protein... [more]
cnbpa2.999e-1026.60CCHC-type zinc finger nucleic acid binding protein... [more]
ENSORLT00000043369.13.744e-642.55pep primary_assembly:ASM223467v1:17:15543647:15547... [more]
back to top
BLAST of SMED30003997 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059318.11.447e-8491.24SMESG000059318.1[more]
SMESG000059304.11.447e-8491.24SMESG000059304.1[more]
SMESG000059283.15.246e-4145.92SMESG000059283.1[more]
SMESG000059283.13.827e-3845.26SMESG000059283.1[more]
SMESG000059266.12.228e-3337.28SMESG000059266.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003997 ID=SMED30003997|Name=SMED30003997|organism=Schmidtea mediterranea sexual|type=transcript|length=669bp
GTTTAAAATTTCGAACATAAATCACATAATTAAATAATTTTCTGAGTTAT
ATAATTGTGTTTAAAAATGAGTCAACGGAGGTCGGAGTGTTACAATTGTG
GCCAAGATGGTCATTATTCACGAGAGTGTACTGAAAGTAAACGTTACGGA
TCTGGATCAAAGCCTGGTGCATGCTATAATTGTGGAGAAAATGGCCATAT
TTCTAAAGATTGTCCACAAGGTGAAAGAAGAGATCGCAGAGCAGGTGATC
GTAGAAGTGACCATAGAGATGACCGTAGAGATGACCGTAGAGACGATCGT
AGAGATGATCGTAGAGATGATAGAAGAGAACACCCTAGAGACGATAGAAG
AGGAGGATCTCAGAGAAGCAGTGTTTGTTACAGTTGTGGTCAATCCGGTC
ATATTTCAAGTTATTGTCCACAAGGTTCGAGAAATAATGATTCAAGAAAT
CGTGGTTCTTATAAGTTCGGAGATGGTAATGACAAACAAGTAAAATGTTA
CAATTGCAACCAAAATGGCCATATGTCAAGAGAATGCCCTAATGGGCCAT
CGGAAAAAAAATGCTATAAGTGCCAAAATACTGGGCATATTGCAAGAGAT
TGCACTGATGATTGACTGATCCAAACGTGTTTTAATTAGTTGAATAAATG
GAATGTTATTTAAAAAAAA
back to top

protein sequence of SMED30003997-orf-1

>SMED30003997-orf-1 ID=SMED30003997-orf-1|Name=SMED30003997-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=183bp
MSQRRSECYNCGQDGHYSRECTESKRYGSGSKPGACYNCGENGHISKDCP
QGERRDRRAGDRRSDHRDDRRDDRRDDRRDDRRDDRREHPRDDRRGGSQR
SSVCYSCGQSGHISSYCPQGSRNNDSRNRGSYKFGDGNDKQVKCYNCNQN
GHMSRECPNGPSEKKCYKCQNTGHIARDCTDD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR036875Znf_CCHC_sf
IPR001878Znf_CCHC
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001878Zinc finger, CCHC-typeSMARTSM00343c2hcfinal6coord: 177..193
e-value: 3.2E-4
score: 30.0
coord: 115..131
e-value: 7.3E-4
score: 28.8
coord: 35..51
e-value: 8.9E-6
score: 35.2
coord: 155..171
e-value: 2.1E-5
score: 34.0
coord: 7..23
e-value: 7.5E-5
score: 32.1
IPR001878Zinc finger, CCHC-typePFAMPF00098zf-CCHCcoord: 155..171
e-value: 4.5E-8
score: 32.8
coord: 176..192
e-value: 1.3E-7
score: 31.4
coord: 7..23
e-value: 2.2E-7
score: 30.6
coord: 115..131
e-value: 1.6E-6
score: 27.9
coord: 35..51
e-value: 1.7E-8
score: 34.2
IPR001878Zinc finger, CCHC-typePROSITEPS50158ZF_CCHCcoord: 8..23
score: 11.037
IPR001878Zinc finger, CCHC-typePROSITEPS50158ZF_CCHCcoord: 36..51
score: 11.598
IPR001878Zinc finger, CCHC-typePROSITEPS50158ZF_CCHCcoord: 177..193
score: 10.065
IPR001878Zinc finger, CCHC-typePROSITEPS50158ZF_CCHCcoord: 116..131
score: 10.296
IPR001878Zinc finger, CCHC-typePROSITEPS50158ZF_CCHCcoord: 155..171
score: 10.905
NoneNo IPR availableGENE3DG3DSA:4.10.60.10coord: 2..30
e-value: 4.9E-7
score: 31.3
coord: 31..59
e-value: 4.5E-8
score: 34.6
coord: 105..141
e-value: 1.5E-6
score: 29.8
NoneNo IPR availableGENE3DG3DSA:4.10.60.10coord: 147..194
e-value: 1.4E-17
score: 65.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 47..121
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 127..143
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 47..110
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 127..146
NoneNo IPR availablePANTHERPTHR23002ZINC FINGER CCHC DOMAIN CONTAINING PROTEINcoord: 98..192
coord: 4..55
IPR036875Zinc finger, CCHC-type superfamilySUPERFAMILYSSF57756Retrovirus zinc finger-like domainscoord: 97..135
IPR036875Zinc finger, CCHC-type superfamilySUPERFAMILYSSF57756Retrovirus zinc finger-like domainscoord: 5..52
IPR036875Zinc finger, CCHC-type superfamilySUPERFAMILYSSF57756Retrovirus zinc finger-like domainscoord: 148..193