Tctex1 domain containing 1

Overview
NameTctex1 domain containing 1
Smed IDSMED30003981
Length (bp)735
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tctex1 domain containing 1 (SMED30003981) t-SNE clustered cells

Violin plots show distribution of expression levels for Tctex1 domain containing 1 (SMED30003981) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tctex1 domain containing 1 (SMED30003981) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tctex1 domain containing 1 (SMED30003981) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003981

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30003981h1SMcG0003933 SmedASXL_007732SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30003981h1SMcG0003933 dd_Smed_v4_12108_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003981h1SMcG0003933 dd_Smed_v4_12108_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30003981h1SMcG0003933 dd_Smed_v4_12108_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30003981h1SMcG0003933 dd_Smed_v6_12108_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tctex1 domain containing 1 vs. Ensembl Human
Match: TCTEX1D1 (Tctex1 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26882])

HSP 1 Score: 90.5077 bits (223), Expect = 6.230e-22
Identity = 48/145 (33.10%), Postives = 87/145 (60.00%), Query Frame = 3
Query:  273 IQRSRGSIWSMQNPGKKTLLS-LPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            I+ S  ++  M+ P ++  +S L +Q ENTY++ P  H  F + T+  I++DV++  L   +Y+ ++  +++K I++ IK  V+DL   R+KL+ IV IG  +  ++ I SRCLW+ ++ D  +   F   S+FA+  V+ +Y E
Sbjct:   38 IKDSMSTVSYMEEPSQRDDISRLTVQMENTYQLGPPKH--FPVVTVNHILKDVVTSYLQVEEYEPELCRQMTKTISEVIKAQVKDLMIPRYKLIVIVHIGQLNRQSILIGSRCLWDPKS-DTFSSYVFRNSSLFALANVYAVYLE 179          
BLAST of Tctex1 domain containing 1 vs. Ensembl Human
Match: TCTE3 (t-complex-associated-testis-expressed 3 [Source:HGNC Symbol;Acc:HGNC:11695])

HSP 1 Score: 84.3445 bits (207), Expect = 2.392e-19
Identity = 57/184 (30.98%), Postives = 93/184 (50.54%), Query Frame = 3
Query:  195 EIPKLIPNNP--DRRLSIIRGRRGTLVNIQRSRGSIWSMQ-----------NPGKKTLLSLP-IQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            + P+  P  P  +RR S+      T +  +R R SI ++Q           + GK+   +L  +++ N+YR+ P   +KF   ++   +Q +L++ L  VKYD KV   LS  +ADRI   V++  Y+R+K +  V    K+G  + IASR +W+    D    A  +  S  A+  VF LY+E
Sbjct:   18 QTPQQAPVTPRKERRPSMFEKEAYTQILRERLRESIHNVQYVEPPFDDSIADIGKEWKSALAKLKFANSYRMEP--LKKFQAHSVETKVQQILTESLKDVKYDDKVFSHLSLELADRILLAVKEFGYHRYKFIIKVLFIQKTGQAINIASRWIWDI-AWDSWVAAKHEAESYVALVLVFALYYE 198          
BLAST of Tctex1 domain containing 1 vs. Ensembl Human
Match: TCTE3 (t-complex-associated-testis-expressed 3 [Source:HGNC Symbol;Acc:HGNC:11695])

HSP 1 Score: 84.3445 bits (207), Expect = 2.392e-19
Identity = 57/184 (30.98%), Postives = 93/184 (50.54%), Query Frame = 3
Query:  195 EIPKLIPNNP--DRRLSIIRGRRGTLVNIQRSRGSIWSMQ-----------NPGKKTLLSLP-IQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            + P+  P  P  +RR S+      T +  +R R SI ++Q           + GK+   +L  +++ N+YR+ P   +KF   ++   +Q +L++ L  VKYD KV   LS  +ADRI   V++  Y+R+K +  V    K+G  + IASR +W+    D    A  +  S  A+  VF LY+E
Sbjct:   18 QTPQQAPVTPRKERRPSMFEKEAYTQILRERLRESIHNVQYVEPPFDDSIADIGKEWKSALAKLKFANSYRMEP--LKKFQAHSVETKVQQILTESLKDVKYDDKVFSHLSLELADRILLAVKEFGYHRYKFIIKVLFIQKTGQAINIASRWIWDI-AWDSWVAAKHEAESYVALVLVFALYYE 198          
BLAST of Tctex1 domain containing 1 vs. Ensembl Human
Match: TCTEX1D2 (Tctex1 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:28482])

HSP 1 Score: 76.2554 bits (186), Expect = 6.128e-17
Identity = 35/117 (29.91%), Postives = 69/117 (58.97%), Query Frame = 3
Query:  351 ENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYF 701
            ENTY + P   ++F    ++  I  VL + L+  +Y  + +P+L+K +++ IK  ++++ ++R+K+V  V IG++ G  V +ASRC W+++  D+     F   S+F +   FG ++
Sbjct:   26 ENTYILRPVFQQRFRPSVVKDCIHAVLKEELANAEYSPEEMPQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDADT-DNYTHDVFMNDSLFCVVAAFGCFY 141          
BLAST of Tctex1 domain containing 1 vs. Ensembl Human
Match: TCTEX1D4 (Tctex1 domain containing 4 [Source:HGNC Symbol;Acc:HGNC:32315])

HSP 1 Score: 60.4622 bits (145), Expect = 1.949e-10
Identity = 35/116 (30.17%), Postives = 61/116 (52.59%), Query Frame = 3
Query:  357 TYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            +YR  P   E++     ++ ++  L+  L    Y S     L + + +++   +R+L   R+KLVC V +G ++G  V + SR LW+    D +A  ++   S+FA+ TV GLY E
Sbjct:  107 SYRTEPVPGERWEAARAQRALEAALAAGLHDACYSSDEAARLVRELCEQVHVRLRELSPPRYKLVCSVVLGPRAGQGVHVVSRALWDVAR-DGLASVSYTNTSLFAVATVHGLYCE 221          
BLAST of Tctex1 domain containing 1 vs. Ensembl Fly
Match: CG5359 (gene:FBgn0037773 transcript:FBtr0306611)

HSP 1 Score: 65.0846 bits (157), Expect = 7.697e-13
Identity = 46/164 (28.05%), Postives = 75/164 (45.73%), Query Frame = 3
Query:  210 IPNNPDRRLSIIRGRRGTLVNIQRSRGSIWSMQNPGKKTLLSLPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRI-KRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLY 698
            +PN  DR+    +   G+L       GS   ++N  K      P      Y + P   E F + TI+ I+ +V+++ L    YD  V  + +  IAD + +++       R+K V  V +G + GA     SRC W+ +    V++  F   S+F + TVFG Y
Sbjct:   19 VPNPADRKSE--KSASGSL-----HSGSADGLENQEKS---EKPGDQPTAYSMRPAFGEMFPLPTIKSIMNNVMAEKLKDKTYDKDVAKKWTSEIADEVNQQIASSSLVKRYKHVVQVMLGQELGAGATYNSRCCWDCDCDTSVSEV-FSNTSLFCVCTVFGTY 171          
BLAST of Tctex1 domain containing 1 vs. Ensembl Fly
Match: CG5359 (gene:FBgn0037773 transcript:FBtr0082215)

HSP 1 Score: 65.0846 bits (157), Expect = 7.697e-13
Identity = 46/164 (28.05%), Postives = 75/164 (45.73%), Query Frame = 3
Query:  210 IPNNPDRRLSIIRGRRGTLVNIQRSRGSIWSMQNPGKKTLLSLPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRI-KRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLY 698
            +PN  DR+    +   G+L       GS   ++N  K      P      Y + P   E F + TI+ I+ +V+++ L    YD  V  + +  IAD + +++       R+K V  V +G + GA     SRC W+ +    V++  F   S+F + TVFG Y
Sbjct:   19 VPNPADRKSE--KSASGSL-----HSGSADGLENQEKS---EKPGDQPTAYSMRPAFGEMFPLPTIKSIMNNVMAEKLKDKTYDKDVAKKWTSEIADEVNQQIASSSLVKRYKHVVQVMLGQELGAGATYNSRCCWDCDCDTSVSEV-FSNTSLFCVCTVFGTY 171          
BLAST of Tctex1 domain containing 1 vs. Ensembl Fly
Match: CG5359 (gene:FBgn0037773 transcript:FBtr0300257)

HSP 1 Score: 65.0846 bits (157), Expect = 7.697e-13
Identity = 46/164 (28.05%), Postives = 75/164 (45.73%), Query Frame = 3
Query:  210 IPNNPDRRLSIIRGRRGTLVNIQRSRGSIWSMQNPGKKTLLSLPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRI-KRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLY 698
            +PN  DR+    +   G+L       GS   ++N  K      P      Y + P   E F + TI+ I+ +V+++ L    YD  V  + +  IAD + +++       R+K V  V +G + GA     SRC W+ +    V++  F   S+F + TVFG Y
Sbjct:   19 VPNPADRKSE--KSASGSL-----HSGSADGLENQEKS---EKPGDQPTAYSMRPAFGEMFPLPTIKSIMNNVMAEKLKDKTYDKDVAKKWTSEIADEVNQQIASSSLVKRYKHVVQVMLGQELGAGATYNSRCCWDCDCDTSVSEV-FSNTSLFCVCTVFGTY 171          
BLAST of Tctex1 domain containing 1 vs. Ensembl Fly
Match: CG7276 (gene:FBgn0036499 transcript:FBtr0075546)

HSP 1 Score: 57.3806 bits (137), Expect = 5.612e-10
Identity = 38/131 (29.01%), Postives = 62/131 (47.33%), Query Frame = 3
Query:  309 NPGKKTLLSLPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYN-RFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLY 698
             PG +   +  +   N Y + P   +KF +  IR +I  V+ + L+   Y+     + ++ +AD I   ++    + RFK V  V +  ++GA     +R +W+ E  DD     FDGGS   I  VFG Y
Sbjct:   40 EPGNEDKPASDVTIYNYYNMGPAFGKKFPLPYIRLMIAQVVKEKLANKTYNQSEALKWTREVADDINIKMKGRGSSPRFKHVVNVMLYQQTGAGCFYGARAIWD-ELSDDYITFTFDGGSFICIAAVFGCY 169          
BLAST of Tctex1 domain containing 1 vs. Ensembl Zebrafish
Match: tctex1d1 (Tctex1 domain containing 1 [Source:NCBI gene;Acc:447884])

HSP 1 Score: 96.6709 bits (239), Expect = 1.658e-24
Identity = 48/135 (35.56%), Postives = 82/135 (60.74%), Query Frame = 3
Query:  303 MQNPGKKTLLSLP-IQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            M+  G    +  P +Q ENTYRI P    +F + T++ +++DVL+  L   KY++++  +++K I + +K  V+DL   R+K++ ++ IG     N+ + SRCLW+ +N D+ +   F   S+FA  TVFG+YFE
Sbjct:   42 MEEHGHHDDIQRPTVQMENTYRITPSR--RFPVLTVKDLLKDVLTSYLQEEKYETELCRQMTKTITEVVKARVKDLMIPRYKIIVVISIGQIKDQNIRMGSRCLWD-DNHDNFSSHIFKNNSLFAAATVFGVYFE 173          
BLAST of Tctex1 domain containing 1 vs. Ensembl Zebrafish
Match: tctex1d1 (Tctex1 domain containing 1 [Source:NCBI gene;Acc:447884])

HSP 1 Score: 96.6709 bits (239), Expect = 1.658e-24
Identity = 48/135 (35.56%), Postives = 82/135 (60.74%), Query Frame = 3
Query:  303 MQNPGKKTLLSLP-IQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            M+  G    +  P +Q ENTYRI P    +F + T++ +++DVL+  L   KY++++  +++K I + +K  V+DL   R+K++ ++ IG     N+ + SRCLW+ +N D+ +   F   S+FA  TVFG+YFE
Sbjct:   42 MEEHGHHDDIQRPTVQMENTYRITPSR--RFPVLTVKDLLKDVLTSYLQEEKYETELCRQMTKTITEVVKARVKDLMIPRYKIIVVISIGQIKDQNIRMGSRCLWD-DNHDNFSSHIFKNNSLFAAATVFGVYFE 173          
BLAST of Tctex1 domain containing 1 vs. Ensembl Zebrafish
Match: tctex1d2 (Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-219])

HSP 1 Score: 90.1225 bits (222), Expect = 2.569e-22
Identity = 44/129 (34.11%), Postives = 76/129 (58.91%), Query Frame = 3
Query:  315 GKKTLLSLPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYF 701
             +K  +SL     NTY I P   +KF     ++ I ++L + L GV+YD + VP LS+ +AD IK  ++D+ ++R+K +  V IG++ G  V +A+RC W+++  D+ AQ  +   S+F +   F +Y+
Sbjct:   22 AQKRDISLMDTGANTYLIRPNYKDKFKAGVAKECIGEILREQLYGVQYDPEEVPTLSRSLADSIKHKLKDMAFDRYKFIVQVVIGEQRGEGVKMAARCFWDADT-DNYAQEIYMNDSLFCVAAAFAVYY 149          
BLAST of Tctex1 domain containing 1 vs. Ensembl Zebrafish
Match: tctex1d2 (Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-219])

HSP 1 Score: 77.7962 bits (190), Expect = 1.879e-17
Identity = 40/110 (36.36%), Postives = 67/110 (60.91%), Query Frame = 3
Query:  315 GKKTLLSLPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQ 644
             +K  +SL     NTY I P   +KF     ++ I ++L + L GV+YD + VP LS+ +AD IK  ++D+ ++R+K +  V IG++ G  V +A+RC W+++  D+ AQ
Sbjct:   22 AQKRDISLMDTGANTYLIRPNYKDKFKAGVAKECIGEILREQLYGVQYDPEEVPTLSRSLADSIKHKLKDMAFDRYKFIVQVVIGEQRGEGVKMAARCFWDADT-DNYAQ 130          
BLAST of Tctex1 domain containing 1 vs. Ensembl Xenopus
Match: coq10b (coenzyme Q10B [Source:Xenbase;Acc:XB-GENE-5784252])

HSP 1 Score: 90.1225 bits (222), Expect = 7.700e-22
Identity = 45/151 (29.80%), Postives = 89/151 (58.94%), Query Frame = 3
Query:  255 RGTLVNIQRSRGSIWSMQNPGKKTLLSLP-IQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            RG+    + S  ++  +  PG    +  P I  ENTY+  P   ++F + ++  I++DVL+  L   KY++++  +++K I++ IK  V+DL   R+K++ +++IG  +  ++ + SRC+W+  N D  +  +F   S+FA+  V+G+Y+E
Sbjct:   30 RGSFSKTKDSVSTVSYIDEPGHHDDIQRPAILMENTYQTGPT--KRFPVASVNNILKDVLTSYLQEEKYEAELCRQMTKTISEVIKARVKDLMIPRYKIIVLIYIGQLNDQSMRVGSRCIWDPAN-DTFSSYSFKNSSLFALANVYGVYYE 177          
BLAST of Tctex1 domain containing 1 vs. Ensembl Xenopus
Match: ENSXETT00000022071.1 (lysophosphatidic acid receptor 6-like [Source:Xenbase;Acc:XB-GENE-5721642])

HSP 1 Score: 79.7221 bits (195), Expect = 1.954e-18
Identity = 38/117 (32.48%), Postives = 70/117 (59.83%), Query Frame = 3
Query:  351 ENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYF 701
            ENTY I P    KF    ++  I+ VL + LS  +Y  + VP+L++ +++ IK  ++D+ ++R+K+V  V IG++ G  V +A+RC W+++  D+ A+  F    +F +   FG ++
Sbjct:    8 ENTYSIRPNFQHKFKSAPVKDCIRSVLKEELSDKQYVPEEVPQLTRFLSETIKDRLKDMGFDRYKMVVQVVIGEQRGEGVKMAARCFWDADT-DNYAEDVFMNEYLFCVVAAFGCFY 123          
BLAST of Tctex1 domain containing 1 vs. Ensembl Xenopus
Match: txnrd2 (thioredoxin reductase 2 [Source:Xenbase;Acc:XB-GENE-5767949])

HSP 1 Score: 70.8626 bits (172), Expect = 1.948e-14
Identity = 29/107 (27.10%), Postives = 61/107 (57.01%), Query Frame = 3
Query:  384 EKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            EK  +  ++Q+++  L + L  + Y+    P L K +++ +K  V+ +   R+K +C+V +G++   ++ + SRCLW+S +   VA   ++  S+F +  V+ +Y E
Sbjct:   92 EKIQVTAMKQVLESYLPERLGTITYNPASAPSLVKEVSEEVKGRVKRVLPTRYKALCVVTLGERGQEDIAVVSRCLWDSHSDSYVAHV-YENSSLFCVVAVYAVYCE 197          
BLAST of Tctex1 domain containing 1 vs. Ensembl Xenopus
Match: ENSXETT00000044463.1 (tctex1 domain-containing protein 1-like [Source:NCBI gene;Acc:100498184])

HSP 1 Score: 69.707 bits (169), Expect = 7.453e-14
Identity = 31/107 (28.97%), Postives = 61/107 (57.01%), Query Frame = 3
Query:  384 EKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
             +F    ++++I++ L+  L    YD      L+K + + IK++VR +   R+KL+C + IG K   ++ + S+CLW+S   D+V   ++   ++F +  V+ +YFE
Sbjct:  117 HRFPNAHVKELIEEFLATKLKNESYDPSTCAALTKDLCEDIKKIVRRVTPPRYKLICSMAIGSKDREDIMVTSQCLWDS-YSDNVTSCSYQNRTLFCVVLVYAVYFE 222          
BLAST of Tctex1 domain containing 1 vs. Ensembl Xenopus
Match: ENSXETT00000021739.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:98753466:98754165:-1 gene:ENSXETG00000011363.1 transcript:ENSXETT00000021739.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 4.054e-11
Identity = 31/105 (29.52%), Postives = 55/105 (52.38%), Query Frame = 3
Query:  390 FTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            F+ + + ++I+ +L   L   +YD+    + +  +   +K  V+ L Y R+KLVC + +G  S   +C  SR +W S   D  A+  F   S+FA+  V+  Y+E
Sbjct:   28 FSAEEVSKLIKSILEKQLQDSEYDATGSQQRALELVQLVKEAVKSLGYERYKLVCYIVLGPVSQGALCCCSRSVW-SPTSDTYAEFVFRNQSLFALCIVYAGYYE 131          
BLAST of Tctex1 domain containing 1 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 95.1301 bits (235), Expect = 7.186e-24
Identity = 53/165 (32.12%), Postives = 92/165 (55.76%), Query Frame = 3
Query:  213 PNNPDRRLSIIRGRRGTLVNIQRSRGSIWSMQNPGKKTLLS-LPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            PNN +      R + G    I+ S  ++     P ++   S L ++ ENTY++ P   + F + T+  I++DVL+  L   +YD +   +++K I++ IK  V++L   R+KL+ IV+IG +   ++ I SRCLWN ++ D V+   F   + FA+  V+ +YFE
Sbjct:   22 PNNRE-----FRQKEGHW-RIKHSLSTVSHADEPSQRDESSRLTVRMENTYQLGPT--KPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKS-DTVSSYTFKNSTFFALANVYAVYFE 177          
BLAST of Tctex1 domain containing 1 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 94.3597 bits (233), Expect = 1.615e-23
Identity = 44/123 (35.77%), Postives = 76/123 (61.79%), Query Frame = 3
Query:  336 LPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            L ++ ENTY++ P   + F + T+  I++DVL+  L   +YD +   +++K I++ IK  V++L   R+KL+ IV+IG +   ++ I SRCLWN ++ D V+   F   + FA+  V+ +YFE
Sbjct:   54 LTVRMENTYQLGPT--KPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKS-DTVSSYTFKNSTFFALANVYAVYFE 173          
BLAST of Tctex1 domain containing 1 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 94.3597 bits (233), Expect = 1.615e-23
Identity = 44/123 (35.77%), Postives = 76/123 (61.79%), Query Frame = 3
Query:  336 LPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            L ++ ENTY++ P   + F + T+  I++DVL+  L   +YD +   +++K I++ IK  V++L   R+KL+ IV+IG +   ++ I SRCLWN ++ D V+   F   + FA+  V+ +YFE
Sbjct:   54 LTVRMENTYQLGPT--KPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKS-DTVSSYTFKNSTFFALANVYAVYFE 173          
BLAST of Tctex1 domain containing 1 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 94.3597 bits (233), Expect = 1.615e-23
Identity = 44/123 (35.77%), Postives = 76/123 (61.79%), Query Frame = 3
Query:  336 LPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            L ++ ENTY++ P   + F + T+  I++DVL+  L   +YD +   +++K I++ IK  V++L   R+KL+ IV+IG +   ++ I SRCLWN ++ D V+   F   + FA+  V+ +YFE
Sbjct:   54 LTVRMENTYQLGPT--KPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKS-DTVSSYTFKNSTFFALANVYAVYFE 173          
BLAST of Tctex1 domain containing 1 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 91.6633 bits (226), Expect = 3.717e-23
Identity = 43/118 (36.44%), Postives = 72/118 (61.02%), Query Frame = 3
Query:  351 ENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            ENTY++ P   + F + T+  I++DVL+  L   +YD +   +++K I++ IK  V++L   R+KL+ IV+IG +   ++ I SRCLWN +  D V+   F   + FA+  V+ +YFE
Sbjct:    2 ENTYQLGPT--KPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPK-SDTVSSYTFKNSTFFALANVYAVYFE 116          
BLAST of Tctex1 domain containing 1 vs. UniProt/SwissProt
Match: sp|Q66IC8|TC1D1_DANRE (Tctex1 domain-containing protein 1 OS=Danio rerio OX=7955 GN=tctex1d1 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.252e-23
Identity = 48/135 (35.56%), Postives = 82/135 (60.74%), Query Frame = 3
Query:  303 MQNPGKKTLLSLP-IQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            M+  G    +  P +Q ENTYRI P    +F + T++ +++DVL+  L   KY++++  +++K I + +K  V+DL   R+K++ ++ IG     N+ + SRCLW+ +N D+ +   F   S+FA  TVFG+YFE
Sbjct:   42 MEEHGHHDDIQRPTVQMENTYRITPSR--RFPVLTVKDLLKDVLTSYLQEEKYETELCRQMTKTITEVVKARVKDLMIPRYKIIVVISIGQIKDQNIRMGSRCLWD-DNHDNFSSHIFKNNSLFAAATVFGVYFE 173          
BLAST of Tctex1 domain containing 1 vs. UniProt/SwissProt
Match: sp|Q9D5I4|TC1D1_MOUSE (Tctex1 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tctex1d1 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.130e-22
Identity = 44/123 (35.77%), Postives = 76/123 (61.79%), Query Frame = 3
Query:  336 LPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            L ++ ENTY++ P   + F + T+  I++DVL+  L   +YD +   +++K I++ IK  V++L   R+KL+ IV+IG +   ++ I SRCLWN ++ D V+   F   + FA+  V+ +YFE
Sbjct:   54 LTVRMENTYQLGPT--KPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKS-DTVSSYTFKNSTFFALANVYAVYFE 173          
BLAST of Tctex1 domain containing 1 vs. UniProt/SwissProt
Match: sp|Q3B8D7|TC1DA_XENLA (Tctex1 domain-containing protein 1-A OS=Xenopus laevis OX=8355 GN=tctex1d1-a PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 5.517e-22
Identity = 46/151 (30.46%), Postives = 90/151 (59.60%), Query Frame = 3
Query:  255 RGTLVNIQRSRGSIWSMQNPGKKTLLSLP-IQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            RG+    + S  ++  +  PG    +  P I  ENTY+I P   ++F + ++  I++DVL+  L   KY++++  +++K I++ IK  V+DL   R+K++ +++IG  +  ++ + SRC+W+  N D  +  +F   S+FA+  V+G+Y+E
Sbjct:   30 RGSFSKTKDSVSTVSYIDEPGHHDEIQSPAILMENTYQIGPA--KRFPVASVNNILKDVLTSYLQEEKYEAELCRQMTKTISEVIKARVKDLMIPRYKIIVLIYIGQLNDQSMRVGSRCIWDPAN-DTFSSYSFKNSSLFALANVYGVYYE 177          
BLAST of Tctex1 domain containing 1 vs. UniProt/SwissProt
Match: sp|Q8N7M0|TC1D1_HUMAN (Tctex1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TCTEX1D1 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 2.992e-21
Identity = 48/145 (33.10%), Postives = 87/145 (60.00%), Query Frame = 3
Query:  273 IQRSRGSIWSMQNPGKKTLLS-LPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            I+ S  ++  M+ P ++  +S L +Q ENTY++ P  H  F + T+  I++DV++  L   +Y+ ++  +++K I++ IK  V+DL   R+KL+ IV IG  +  ++ I SRCLW+ ++ D  +   F   S+FA+  V+ +Y E
Sbjct:   38 IKDSMSTVSYMEEPSQRDDISRLTVQMENTYQLGPPKH--FPVVTVNHILKDVVTSYLQVEEYEPELCRQMTKTISEVIKAQVKDLMIPRYKLIVIVHIGQLNRQSILIGSRCLWDPKS-DTFSSYVFRNSSLFALANVYAVYLE 179          
BLAST of Tctex1 domain containing 1 vs. UniProt/SwissProt
Match: sp|A2VDD2|TC1DB_XENLA (Tctex1 domain-containing protein 1-B (Fragment) OS=Xenopus laevis OX=8355 GN=tctex1d1-b PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 4.025e-21
Identity = 45/151 (29.80%), Postives = 89/151 (58.94%), Query Frame = 3
Query:  255 RGTLVNIQRSRGSIWSMQNPGKKTLLSLP-IQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            RG+    + S  ++  +  PG    +  P I  ENTY++ P   ++F + ++  I++DVL+  L   KY++++  +++K I++ IK  V+DL   R+K++ +++IG  +   + + SRC+W+  N D  +  +F   S+FA+  V+G+Y+E
Sbjct:   29 RGSFSKTKDSVSTVSYIDEPGHHDDIQRPAILVENTYQMGPT--KRFPVASVNNILKDVLTSYLQEEKYEAELCRQMTKTISEVIKARVKDLMIPRYKIIVLIYIGQLNDQGMRVGSRCIWDPAN-DTFSSYSFKNSSLFALANVYGVYYE 176          
BLAST of Tctex1 domain containing 1 vs. TrEMBL
Match: K1QEM9 (Tctex1 domain-containing protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10007786 PE=4 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 5.389e-30
Identity = 65/154 (42.21%), Postives = 94/154 (61.04%), Query Frame = 3
Query:  243 IRGRRGTLVNIQRSRGSIWSMQNPGKKTLLSLPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            + GRR +    Q SR +  S  + G K  + +P++ +NTYR+ PE+ EKF    + +I++ VL   L G  Y+ K+   L++ ++D IK  V+DL + R+KLVC V IG+ S   V + SRCLWNS+  D+ AQA F  G +FAI TVF  YFE
Sbjct:   60 LSGRRPS----QASRRTSISGTSQGTKHHV-IPVRLQNTYRMHPESKEKFNAGPVEKIMKSVLESYLEGEVYEHKMCANLAQNLSDVIKSRVKDLGFPRYKLVCNVLIGENSSQAVMMTSRCLWNSDT-DNFAQARFSKGKLFAIATVFATYFE 207          
BLAST of Tctex1 domain containing 1 vs. TrEMBL
Match: A0A210PWJ1 (Tctex1 domain-containing protein 1-B OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09226 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 2.666e-28
Identity = 65/161 (40.37%), Postives = 94/161 (58.39%), Query Frame = 3
Query:  222 PDRRLSIIRGRRGTLVNIQRSRGSIWSMQNPGKKTLLSLPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            PD RLS+  G  G   + Q SR SI     P     + +PI+ +NTYR+ P   EKF    +  I+ +VL   L G KYD K+   L++ + D IK  V++L Y R+KLVC V IG+ S   + +ASRCLW+ ++ D  AQA++  G I+A+ TV+  YF+
Sbjct:   48 PDHRLSVQYGYTGRRPS-QVSRTSISGSVGPKH---IGIPIKLQNTYRLEPLPKEKFDPSKVNTIMYNVLESYLDGEKYDPKMCSNLAQNLTDVIKNRVKELGYVRYKLVCNVIIGENSAQGMRVASRCLWD-DSTDSYAQASYSKGQIYAVATVYATYFD 203          
BLAST of Tctex1 domain containing 1 vs. TrEMBL
Match: C3YMC3 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_210165 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 1.319e-25
Identity = 53/150 (35.33%), Postives = 90/150 (60.00%), Query Frame = 3
Query:  255 RGTLVNIQRSRGSIWSMQNPGKKTLLSLPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            RG+      S  ++  M  P     L  P++ ENTY++ P   ++F + T+R I+QDVL + L   KY+ ++  +++K I++ IK  V+DL   R+K++C++ IG  +   + I SRCLW+  N D  A  +F  GS++A+ TV+G+Y+E
Sbjct:   36 RGSFRKQTVSISTVSFMDEPSHTDELHPPVKLENTYQMSP--LKRFPVSTVRHILQDVLQNYLQEEKYEPELCRQMTKTISEVIKARVKDLMVPRYKIICLIHIGQLNNQGLRIGSRCLWDP-NNDTFATQDFQNGSLYAVATVYGVYYE 182          
BLAST of Tctex1 domain containing 1 vs. TrEMBL
Match: A0A2C9JUM9 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106068962 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 1.901e-25
Identity = 55/155 (35.48%), Postives = 90/155 (58.06%), Query Frame = 3
Query:  243 IRGRRGTLVNIQRSRGSIWSMQNPGKKTLLSLPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYN-RFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            + GRR + V+     G+   +++        +P+QY+NTYR+ P  +EKF     +Q++++VL   LS  KY++++   +   I+D IK  V+ L ++ R+K VC+V IG      V +ASRC+WN E  D+ A A+F  G +FA+  +F  YFE
Sbjct:   50 MSGRRMSYVSRSSISGASLGLKD------FKVPVQYQNTYRLGPSGNEKFQPSKAQQVMKEVLQSYLSSEKYNTEICGNIVGQISDVIKGRVKSLGFSPRYKFVCVVTIGQHRNQGVAVASRCVWNPET-DNFATASFKSGDLFAVANIFATYFE 197          
BLAST of Tctex1 domain containing 1 vs. TrEMBL
Match: A7T530 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g146279 PE=4 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 1.364e-24
Identity = 55/121 (45.45%), Postives = 76/121 (62.81%), Query Frame = 3
Query:  342 IQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            I+Y N+YR  PE  +KF +K +  II  VLS+ L  VKY ++    LS  +A+ IK  V+ L Y R+K++C+V IG   G +V +ASRCLW+ EN D  A  +F   S+FA  TVFG+Y E
Sbjct:   12 IKYCNSYRTTPEESKKFRVKPVSDIINKVLSERLGQVKYSAERSRVLSVPLAEEIKSHVKRLGYQRYKIICVVHIGSLDGQDVRVASRCLWD-ENQDRAASGSFCNESLFASATVFGVYHE 131          
BLAST of Tctex1 domain containing 1 vs. Ensembl Cavefish
Match: tctex1d1 (Tctex1 domain containing 1 [Source:NCBI gene;Acc:103044040])

HSP 1 Score: 102.834 bits (255), Expect = 8.161e-27
Identity = 50/151 (33.11%), Postives = 96/151 (63.58%), Query Frame = 3
Query:  255 RGTLVNIQRSRGSIWSMQNPGKKTLLSLP-IQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            +  L+  + S  ++  M +PG    +S P +Q ENTY++ P+  ++F ++T+++I++DVLS  L  VKY++++  +++K I++ +K  V+D+   R+K++ ++ IG  +G N+ + SRCLW++   D     +F   S+FAI  V+ +YFE
Sbjct:   30 KNLLLKNKDSISTVSYMDDPGHHDDVSRPAVQMENTYQLGPK--KRFPVQTVKEILKDVLSSYLLEVKYEAELCRQMTKTISEVVKARVKDMMIPRYKIIVVISIGQLTGQNMHVGSRCLWDA-TSDTFCSNSFKNSSLFAIANVYAVYFE 177          
BLAST of Tctex1 domain containing 1 vs. Ensembl Cavefish
Match: tctex1d2 (Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-219])

HSP 1 Score: 65.4698 bits (158), Expect = 3.635e-13
Identity = 33/104 (31.73%), Postives = 61/104 (58.65%), Query Frame = 3
Query:  387 KFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLY 698
            +F    +   I++++ + L G  YDS+   E ++ ++ RI   +++L  +R+KLV  V IG++ G  V +ASRC W+++  D  A+  +   S+F +  VFG+Y
Sbjct:   41 RFRPAVVSSCIRELVREQLGGESYDSERSAETAQTLSKRITDRLKELGLDRYKLVVQVVIGEQRGEGVQMASRCFWDADT-DSCAKDVYMNDSLFCVAAVFGIY 143          
BLAST of Tctex1 domain containing 1 vs. Ensembl Cavefish
Match: tctex1d2 (Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-219])

HSP 1 Score: 59.6918 bits (143), Expect = 2.588e-11
Identity = 27/89 (30.34%), Postives = 51/89 (57.30%), Query Frame = 3
Query:  360 YRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSEN 626
            + I P    +F    +   I++++ + L G  YDS+   E ++ ++ RI   +++L  +R+KLV  V IG++ G  V +ASRC W+++ 
Sbjct:    8 HSIRPTQQHRFRPAVVSSCIRELVREQLGGESYDSERSAETAQTLSKRITDRLKELGLDRYKLVVQVVIGEQRGEGVQMASRCFWDADT 96          
BLAST of Tctex1 domain containing 1 vs. Ensembl Cavefish
Match: ENSAMXT00000038759.1 (tctex1 domain-containing protein 1-A-like [Source:NCBI gene;Acc:103036543])

HSP 1 Score: 59.3066 bits (142), Expect = 1.910e-10
Identity = 35/132 (26.52%), Postives = 63/132 (47.73%), Query Frame = 3
Query:  312 PGKKTLLSLPIQYE-NTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            P   +L   P Q E   Y+  P  H +F  + +R +++ ++   L   +Y S+    +++ ++D IK   + L Y R+KL+  V IG    + V  +SR +W     D   +  F    +FA+  +F +Y E
Sbjct:   71 PWTSSLTVYPGQSEWQEYQTAP--HRRFPREQVRSVMKSIVEARLGEAQYTSRCS-AVARKLSDSIKEAAKSLSYERYKLISYVAIGQLRDSEVTCSSRGVW-CPAADTFTEYTFKNDHLFALCVLFAVYQE 198          
BLAST of Tctex1 domain containing 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008035.1 (pep scaffold:Pmarinus_7.0:GL476353:419801:420827:1 gene:ENSPMAG00000007269.1 transcript:ENSPMAT00000008035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 6.719e-13
Identity = 30/106 (28.30%), Postives = 58/106 (54.72%), Query Frame = 3
Query:  390 FTMKTIRQIIQDVLSDCL-SGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            F ++ + +++++ L+  L  G   D+     L+ L+++ IK   ++    R+KL+  V +G      V +ASRCLW+    D  A  ++  G+ F + T+FG+Y+E
Sbjct:    1 FPVERLERLLEETLTRHLGEGEALDAAACARLAPLLSEEIKARAKEQTPTRYKLIVSVTLGSWEREQVVVASRCLWDP-AADAFASHHYRRGARFCVATIFGVYYE 105          
BLAST of Tctex1 domain containing 1 vs. Ensembl Nematostella
Match: EDO28932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T530])

HSP 1 Score: 104.375 bits (259), Expect = 1.887e-28
Identity = 55/121 (45.45%), Postives = 76/121 (62.81%), Query Frame = 3
Query:  342 IQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            I+Y N+YR  PE  +KF +K +  II  VLS+ L  VKY ++    LS  +A+ IK  V+ L Y R+K++C+V IG   G +V +ASRCLW+ EN D  A  +F   S+FA  TVFG+Y E
Sbjct:   12 IKYCNSYRTTPEESKKFRVKPVSDIINKVLSERLGQVKYSAERSRVLSVPLAEEIKSHVKRLGYQRYKIICVVHIGSLDGQDVRVASRCLWD-ENQDRAASGSFCNESLFASATVFGVYHE 131          
BLAST of Tctex1 domain containing 1 vs. Ensembl Nematostella
Match: EDO46891 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNP6])

HSP 1 Score: 104.375 bits (259), Expect = 2.215e-28
Identity = 55/120 (45.83%), Postives = 75/120 (62.50%), Query Frame = 3
Query:  345 QYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            +Y NTYR  PE  +KF +K +  II  VLS+ L  VKY ++    LS  +A+ IK  V+ L Y R+K++C+V IG   G +V +ASRCLW+ EN D  A  +F   S+FA  TVFG+Y E
Sbjct:   13 KYCNTYRTTPEESKKFRVKPVSDIINKVLSERLGQVKYSAERSRVLSVPLAEEIKSHVKRLGYQRYKIICVVHIGSLDGQDVRVASRCLWD-ENQDRAASGSFCNESLFASATVFGVYHE 131          
BLAST of Tctex1 domain containing 1 vs. Ensembl Nematostella
Match: EDO44328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW04])

HSP 1 Score: 98.2117 bits (243), Expect = 3.329e-26
Identity = 53/123 (43.09%), Postives = 78/123 (63.41%), Query Frame = 3
Query:  339 PIQ-YENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            PIQ  ENTY++ P+    F    ++QII + L + L+  KY       +S+L++ R+   V+ L   R+KLVC+V IG KS   + +ASRCLW+SE  D  A A+ + GS+FA+GTV+G+YFE
Sbjct:    1 PIQKLENTYQVEPKR--VFPTGEVKQIIHNTLQNALAESKYKEMNSSFVSQLLSQRVLDQVKSLDVQRYKLVCLVSIGSKSDQGMRVASRCLWHSE-FDRFASASVENGSLFAVGTVYGVYFE 120          
BLAST of Tctex1 domain containing 1 vs. Ensembl Nematostella
Match: EDO29797 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW04])

HSP 1 Score: 98.2117 bits (243), Expect = 3.329e-26
Identity = 53/123 (43.09%), Postives = 78/123 (63.41%), Query Frame = 3
Query:  339 PIQ-YENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            PIQ  ENTY++ P+    F    ++QII + L + L+  KY       +S+L++ R+   V+ L   R+KLVC+V IG KS   + +ASRCLW+SE  D  A A+ + GS+FA+GTV+G+YFE
Sbjct:    1 PIQKLENTYQVEPKR--VFPTGEVKQIIHNTLQNALAESKYKEMNSSFVSQLLSQRVLDQVKSLDVQRYKLVCLVSIGSKSDQGMRVASRCLWHSE-FDRFASASVENGSLFAVGTVYGVYFE 120          
BLAST of Tctex1 domain containing 1 vs. Ensembl Nematostella
Match: EDO45313 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT02])

HSP 1 Score: 93.2041 bits (230), Expect = 2.493e-24
Identity = 42/118 (35.59%), Postives = 76/118 (64.41%), Query Frame = 3
Query:  351 ENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            +NTYR+ P N  +F+ K ++ II++   + L+   Y+++    ++  +++ IK+ V+ L + R+KL+CIV+IG      + I SRCLWN+ N D+V + ++  G++FA+ TVFG + E
Sbjct:    1 KNTYRMEPSN--RFSHKKVKDIIEEAFQEHLNEHSYEAEFCKHMTTKLSELIKQRVKHLGFTRYKLICIVYIGQVMNQGMRIGSRCLWNT-NFDNVVEGSYRNGNLFAVATVFGAFVE 115          
BLAST of Tctex1 domain containing 1 vs. Ensembl Medaka
Match: tctex1d2 (Tctex1 domain containing 2 [Source:NCBI gene;Acc:101160473])

HSP 1 Score: 67.0106 bits (162), Expect = 9.125e-14
Identity = 32/108 (29.63%), Postives = 64/108 (59.26%), Query Frame = 3
Query:  378 NHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYF 701
            +  +F    +++ + +++ + LSGVKY+ + +PE    +AD I+  V+ L  +++K++  V IG++ G  V + SR  W+++  D+ A+  F   S+F +  VFG Y+
Sbjct:   36 SFSRFKPAIVKEFVHEIVRERLSGVKYEPEKIPETCSSLADCIRDKVKSLGIDKYKIIVQVMIGEQRGQGVKMCSRFFWDADT-DNYAEDVFMNDSLFCVAAVFGCYY 142          
BLAST of Tctex1 domain containing 1 vs. Planmine SMEST
Match: SMESG000021852.1 (SMESG000021852.1)

HSP 1 Score: 373.244 bits (957), Expect = 3.905e-133
Identity = 181/183 (98.91%), Postives = 182/183 (99.45%), Query Frame = 3
Query:  156 MSIETKRASIIEFEIPKLIPNNPDRRLSIIRGRRGTLVNIQRSRGSIWSMQNPGKKTLLSLPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            MSIETKRASIIEFEIPKLIPNNPDRRLSIIRGRRGTLVNIQRSRGSIWSMQNPGKKTLLSLPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIV IGDKSGANVCIASRCLWNSENGDDVAQA+FDGGSIFAIGTVFGLYFE
Sbjct:    1 MSIETKRASIIEFEIPKLIPNNPDRRLSIIRGRRGTLVNIQRSRGSIWSMQNPGKKTLLSLPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVLIGDKSGANVCIASRCLWNSENGDDVAQASFDGGSIFAIGTVFGLYFE 183          
BLAST of Tctex1 domain containing 1 vs. Planmine SMEST
Match: SMESG000018052.1 (SMESG000018052.1)

HSP 1 Score: 110.923 bits (276), Expect = 4.659e-30
Identity = 55/163 (33.74%), Postives = 98/163 (60.12%), Query Frame = 3
Query:  228 RRLSIIRGRRGTLVNIQRS----RGSIWSMQNPGKKTLLSLPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            RR S+++ RR TLV  ++S    + ++W++    +K +    IQYENTYR+  +  E F    ++ I+ D L   L   KYD     E+++++ ++IK  +++L   R+K V IV +G+K+   +C  SR LWN ++GD  ++ ++   +I+AI TV+G+Y+E
Sbjct:   20 RRASLLKWRRSTLVGPRKSIYMNQPNLWNLD---RKIMPQ--IQYENTYRMDADPKETFLSHKVKSILTDELKRVLHDYKYDPNSANEMTRILTEKIKFKMKELPSVRYKFVVIVVLGNKNSGAICYGSRALWNDKSGDTFSEVSYTNDNIYAIATVYGIYYE 177          
BLAST of Tctex1 domain containing 1 vs. Planmine SMEST
Match: SMESG000017994.1 (SMESG000017994.1)

HSP 1 Score: 108.612 bits (270), Expect = 3.049e-29
Identity = 55/163 (33.74%), Postives = 96/163 (58.90%), Query Frame = 3
Query:  228 RRLSIIRGRRGTLVNIQRS----RGSIWSMQNPGKKTLLSLPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            RR S+++ RR TLV  ++S    + ++W++    +K +    IQYENTYR+     E F     + I+ D L   L   KYD     E+++++ ++IK  +++L   R+K V IV +G+K+   +C  SR LWN ++GD  ++ ++   +I+AI TV+G+Y+E
Sbjct:   20 RRASLLKWRRSTLVGPRKSIYMNQPNLWNLD---RKIMPQ--IQYENTYRMDANPKETFLSHKAKSILTDELKRVLHNYKYDPNNANEMTRILTEKIKFKMKELPSVRYKFVVIVVLGNKNSGAICYGSRALWNDKSGDTFSEVSYTNDNIYAIATVYGIYYE 177          
BLAST of Tctex1 domain containing 1 vs. Planmine SMEST
Match: SMESG000040148.1 (SMESG000040148.1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.719e-19
Identity = 44/147 (29.93%), Postives = 84/147 (57.14%), Query Frame = 3
Query:  264 LVNIQRSRGSIWSMQNPGKKTLLSLPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            L N ++S  S+  +  P   +  +  ++ ENTY++ P+  +KF ++ I  I +DV+   L+  +Y+ +    +SK I++ ++  +++L   R+K+V I+ +G++        SRCLW+  + D  A   F  GS+FA+ T+FG+Y E
Sbjct:   46 LANRKQSISSVCHIDQPNPASRPT--VRVENTYQLGPD--QKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDP-SIDSFACYEFKNGSLFAVATIFGIYQE 187          
BLAST of Tctex1 domain containing 1 vs. Planmine SMEST
Match: SMESG000040148.1 (SMESG000040148.1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.264e-19
Identity = 45/140 (32.14%), Postives = 82/140 (58.57%), Query Frame = 3
Query:  288 GSIWSMQNPGKKTLLSLP-IQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASRCLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE 704
            GSI S+ +  +    S P ++ ENTY++ P+  +KF ++ I  I +DV+   L+  +Y+ +    +SK I++ ++  +++L   R+K+V I+ +G++        SRCLW+  + D  A   F  GS+FA+ T+FG+Y E
Sbjct:   39 GSISSVCHIDQPNPASRPTVRVENTYQLGPD--QKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDP-SIDSFACYEFKNGSLFAVATIFGIYQE 175          
The following BLAST results are available for this feature:
BLAST of Tctex1 domain containing 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TCTEX1D16.230e-2233.10Tctex1 domain containing 1 [Source:HGNC Symbol;Acc... [more]
TCTE32.392e-1930.98t-complex-associated-testis-expressed 3 [Source:HG... [more]
TCTE32.392e-1930.98t-complex-associated-testis-expressed 3 [Source:HG... [more]
TCTEX1D26.128e-1729.91Tctex1 domain containing 2 [Source:HGNC Symbol;Acc... [more]
TCTEX1D41.949e-1030.17Tctex1 domain containing 4 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Tctex1 domain containing 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tctex1 domain containing 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG53597.697e-1328.05gene:FBgn0037773 transcript:FBtr0306611[more]
CG53597.697e-1328.05gene:FBgn0037773 transcript:FBtr0082215[more]
CG53597.697e-1328.05gene:FBgn0037773 transcript:FBtr0300257[more]
CG72765.612e-1029.01gene:FBgn0036499 transcript:FBtr0075546[more]
back to top
BLAST of Tctex1 domain containing 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tctex1d11.658e-2435.56Tctex1 domain containing 1 [Source:NCBI gene;Acc:4... [more]
tctex1d11.658e-2435.56Tctex1 domain containing 1 [Source:NCBI gene;Acc:4... [more]
tctex1d22.569e-2234.11Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GE... [more]
tctex1d21.879e-1736.36Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Tctex1 domain containing 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
coq10b7.700e-2229.80coenzyme Q10B [Source:Xenbase;Acc:XB-GENE-5784252][more]
ENSXETT00000022071.11.954e-1832.48lysophosphatidic acid receptor 6-like [Source:Xenb... [more]
txnrd21.948e-1427.10thioredoxin reductase 2 [Source:Xenbase;Acc:XB-GEN... [more]
ENSXETT00000044463.17.453e-1428.97tctex1 domain-containing protein 1-like [Source:NC... [more]
ENSXETT00000021739.14.054e-1129.52pep primary_assembly:Xenopus_tropicalis_v9.1:4:987... [more]
back to top
BLAST of Tctex1 domain containing 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tctex1d17.186e-2432.12Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d11.615e-2335.77Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d11.615e-2335.77Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d11.615e-2335.77Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d13.717e-2336.44Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Tctex1 domain containing 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q66IC8|TC1D1_DANRE1.252e-2335.56Tctex1 domain-containing protein 1 OS=Danio rerio ... [more]
sp|Q9D5I4|TC1D1_MOUSE1.130e-2235.77Tctex1 domain-containing protein 1 OS=Mus musculus... [more]
sp|Q3B8D7|TC1DA_XENLA5.517e-2230.46Tctex1 domain-containing protein 1-A OS=Xenopus la... [more]
sp|Q8N7M0|TC1D1_HUMAN2.992e-2133.10Tctex1 domain-containing protein 1 OS=Homo sapiens... [more]
sp|A2VDD2|TC1DB_XENLA4.025e-2129.80Tctex1 domain-containing protein 1-B (Fragment) OS... [more]
back to top
BLAST of Tctex1 domain containing 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QEM95.389e-3042.21Tctex1 domain-containing protein 1 OS=Crassostrea ... [more]
A0A210PWJ12.666e-2840.37Tctex1 domain-containing protein 1-B OS=Mizuhopect... [more]
C3YMC31.319e-2535.33Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A2C9JUM91.901e-2535.48Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A7T5301.364e-2445.45Predicted protein OS=Nematostella vectensis OX=453... [more]
back to top
BLAST of Tctex1 domain containing 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tctex1d18.161e-2733.11Tctex1 domain containing 1 [Source:NCBI gene;Acc:1... [more]
tctex1d23.635e-1331.73Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GE... [more]
tctex1d22.588e-1130.34Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GE... [more]
ENSAMXT00000038759.11.910e-1026.52tctex1 domain-containing protein 1-A-like [Source:... [more]
back to top
BLAST of Tctex1 domain containing 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008035.16.719e-1328.30pep scaffold:Pmarinus_7.0:GL476353:419801:420827:1... [more]
back to top
BLAST of Tctex1 domain containing 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tctex1 domain containing 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO289321.887e-2845.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468912.215e-2845.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443283.329e-2643.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297973.329e-2643.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453132.493e-2435.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tctex1 domain containing 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tctex1d29.125e-1429.63Tctex1 domain containing 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Tctex1 domain containing 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021852.13.905e-13398.91SMESG000021852.1[more]
SMESG000018052.14.659e-3033.74SMESG000018052.1[more]
SMESG000017994.13.049e-2933.74SMESG000017994.1[more]
SMESG000040148.11.719e-1929.93SMESG000040148.1[more]
SMESG000040148.12.264e-1932.14SMESG000040148.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003981 ID=SMED30003981|Name=Tctex1 domain containing 1|organism=Schmidtea mediterranea sexual|type=transcript|length=735bp
TGCTATCTGATGGCATTGTTGAAATTTTCCCATCATTCATTACTGGTAAA
TCAAATATCACAAAAATAAACACACTGAACAAAAAAAATCTCATTTAAGT
ATTGTTAGTGTTCAAAGAAGAAACAATTTCATAATACACAGTTTCCAACG
GTGCCATGTCAATTGAAACCAAACGAGCAAGCATTATAGAGTTTGAAATT
CCCAAACTGATTCCTAACAATCCAGACAGGCGCCTGTCAATCATTCGAGG
TCGCCGAGGAACTTTGGTTAATATTCAGAGGTCTCGTGGAAGTATTTGGA
GTATGCAAAATCCCGGTAAAAAGACTTTACTATCTCTTCCGATTCAATAC
GAGAACACTTATAGAATTATGCCGGAAAATCATGAAAAATTCACGATGAA
AACCATTCGACAGATAATTCAGGATGTTTTAAGCGATTGTTTGTCTGGAG
TGAAATACGATAGCAAAGTTGTTCCGGAGCTGAGCAAATTGATTGCGGAT
CGAATCAAGAGACTCGTTCGAGATTTGTGTTACAATAGGTTTAAATTAGT
TTGCATTGTATTCATCGGTGATAAATCTGGAGCGAATGTTTGCATTGCAA
GTCGATGTCTTTGGAATTCTGAAAATGGAGATGATGTTGCCCAAGCCAAC
TTTGACGGAGGTTCAATCTTTGCAATTGGAACTGTATTTGGATTGTATTT
TGAGTAATTATATGATGTAAGAAGCGTTTGTCCAC
back to top

protein sequence of SMED30003981-orf-1

>SMED30003981-orf-1 ID=SMED30003981-orf-1|Name=SMED30003981-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=184bp
MSIETKRASIIEFEIPKLIPNNPDRRLSIIRGRRGTLVNIQRSRGSIWSM
QNPGKKTLLSLPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVK
YDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVFIGDKSGANVCIASR
CLWNSENGDDVAQANFDGGSIFAIGTVFGLYFE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0060271cilium morphogenesis
GO:0008150biological_process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR038586Tctex-1-like_sf
IPR005334Tctex-1-like
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038586Tctex-1-like superfamilyGENE3DG3DSA:3.30.1140.40coord: 82..181
e-value: 1.6E-17
score: 65.2
IPR005334Dynein light chain Tctex-1 likePFAMPF03645Tctex-1coord: 84..181
e-value: 7.2E-20
score: 71.1
IPR005334Dynein light chain Tctex-1 likePANTHERPTHR21255T-COMPLEX-ASSOCIATED-TESTIS-EXPRESSED 1/ DYNEIN LIGHT CHAINcoord: 50..183
NoneNo IPR availablePANTHERPTHR21255:SF44TCTEX1 DOMAIN-CONTAINING PROTEIN 1coord: 50..183