Ceramide synthase 5

Overview
NameCeramide synthase 5
Smed IDSMED30003975
Length (bp)1188
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ceramide synthase 5 (SMED30003975) t-SNE clustered cells

Violin plots show distribution of expression levels for Ceramide synthase 5 (SMED30003975) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ceramide synthase 5 (SMED30003975) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ceramide synthase 5 (SMED30003975) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003975

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30003975SMESG000039123.1 SmedASXL_003115SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30003975SMESG000060101.1 SMESG000039123.1 dd_Smed_v4_4223_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30003975SMESG000060101.1 SMESG000039123.1 dd_Smed_v4_4223_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30003975SMESG000060101.1 SMESG000039123.1 dd_Smed_v4_4223_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003975SMESG000060101.1 SMESG000039123.1 dd_Smed_v4_4223_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30003975SMESG000060101.1 SMESG000039123.1 dd_Smed_v4_4223_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003975SMESG000060101.1 SMESG000039123.1 dd_Smed_v4_4223_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ceramide synthase 5 vs. Ensembl Human
Match: CERS2 (ceramide synthase 2 [Source:HGNC Symbol;Acc:HGNC:14076])

HSP 1 Score: 235.728 bits (600), Expect = 1.439e-73
Identity = 125/332 (37.65%), Postives = 184/332 (55.42%), Query Frame = 3
Query:   54 RLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEY-KRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAH---IGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSD 1037
            RLWLP N TW DL  +D    Y +  DL  +   A     +R F E  +  P+     +  +   +A  N  LE  Y    K+P  + ++ +S    L    ++RWFRRRRNQ++  +L KF+E+ WRF +YL  F+ G  V+ D+ + +D KK+W   P  +  P  +WY MIEL +YW+ LF++  DVKRKDF E +IHH+ TI LI  +W  N+I     ++ LHD  DY +E+AKM +Y      CN +F VF + + ++RLVI P  I++    +   +    FG +   SM+ VLQ+LHI W  +ILR+A   F    + +D RSD
Sbjct:   13 RLWLPVNLTWADLEDRD-GRVYAKASDLYITLPLALLFLIVRYFFELYVATPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRRRRNQDRPSLLKKFREASWRFTFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQYWYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYIRAGTLIMALHDSSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFFGYYFFNSMMGVLQLLHIFWAYLILRMA-HKFITGKLVEDERSD 342          
BLAST of Ceramide synthase 5 vs. Ensembl Human
Match: CERS2 (ceramide synthase 2 [Source:HGNC Symbol;Acc:HGNC:14076])

HSP 1 Score: 235.728 bits (600), Expect = 1.439e-73
Identity = 125/332 (37.65%), Postives = 184/332 (55.42%), Query Frame = 3
Query:   54 RLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEY-KRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAH---IGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSD 1037
            RLWLP N TW DL  +D    Y +  DL  +   A     +R F E  +  P+     +  +   +A  N  LE  Y    K+P  + ++ +S    L    ++RWFRRRRNQ++  +L KF+E+ WRF +YL  F+ G  V+ D+ + +D KK+W   P  +  P  +WY MIEL +YW+ LF++  DVKRKDF E +IHH+ TI LI  +W  N+I     ++ LHD  DY +E+AKM +Y      CN +F VF + + ++RLVI P  I++    +   +    FG +   SM+ VLQ+LHI W  +ILR+A   F    + +D RSD
Sbjct:   13 RLWLPVNLTWADLEDRD-GRVYAKASDLYITLPLALLFLIVRYFFELYVATPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRRRRNQDRPSLLKKFREASWRFTFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQYWYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYIRAGTLIMALHDSSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFFGYYFFNSMMGVLQLLHIFWAYLILRMA-HKFITGKLVEDERSD 342          
BLAST of Ceramide synthase 5 vs. Ensembl Human
Match: CERS2 (ceramide synthase 2 [Source:HGNC Symbol;Acc:HGNC:14076])

HSP 1 Score: 221.09 bits (562), Expect = 5.628e-68
Identity = 119/316 (37.66%), Postives = 172/316 (54.43%), Query Frame = 3
Query:   54 RLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEY-KRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAH---IGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIA 989
            RLWLP N TW DL  +D    Y +  DL  +   A     +R F E  +  P+     +  +   +A  N  LE  Y    K+P             L    ++RWFRRRRNQ++  +L KF+E+ WRF +YL  F+ G  V+ D+ + +D KK+W   P  +  P  +WY MIEL +YW+ LF++  DVKRKDF E +IHH+ TI LI  +W  N+I     ++ LHD  DY +E+AKM +Y      CN +F VF + + ++RLVI P  I++    +   +    FG +   SM+ VLQ+LHI W  +ILR+A
Sbjct:   13 RLWLPVNLTWADLEDRD-GRVYAKASDLYITLPLALLFLIVRYFFELYVATPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPKQ---------SGLSGRQVERWFRRRRNQDRPSLLKKFREASWRFTFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQYWYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYIRAGTLIMALHDSSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFFGYYFFNSMMGVLQLLHIFWAYLILRMA 318          
BLAST of Ceramide synthase 5 vs. Ensembl Human
Match: CERS4 (ceramide synthase 4 [Source:HGNC Symbol;Acc:HGNC:23747])

HSP 1 Score: 219.935 bits (559), Expect = 2.039e-67
Identity = 126/360 (35.00%), Postives = 199/360 (55.28%), Query Frame = 3
Query:   18 IMNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEY-KRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAF----AHIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVNDKK 1082
            +++  N+W    R WLP N TW +L  +D    Y  P+DL  +   A  L  +R+  ER I  P+ R+ G+  +   +   N  LE  +     RP    +  ++    L     QRWFRRRRNQ++  +  KF E+ WRF++YLS F+ G  VL  + ++W     W   P   + P ++W+ ++ELG+Y + L  + FDVKRKDF E +IHH V + L+  ++  N + +   VL LHD  DY +EA KM++Y++   +C+ LF +F+  +F +RLV+FPT+I+Y+ +    ++ G   FG +    +L +LQ+LH+ W  +ILR+         + KD RSD E S S EEA   ++
Sbjct:    1 MLSSFNEWFWQDRFWLPPNVTWTELEDRD-GRVYPHPQDLLAALPLALVLLAMRLAFERFIGLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWRFLFYLSSFVGGLSVLYHESWLWAPVMCWDRYPNQTLKPSLYWWYLLELGFYLSLLIRLPFDVKRKDFKEQVIHHFVAVILMTFSYSANLLRIGSLVLLLHDSSDYLLEACKMVNYMQYQQVCDALFLIFSFVFFYTRLVLFPTQILYTTYYESISNRG-PFFGYYFFNGLLMLLQLLHVFWSCLILRMLYSFMKKGQMEKDIRSDVEESDSSEEAAAAQE 358          
BLAST of Ceramide synthase 5 vs. Ensembl Human
Match: CERS4 (ceramide synthase 4 [Source:HGNC Symbol;Acc:HGNC:23747])

HSP 1 Score: 219.935 bits (559), Expect = 2.039e-67
Identity = 126/360 (35.00%), Postives = 199/360 (55.28%), Query Frame = 3
Query:   18 IMNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEY-KRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAF----AHIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVNDKK 1082
            +++  N+W    R WLP N TW +L  +D    Y  P+DL  +   A  L  +R+  ER I  P+ R+ G+  +   +   N  LE  +     RP    +  ++    L     QRWFRRRRNQ++  +  KF E+ WRF++YLS F+ G  VL  + ++W     W   P   + P ++W+ ++ELG+Y + L  + FDVKRKDF E +IHH V + L+  ++  N + +   VL LHD  DY +EA KM++Y++   +C+ LF +F+  +F +RLV+FPT+I+Y+ +    ++ G   FG +    +L +LQ+LH+ W  +ILR+         + KD RSD E S S EEA   ++
Sbjct:    1 MLSSFNEWFWQDRFWLPPNVTWTELEDRD-GRVYPHPQDLLAALPLALVLLAMRLAFERFIGLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWRFLFYLSSFVGGLSVLYHESWLWAPVMCWDRYPNQTLKPSLYWWYLLELGFYLSLLIRLPFDVKRKDFKEQVIHHFVAVILMTFSYSANLLRIGSLVLLLHDSSDYLLEACKMVNYMQYQQVCDALFLIFSFVFFYTRLVLFPTQILYTTYYESISNRG-PFFGYYFFNGLLMLLQLLHVFWSCLILRMLYSFMKKGQMEKDIRSDVEESDSSEEAAAAQE 358          
BLAST of Ceramide synthase 5 vs. Ensembl Celegans
Match: hyl-1 (Ceramide synthase hyl-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ED45])

HSP 1 Score: 149.443 bits (376), Expect = 5.622e-42
Identity = 85/248 (34.27%), Postives = 128/248 (51.61%), Query Frame = 3
Query:  411 KFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNI-ICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAHIGL--------------GHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVND------KKKEN 1091
            K  E  WRF YY   FL G +V+ +  +++D K+ W+  PF  +   ++WY MIE G+Y++ L    FDV+R DFW++++HH++TIFL+  +W  NF+ V   +L  HD  D F+E  K++ Y   N  + N +F +F  +W  +RL+ +P  +I SA                      +   L    L +L  LHI W  +ILRIA +     G  KD RSDS+    +EE          KKK+N
Sbjct:   17 KILECFWRFSYYTFAFLYGLYVMKNSSWLYDVKQCWIGYPFHPVPDTIWWYYMIETGFYYSLLIGSTFDVRRSDFWQLMVHHVITIFLLSSSWTINFVRVGTLILLSHDVSDVFLEGGKLVRYDAHNKNMTNFMFVLFFSSWVATRLIYYPFIVIRSAVTEAAALIQPDYILWDYQLSPPYAPRLIVFALILLFFLHIFWTFIILRIAYRT-STGGQAKDVRSDSDSDYDEEEMARRERTRLLKKKKN 263          
BLAST of Ceramide synthase 5 vs. Ensembl Celegans
Match: hyl-1 (Ceramide synthase hyl-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ED45])

HSP 1 Score: 149.058 bits (375), Expect = 4.119e-41
Identity = 85/248 (34.27%), Postives = 128/248 (51.61%), Query Frame = 3
Query:  411 KFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNI-ICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAHIGL--------------GHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVND------KKKEN 1091
            K  E  WRF YY   FL G +V+ +  +++D K+ W+  PF  +   ++WY MIE G+Y++ L    FDV+R DFW++++HH++TIFL+  +W  NF+ V   +L  HD  D F+E  K++ Y   N  + N +F +F  +W  +RL+ +P  +I SA                      +   L    L +L  LHI W  +ILRIA +     G  KD RSDS+    +EE          KKK+N
Sbjct:   91 KILECFWRFSYYTFAFLYGLYVMKNSSWLYDVKQCWIGYPFHPVPDTIWWYYMIETGFYYSLLIGSTFDVRRSDFWQLMVHHVITIFLLSSSWTINFVRVGTLILLSHDVSDVFLEGGKLVRYDAHNKNMTNFMFVLFFSSWVATRLIYYPFIVIRSAVTEAAALIQPDYILWDYQLSPPYAPRLIVFALILLFFLHIFWTFIILRIAYRT-STGGQAKDVRSDSDSDYDEEEMARRERTRLLKKKKN 337          
BLAST of Ceramide synthase 5 vs. Ensembl Celegans
Match: hyl-1 (Ceramide synthase hyl-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ED45])

HSP 1 Score: 149.058 bits (375), Expect = 4.119e-41
Identity = 85/248 (34.27%), Postives = 128/248 (51.61%), Query Frame = 3
Query:  411 KFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNI-ICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAHIGL--------------GHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVND------KKKEN 1091
            K  E  WRF YY   FL G +V+ +  +++D K+ W+  PF  +   ++WY MIE G+Y++ L    FDV+R DFW++++HH++TIFL+  +W  NF+ V   +L  HD  D F+E  K++ Y   N  + N +F +F  +W  +RL+ +P  +I SA                      +   L    L +L  LHI W  +ILRIA +     G  KD RSDS+    +EE          KKK+N
Sbjct:   91 KILECFWRFSYYTFAFLYGLYVMKNSSWLYDVKQCWIGYPFHPVPDTIWWYYMIETGFYYSLLIGSTFDVRRSDFWQLMVHHVITIFLLSSSWTINFVRVGTLILLSHDVSDVFLEGGKLVRYDAHNKNMTNFMFVLFFSSWVATRLIYYPFIVIRSAVTEAAALIQPDYILWDYQLSPPYAPRLIVFALILLFFLHIFWTFIILRIAYRT-STGGQAKDVRSDSDSDYDEEEMARRERTRLLKKKKN 337          
BLAST of Ceramide synthase 5 vs. Ensembl Celegans
Match: hyl-1 (Ceramide synthase hyl-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ED45])

HSP 1 Score: 149.058 bits (375), Expect = 4.719e-41
Identity = 85/248 (34.27%), Postives = 128/248 (51.61%), Query Frame = 3
Query:  411 KFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNI-ICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAHIGL--------------GHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVND------KKKEN 1091
            K  E  WRF YY   FL G +V+ +  +++D K+ W+  PF  +   ++WY MIE G+Y++ L    FDV+R DFW++++HH++TIFL+  +W  NF+ V   +L  HD  D F+E  K++ Y   N  + N +F +F  +W  +RL+ +P  +I SA                      +   L    L +L  LHI W  +ILRIA +     G  KD RSDS+    +EE          KKK+N
Sbjct:   95 KILECFWRFSYYTFAFLYGLYVMKNSSWLYDVKQCWIGYPFHPVPDTIWWYYMIETGFYYSLLIGSTFDVRRSDFWQLMVHHVITIFLLSSSWTINFVRVGTLILLSHDVSDVFLEGGKLVRYDAHNKNMTNFMFVLFFSSWVATRLIYYPFIVIRSAVTEAAALIQPDYILWDYQLSPPYAPRLIVFALILLFFLHIFWTFIILRIAYRT-STGGQAKDVRSDSDSDYDEEEMARRERTRLLKKKKN 341          
BLAST of Ceramide synthase 5 vs. Ensembl Celegans
Match: hyl-2 (Ceramide synthase hyl-2 [Source:UniProtKB/Swiss-Prot;Acc:Q7Z139])

HSP 1 Score: 113.62 bits (283), Expect = 2.764e-28
Identity = 91/368 (24.73%), Postives = 148/368 (40.22%), Query Frame = 3
Query:   39 WILNPRLWLPKNYTWDDLISQ--DPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFF-DVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYS----AFAHIGLGHFGVHLCQSMLCVLQVL---------HIMWFIMILRIALQAFDDTGIHKDSRSD-SEMSLSDEEAVNDKKKEN 1091
            W  +   WLP+  +W D+ ++  +P Y Y     L  +  T   L   R   E  I+ P+  +                      R+  P                        RR   ++    ++  E   R +YY   F+ G +++  +  ++D  + W N PF  I   + WY  I+ G+Y A +F + F D KR DFW+ML+HH +T+ LI ++W  N + V   +L  HD VD  ++  K+L Y +      + F      W  +RLV +P  II S    A A I   +  ++  Q       ++         HI W  ++ +IA     + G+  D R D  E SL + E    + K  
Sbjct:    3 WWTDALYWLPRGVSWSDMYNKTTEPGYMYPHYSHLWMTVLTGISLIIYRFVFENYIFVPLAHFLS--------------------RKNPPET----------------------RRGTLDREKKYSRMAECAMRALYYTISFVCGLYLVLHESHLYDITECWRNWPFHPIPNAVAWYYWIQGGFYIALVFGILFLDAKRSDFWQMLVHHFITLALIGVSWTMNMVRVGTLILVSHDAVDILIDVGKILRYEQFETALTICFAGVLFVWVATRLVYYPFWIIRSVWFDAPALIQDDYEWLNFDQQPQAPRFIMLLLTALLILHIFWAYILFKIAYDTIQE-GVVDDVREDFDEQSLVNREKAKQQNKNK 327          
BLAST of Ceramide synthase 5 vs. Ensembl Fly
Match: schlank (gene:FBgn0040918 transcript:FBtr0070938)

HSP 1 Score: 219.164 bits (557), Expect = 2.584e-67
Identity = 127/354 (35.88%), Postives = 193/354 (54.52%), Query Frame = 3
Query:   18 IMNIVNDWILNPRLWLPKNYTWDDLI-SQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAHIG--LGHFGV-HLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEA 1067
            I+N  ++   +  +WLP N TW D+     P+  +   KDL +    A  +  +R  +ER    P+G+  G+   +  KA +   LE  Y +  R     +  +S   ++ E  I+RW+R RR Q+K   L KF E+ WR +YYL  F+ G  VL D+ + WD K  W   P  +I+  ++WY MI + +YW+   T FFDVKRKDFW+M IHH+VT+ L+ ++W+ N   V   VL +HD  D F+EAAK+  Y K   +C+ +F +FTV W V+RL  +P +IIYS+       L  F   ++  S+L +L VLH++W  MIL+I + +     +  D RS     L+D   
Sbjct:    3 ILNEFSNVFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFAAVVMLVRYTLERFWISPVGKSLGIRSSRPKKAANVPILEKTYAKSTRLDKKKLVPLSKQTDMSEREIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSFIFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQFFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLEAAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYP-RIIYSSSVEAPRILPMFPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDLTDSSG 355          
BLAST of Ceramide synthase 5 vs. Ensembl Fly
Match: schlank (gene:FBgn0040918 transcript:FBtr0070937)

HSP 1 Score: 219.164 bits (557), Expect = 2.584e-67
Identity = 127/354 (35.88%), Postives = 193/354 (54.52%), Query Frame = 3
Query:   18 IMNIVNDWILNPRLWLPKNYTWDDLI-SQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAHIG--LGHFGV-HLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEA 1067
            I+N  ++   +  +WLP N TW D+     P+  +   KDL +    A  +  +R  +ER    P+G+  G+   +  KA +   LE  Y +  R     +  +S   ++ E  I+RW+R RR Q+K   L KF E+ WR +YYL  F+ G  VL D+ + WD K  W   P  +I+  ++WY MI + +YW+   T FFDVKRKDFW+M IHH+VT+ L+ ++W+ N   V   VL +HD  D F+EAAK+  Y K   +C+ +F +FTV W V+RL  +P +IIYS+       L  F   ++  S+L +L VLH++W  MIL+I + +     +  D RS     L+D   
Sbjct:    3 ILNEFSNVFWSTHIWLPPNTTWADIAPGSRPDVVHANYKDLIWPIPFAAVVMLVRYTLERFWISPVGKSLGIRSSRPKKAANVPILEKTYAKSTRLDKKKLVPLSKQTDMSEREIERWWRLRRAQDKPSTLVKFCENTWRCIYYLYSFIFGVIVLWDKPWFWDVKSCWYGYPHQSISNDIWWYYMISMSFYWSLTGTQFFDVKRKDFWQMFIHHMVTLLLMSLSWVCNLHRVGSLVLVVHDCADIFLEAAKLTKYAKYQKLCDAIFAIFTVVWIVTRLGFYP-RIIYSSSVEAPRILPMFPAYYIFNSLLLMLLVLHVIWTYMILKIVVDSLQKGLMSGDIRSSDSEDLTDSSG 355          
BLAST of Ceramide synthase 5 vs. Ensembl Zebrafish
Match: cers5 (ceramide synthase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-1740])

HSP 1 Score: 228.794 bits (582), Expect = 4.290e-71
Identity = 128/344 (37.21%), Postives = 188/344 (54.65%), Query Frame = 3
Query:   21 MNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKR-QKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFP----TKIIYSAFAHIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSD 1037
            M  ++ W  N R WLP N TW DL    P   Y +   L  +   A  +F +R+F ER I  P      +      +A  N  LE  +    K P +   + +S   + +   +QRWFR RRNQ+K    TKF ES WRF +YLSIF  G   L    ++WD ++ W N P+  +T  +++Y + EL +YW+ +F+ F D+KRKDF  M IHHL TI LI  +++ N + V   V+C+HD  D+ +EAAK+ +Y K   +C+V+F +F + +F +RL+IFP       ++ ++  IG  +    L   +L VLQVLHI W  +I RIA +A     + KD RSD
Sbjct:    1 MAALSAWFWNERFWLPHNVTWADLADPAPGVEYPKAGHLLSALPLALGIFAVRIFFERFIAGPCASMLQIQTELSRRAQPNAVLEKVFTSITKSPDSRHSEGLSKQLDWDVRKVQRWFRHRRNQDKPSTRTKFCESMWRFTFYLSIFTYGMRFLWQSPWMWDTRQCWYNYPYQVLTSGLYYYYVTELAFYWSLMFSQFTDIKRKDFLIMFIHHLATIGLISFSYVNNMLRVGSLVMCVHDASDFLLEAAKLANYAKYQRVCDVVFVIFGIIFFGTRLIIFPFWILNTTLFESWQIIG-PYPSWWLFNFLLLVLQVLHIFWSYLIARIAFKAIVRGKVSKDDRSD 343          
BLAST of Ceramide synthase 5 vs. Ensembl Zebrafish
Match: cers2b (ceramide synthase 2b [Source:ZFIN;Acc:ZDB-GENE-110408-40])

HSP 1 Score: 223.402 bits (568), Expect = 5.587e-69
Identity = 116/331 (35.05%), Postives = 179/331 (54.08%), Query Frame = 3
Query:   54 RLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEY-KRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAH---IGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRS 1034
            RLW P+   W DL  +D    Y + +DL  +   A     +R   E+ +  P+    GL      +   N  LE  Y    K PT   ++ +S      E  +QRWFRRRRNQ++ ++L KF E+ WRF +YL  F+ G   L D+ +++D ++MW   P + + P  +WY M+EL +Y + LF+V  DVKRKDF E +IHH+ TI LI  +W  N+I     ++ +HD  DY +E+AKM +Y +    CN +F +F   + V+RL+IFP +I+Y  + +   +    FG +    +L VL  LH+ W  +I+R+A +        +D RS
Sbjct:   13 RLWFPEGLGWADLEDRD-GRVYAKARDLWVALPIAVLFLLIRQLFEKYVATPLASLLGLKETVRRRVAHNPALESYYCNTSKNPTQSSVEKLSKQTGWTERQVQRWFRRRRNQDRPNLLKKFCEASWRFAFYLLAFIGGLAALIDKPWLYDLEEMWKGFPTLTLLPSQYWYYMLELAFYTSLLFSVASDVKRKDFKEQIIHHVATILLISFSWCVNYIRAGTLIMFMHDSADYLLESAKMFNYARWKNACNYIFILFAAIFIVTRLIIFPFRIMYCTWVYPVTLYPPFFGYYFFNGLLMVLLCLHMFWAALIIRLAFRFLSSNSSVEDERS 342          
BLAST of Ceramide synthase 5 vs. Ensembl Zebrafish
Match: cers2b (ceramide synthase 2b [Source:ZFIN;Acc:ZDB-GENE-110408-40])

HSP 1 Score: 223.402 bits (568), Expect = 5.587e-69
Identity = 116/331 (35.05%), Postives = 179/331 (54.08%), Query Frame = 3
Query:   54 RLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEY-KRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAH---IGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRS 1034
            RLW P+   W DL  +D    Y + +DL  +   A     +R   E+ +  P+    GL      +   N  LE  Y    K PT   ++ +S      E  +QRWFRRRRNQ++ ++L KF E+ WRF +YL  F+ G   L D+ +++D ++MW   P + + P  +WY M+EL +Y + LF+V  DVKRKDF E +IHH+ TI LI  +W  N+I     ++ +HD  DY +E+AKM +Y +    CN +F +F   + V+RL+IFP +I+Y  + +   +    FG +    +L VL  LH+ W  +I+R+A +        +D RS
Sbjct:   13 RLWFPEGLGWADLEDRD-GRVYAKARDLWVALPIAVLFLLIRQLFEKYVATPLASLLGLKETVRRRVAHNPALESYYCNTSKNPTQSSVEKLSKQTGWTERQVQRWFRRRRNQDRPNLLKKFCEASWRFAFYLLAFIGGLAALIDKPWLYDLEEMWKGFPTLTLLPSQYWYYMLELAFYTSLLFSVASDVKRKDFKEQIIHHVATILLISFSWCVNYIRAGTLIMFMHDSADYLLESAKMFNYARWKNACNYIFILFAAIFIVTRLIIFPFRIMYCTWVYPVTLYPPFFGYYFFNGLLMVLLCLHMFWAALIIRLAFRFLSSNSSVEDERS 342          
BLAST of Ceramide synthase 5 vs. Ensembl Zebrafish
Match: cers2a (ceramide synthase 2a [Source:ZFIN;Acc:ZDB-GENE-020808-2])

HSP 1 Score: 219.164 bits (557), Expect = 2.078e-67
Identity = 120/343 (34.99%), Postives = 186/343 (54.23%), Query Frame = 3
Query:   18 IMNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKR-QKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAH---IGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRS 1034
            +++ +++W  N RLW P +  W DL  +D    Y +  DL  +   A     +R   ER +   +    G+  +   +A  N  LE  ++   K P    ++ +       E  I RWFRRRRNQ + + L KF+E+ WRF +YL  F+ G   L D+ + +D K+MW   P + + P  +WY MIELG+Y + LF+V  DVKRKDF E ++HH+ TI LI  +W  N+I     ++ +HD  DY +E+AKM +Y      CN +F +F   + ++RLVIFP  I++  + +   +    FG +    +L VLQ LHI W ++ILR+A++      I +D RS
Sbjct:    1 MLSRLSEWFWNERLWFPGDLGWADLEDRD-GVTYAKTADLWVTLPIALTFLIIRQVFERTVAIRLATALGVKEKVRVRAAHNPMLEAYFRSTSKSPKQAEVESLVKKTGHTEREIHRWFRRRRNQERPNQLKKFREASWRFTFYLVAFIAGLAALIDKPWFYDTKEMWAGFPVLPLLPSQYWYYMIELGFYMSLLFSVASDVKRKDFKEQIVHHVATILLISFSWCVNYIRAGTLIMLVHDASDYLLESAKMFNYAGWRKTCNYIFIIFAAIFIITRLVIFPFWILHCTWVYPVTVYPPFFGYYFFNGLLFVLQCLHIFWAVLILRMAIKFLPGNNIVEDERS 342          
BLAST of Ceramide synthase 5 vs. Ensembl Zebrafish
Match: cers2a (ceramide synthase 2a [Source:ZFIN;Acc:ZDB-GENE-020808-2])

HSP 1 Score: 219.164 bits (557), Expect = 2.078e-67
Identity = 120/343 (34.99%), Postives = 186/343 (54.23%), Query Frame = 3
Query:   18 IMNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKR-QKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAH---IGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRS 1034
            +++ +++W  N RLW P +  W DL  +D    Y +  DL  +   A     +R   ER +   +    G+  +   +A  N  LE  ++   K P    ++ +       E  I RWFRRRRNQ + + L KF+E+ WRF +YL  F+ G   L D+ + +D K+MW   P + + P  +WY MIELG+Y + LF+V  DVKRKDF E ++HH+ TI LI  +W  N+I     ++ +HD  DY +E+AKM +Y      CN +F +F   + ++RLVIFP  I++  + +   +    FG +    +L VLQ LHI W ++ILR+A++      I +D RS
Sbjct:    1 MLSRLSEWFWNERLWFPGDLGWADLEDRD-GVTYAKTADLWVTLPIALTFLIIRQVFERTVAIRLATALGVKEKVRVRAAHNPMLEAYFRSTSKSPKQAEVESLVKKTGHTEREIHRWFRRRRNQERPNQLKKFREASWRFTFYLVAFIAGLAALIDKPWFYDTKEMWAGFPVLPLLPSQYWYYMIELGFYMSLLFSVASDVKRKDFKEQIVHHVATILLISFSWCVNYIRAGTLIMLVHDASDYLLESAKMFNYAGWRKTCNYIFIIFAAIFIITRLVIFPFWILHCTWVYPVTVYPPFFGYYFFNGLLFVLQCLHIFWAVLILRMAIKFLPGNNIVEDERS 342          
BLAST of Ceramide synthase 5 vs. Ensembl Xenopus
Match: cers2 (ceramide synthase 2 [Source:NCBI gene;Acc:100036728])

HSP 1 Score: 229.565 bits (584), Expect = 2.244e-71
Identity = 129/332 (38.86%), Postives = 182/332 (54.82%), Query Frame = 3
Query:   54 RLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYK-RQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAF---AHIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSD 1037
            RLWLP N TW DL  +D    Y +  DL  +   AF    +R   E  +  P+    G+  +   +A  N  LE  Y    K P    ++++S    L    ++RWFRRRRN+++  +  KF+E+ WRF +YL  F+ G  VL D+ +  D  ++W   P   + P  +WY MIELG+YW+ LF V FDVKRKDF E +IHH+ TI LI  +W  N+I V   V+ LHD  DYF+E+AKM +Y      CN +F VF + + V+R++IFP  I+Y  +     +    FG +    ML VLQ LHI W  +IL +A   F    + +D RSD
Sbjct:   13 RLWLPVNLTWADLEDKD-GRVYAKASDLYVTIPLAFVFLIVRYIFEISVAGPLANVLGVKDKVRLRAGPNPGLEKFYTCSSKHPRQSDLENLSKASRLTVRQVERWFRRRRNEDRPSLQKKFREASWRFTFYLIAFIAGIAVLIDKPWFHDLHEVWKGFPKQTMLPSQYWYYMIELGFYWSLLFRVAFDVKRKDFKEQIIHHVATIVLISFSWCANYIRVGTLVMVLHDASDYFLESAKMFNYAGWKETCNGIFIVFALVFIVTRIIIFPFWILYCTWFYPLEVYPAFFGYYFFNVMLWVLQCLHIFWAYLILGMA-HKFITGKLEQDERSD 342          
BLAST of Ceramide synthase 5 vs. Ensembl Xenopus
Match: cers2 (ceramide synthase 2 [Source:NCBI gene;Acc:100036728])

HSP 1 Score: 214.927 bits (546), Expect = 8.194e-66
Identity = 126/332 (37.95%), Postives = 175/332 (52.71%), Query Frame = 3
Query:   54 RLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYK-RQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAF---AHIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSD 1037
            RLWLP N TW DL  +D   Y  +  DL  +   AF    +R   E  +  P+    G+  +   +A  N  LE  Y    K P    ++++S    L    ++RWFRRRRN+++  +  KF+E+ WRF +YL  F+ G  VL D                  + P  +WY MIELG+YW+ LF V FDVKRKDF E +IHH+ TI LI  +W  N+I V   V+ LHD  DYF+E+AKM +Y      CN +F VF + + V+R++IFP  I+Y  +     +    FG +    ML VLQ LHI W  +IL +A   F    + +D RSD
Sbjct:   13 RLWLPVNLTWADLEDKDGRVY-AKASDLYVTIPLAFVFLIVRYIFEISVAGPLANVLGVKDKVRLRAGPNPGLEKFYTCSSKHPRQSDLENLSKASRLTVRQVERWFRRRRNEDRPSLQKKFREASWRFTFYLIAFIAGIAVLID-----------------TMLPSQYWYYMIELGFYWSLLFRVAFDVKRKDFKEQIIHHVATIVLISFSWCANYIRVGTLVMVLHDASDYFLESAKMFNYAGWKETCNGIFIVFALVFIVTRIIIFPFWILYCTWFYPLEVYPAFFGYYFFNVMLWVLQCLHIFWAYLILGMA-HKFITGKLEQDERSD 325          
BLAST of Ceramide synthase 5 vs. Ensembl Xenopus
Match: cers3 (ceramide synthase 3 [Source:NCBI gene;Acc:448139])

HSP 1 Score: 211.846 bits (538), Expect = 9.371e-65
Identity = 127/359 (35.38%), Postives = 190/359 (52.92%), Query Frame = 3
Query:   18 IMNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEY-KRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFA---HIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFD---DTGIHKDSRSDSEMSLSDEEAVN 1073
            +   ++DW    R+WLP NYTWDDL +++       P  L  +   A     LR   ER I  P+    G+  +   KA +N   E  Y    K P++  +  ++   N   I ++RWFRRRRNQ++  VL KF+ES WRF +YL   + G  VL D+ +  D  ++WV  P   +    +WY ++EL +YWA LF+V  DV+RKDF   ++HHL TIFL+  +W   +I V    L +HD  D  +EAAKM  Y      CNVLF +F V + +SRL+IFP  IIY+      +     F  +    ++ VLQ LHI W  +I R+  +       T +HK  R  +++ ++ ++ +N
Sbjct:    1 MFQTLSDWFWWDRIWLPCNYTWDDLENEEGTGSVS-PSQLYITIPLALLFMLLRFAFERAIATPVASAMGIKSKLRLKASNNPVFESFYISCSKHPSHEEMYGLAKKSNRTSIQVERWFRRRRNQDRPAVLKKFQESCWRFTFYLCALVGGVAVLYDKPWFHDVWEVWVGYPKQEVLTSQYWYYVMELSFYWALLFSVASDVRRKDFKVQVVHHLATIFLLNFSWSVKYIRVGTLTLLVHDLSDILLEAAKMCSYADWKRSCNVLFIIFAVVFIISRLIIFPFWIIYATTVYPLYYCPRFFLYYFFNMLMFVLQFLHIYWTYLIFRMVKKVISGNVSTTLHKK-RGLADIFIAMDKLMN 357          
BLAST of Ceramide synthase 5 vs. Ensembl Xenopus
Match: cers3 (ceramide synthase 3 [Source:NCBI gene;Acc:448139])

HSP 1 Score: 210.69 bits (535), Expect = 4.063e-64
Identity = 122/327 (37.31%), Postives = 175/327 (53.52%), Query Frame = 3
Query:   18 IMNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEY-KRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFA---HIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRI 986
            +   ++DW    R+WLP NYTWDDL +++       P  L  +   A     LR   ER I  P+    G+  +   KA +N   E  Y    K P++  +  ++   N   I ++RWFRRRRNQ++  VL KF+ES WRF +YL   + G  VL D+ +  D  ++WV  P   +    +WY ++EL +YWA LF+V  DV+RKDF   ++HHL TIFL+  +W   +I V    L +HD  D  +EAAKM  Y      CNVLF +F V + +SRL+IFP  IIY+      +     F  +    ++ VLQ LHI W  +I R+
Sbjct:    1 MFQTLSDWFWWDRIWLPCNYTWDDLENEEGTGSVS-PSQLYITIPLALLFMLLRFAFERAIATPVASAMGIKSKLRLKASNNPVFESFYISCSKHPSHEEMYGLAKKSNRTSIQVERWFRRRRNQDRPAVLKKFQESCWRFTFYLCALVGGVAVLYDKPWFHDVWEVWVGYPKQEVLTSQYWYYVMELSFYWALLFSVASDVRRKDFKVQVVHHLATIFLLNFSWSVKYIRVGTLTLLVHDLSDILLEAAKMCSYADWKRSCNVLFIIFAVVFIISRLIIFPFWIIYATTVYPLYYCPRFFLYYFFNMLMFVLQFLHIYWTYLIFRM 326          
BLAST of Ceramide synthase 5 vs. Ensembl Xenopus
Match: ENSXETT00000051557.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:1:73810921:73835965:1 gene:ENSXETG00000016968.1 transcript:ENSXETT00000051557.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 206.453 bits (524), Expect = 2.663e-62
Identity = 116/323 (35.91%), Postives = 177/323 (54.80%), Query Frame = 3
Query:   30 VNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKR-PTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAF---AHIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRI 986
            +N W+     WLP   TW+D+   D    Y + +DL  S   A F   +R   ER +  P+ R+ G+  +   +  +N  LE  Y  +K+ P    ++ +S   N++   ++ WFR RRNQ++  +  KF E+ WRFV+Y+  FL G   L    F +          F  +   ++WY ++ELG+Y + L T+ FDVKRKD  E ++HHL TIFLI  ++  N+I     V+ LHD  DY +E AKM +Y K   +C+VLF +F V + V+RLV+ PT++IYS +     I    FG +    +L VLQ+LH+ W  +ILR+
Sbjct:    5 LNQWLWRQEFWLPPGVTWEDMEGTD-GVIYPKSRDLLLSVPCALFFTAVRFLFERFVALPLSRHLGIREKYRRQPSANPLLEAFYANEKKQPLEAEVRYLSAQCNMQIRQVESWFRCRRNQDRPSISKKFCEASWRFVFYVISFLTG---LVLAVFFYS---------FQPLISSLYWYYIMELGFYSSLLLTISFDVKRKDLKEQIVHHLATIFLIIFSYCANYIRAGSLVMLLHDTADYILELAKMFNYSKWKRVCDVLFIIFAVVFIVTRLVLLPTRVIYSTYYFSMEIFQPFFGYYFFNVLLMVLQILHVFWAYLILRM 314          
BLAST of Ceramide synthase 5 vs. Ensembl Mouse
Match: Cers2 (ceramide synthase 2 [Source:MGI Symbol;Acc:MGI:1924143])

HSP 1 Score: 235.343 bits (599), Expect = 1.088e-73
Identity = 125/332 (37.65%), Postives = 183/332 (55.12%), Query Frame = 3
Query:   54 RLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQ-KRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAH---IGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSD 1037
            RLWLP N TW DL  +D    Y +  DL  +   A     +R F E  +  P+     +  +   +A  N  LE  Y+   K+P  + +  +S    L    ++RWFRRRRNQ++  +L KF+E+ WRF YYL  F+ G  V  D+ + +D +K+W   P  +I P  +WY MIEL +YW+ LF++  DVKRKDF E +IHH+ TI L+C +W  N++     ++ LHD  DY +E+AKM +Y      CN LF VF + + ++RLVI P  I++    +   +    FG +    M+ VLQ+LHI W   ILR+A   F    + +D RSD
Sbjct:   13 RLWLPVNLTWADLEDKD-GRVYAKASDLYITLPLALLFLVIRYFFELYVATPLAALLNVKEKTRLRAPPNATLEHFYQTSGKQPKQVEVDLLSRQSGLSGRQVERWFRRRRNQDRPSLLKKFREASWRFTYYLIAFVAGMAVTVDKPWFYDLRKVWEGYPIQSIIPSQYWYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILLCFSWFANYVRAGTLIMALHDASDYLLESAKMFNYAGWKNTCNNLFIVFAIVFIITRLVIMPFWILHCTMIYPLELYPAFFGYYFFNFMMAVLQMLHIFWAYFILRMA-HKFITGKLIEDERSD 342          
BLAST of Ceramide synthase 5 vs. Ensembl Mouse
Match: Cers5 (ceramide synthase 5 [Source:MGI Symbol;Acc:MGI:1919199])

HSP 1 Score: 217.624 bits (553), Expect = 2.099e-66
Identity = 120/342 (35.09%), Postives = 182/342 (53.22%), Query Frame = 3
Query:   21 MNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEY-KRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFP----TKIIYSAFAHIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSR 1031
            + ++  W+ +   WLP+N +W DL      Y Y   + +   F  A  +F +RM  ER I +P     G+      K + N  LE  +    K P    +K +S   +     IQ WFR RRNQ+K   LTKF ES WRF YYL IF  G   L    + WD ++ W N P+  ++  +++Y + +L +YW+ +F+ F DVKRKDF  M IHH++ I L   +++ N + V   + CLHDF D  +EAAKM +Y ++  +C  LF +F  A+ VSRL IFP       ++ ++  IG  +    L  ++L +LQVLH +W  +I++ A +A     + KD R
Sbjct:    9 LGLLWGWLWSESFWLPQNVSWADLEGPGDGYGYPRAQHVLSVFPLAVCIFSVRMLFERFIAKPCALRVGIKDSPVNKVEPNDTLEKVFVSVTKYPDEKRLKGLSKQLDWSVRKIQCWFRHRRNQDKPPTLTKFCESMWRFTYYLCIFCYGIRFLWSMPWFWDTRQCWYNYPYQPLSRELYYYYITQLAFYWSLMFSQFIDVKRKDFLMMFIHHMIGIMLTTFSYVNNMVRVGALIFCLHDFADPLLEAAKMANYARRERLCTTLFVIFGAAFIVSRLAIFPLWILNTTLFESWEIIG-PYPSWWLFNALLLILQVLHAIWSYLIVQTASKALSRGKVSKDDR 349          
BLAST of Ceramide synthase 5 vs. Ensembl Mouse
Match: Cers5 (ceramide synthase 5 [Source:MGI Symbol;Acc:MGI:1919199])

HSP 1 Score: 211.46 bits (537), Expect = 2.452e-64
Identity = 118/344 (34.30%), Postives = 180/344 (52.33%), Query Frame = 3
Query:   21 MNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEY-KRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFP----TKIIYSAFAHIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSD 1037
            + ++  W+ +   WLP+N +W DL      Y Y   + +   F  A  +F +RM  ER I +P     G+      K + N  LE  +    K P    +K +S   +     IQ WFR RRNQ+K   LTKF ES WRF YYL IF  G   L    + WD ++ W N P+  ++  +++Y + +L +YW+ +F+ F DVKRKDF  M IHH++ I L   +++ N + V   + CLHDF D  +EAAKM +Y ++  +C  LF +F  A+ VSRL IFP       ++ ++  IG  +    L  ++L +LQVLH +W  +I++ A +A     +      D
Sbjct:    9 LGLLWGWLWSESFWLPQNVSWADLEGPGDGYGYPRAQHVLSVFPLAVCIFSVRMLFERFIAKPCALRVGIKDSPVNKVEPNDTLEKVFVSVTKYPDEKRLKGLSKQLDWSVRKIQCWFRHRRNQDKPPTLTKFCESMWRFTYYLCIFCYGIRFLWSMPWFWDTRQCWYNYPYQPLSRELYYYYITQLAFYWSLMFSQFIDVKRKDFLMMFIHHMIGIMLTTFSYVNNMVRVGALIFCLHDFADPLLEAAKMANYARRERLCTTLFVIFGAAFIVSRLAIFPLWILNTTLFESWEIIG-PYPSWWLFNALLLILQVLHAIWSYLIVQTASKALSRGKVLSQEGLD 351          
BLAST of Ceramide synthase 5 vs. Ensembl Mouse
Match: Cers4 (ceramide synthase 4 [Source:MGI Symbol;Acc:MGI:1914510])

HSP 1 Score: 211.46 bits (537), Expect = 2.783e-64
Identity = 120/358 (33.52%), Postives = 194/358 (54.19%), Query Frame = 3
Query:   30 VNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKR-PTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYS----AFAHIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSD-SEMSLSDEEAVNDKKK 1085
            +++W+     WLP N TW +L  +D    +  P  +  +F  A  L  +R+  ER +  P+ R+ G+      K   N  LE  + R K+ P    +  +++   L     QRWFRRRRNQ++  +  KF E+ WRFV+YL  F+ G  +L  + ++W     W N P   +   ++W+ ++ELG+Y + L T+ FDVKRKDF E ++HH V + LI  ++  N + +   VL LHD  DY +E  K+L+Y      C+ LF +F + +F +RL+ FPT++IY+    +  + G   FG +    +L +LQ+LH+ WF +ILR+         + +D RSD  E   SD+E V++  +
Sbjct:    5 LSEWLWQETYWLPPNVTWAELEDRD-GLVFAHPHHVLAAFPVALVLVAVRIVFERFVALPLSRWMGVQDPIRRKIKPNPVLEKYFLRMKQCPEETQMVLLASQCGLTLRQTQRWFRRRRNQDRPSLSKKFCEACWRFVFYLCSFVGGTSILYHESWLWSPSLCWENYPHQTLNLSLYWWYLLELGFYLSLLITLPFDVKRKDFKEQVVHHFVAVGLIGFSYSVNLLRIGAVVLLLHDCSDYLLEGCKILNYAHFRRGCDALFIMFALVFFYTRLIFFPTQVIYTSVYDSIKNSG-PFFGYYFFIVLLVMLQILHVYWFCLILRMLYSFLHKGQMTEDIRSDVEEPDSSDDEPVSEGPQ 360          
BLAST of Ceramide synthase 5 vs. Ensembl Mouse
Match: Cers6 (ceramide synthase 6 [Source:MGI Symbol;Acc:MGI:2442564])

HSP 1 Score: 196.438 bits (498), Expect = 1.346e-58
Identity = 115/333 (34.53%), Postives = 178/333 (53.45%), Query Frame = 3
Query:   39 WILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKR-QKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFP----TKIIYSAFAHIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHK 1022
            W  N R WLP N TW DL + +    + + +DL  +F  AF +F +R+  ER I +P      +       A  N  LE  +    K P    ++ +S   + +   IQRWFR+RRNQ K   LT+F ES WRF +YL +F  G   L    ++W+ +  W N P+  +T  + +Y ++EL +YW+ + + F D+KRKDF  M +HHL TIFLI  +++ N   V   VLCLHD  D  +EAAKM +Y K   +C++LF +F V +  +RL IFP       ++ ++  +G  +    +   +L +LQ L+  W  +I++IA +      + K
Sbjct:    7 WFWNERFWLPHNVTWADLKNTE-EATFPQAEDLYLAFPLAFCIFMVRLIFERFIAKPCAIALNIQANGPQTAQPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTRFCESMWRFSFYLYVFSYGVRFLKQTPWLWNTRHCWYNYPYQPLTADLHYYYILELSFYWSLMVSQFTDIKRKDFGIMFLHHLATIFLITFSYVNNMARVGTLVLCLHDSADALLEAAKMANYAKFQKMCDLLFVMFAVVFITTRLGIFPLWVLNTTLFESWEIVG-PYPSWWVFNLLLLLLQGLNCFWSYLIVKIACKTVSKGKVSK 337          
BLAST of Ceramide synthase 5 vs. UniProt/SwissProt
Match: sp|Q96G23|CERS2_HUMAN (Ceramide synthase 2 OS=Homo sapiens OX=9606 GN=CERS2 PE=1 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 6.912e-73
Identity = 125/332 (37.65%), Postives = 184/332 (55.42%), Query Frame = 3
Query:   54 RLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEY-KRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAH---IGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSD 1037
            RLWLP N TW DL  +D    Y +  DL  +   A     +R F E  +  P+     +  +   +A  N  LE  Y    K+P  + ++ +S    L    ++RWFRRRRNQ++  +L KF+E+ WRF +YL  F+ G  V+ D+ + +D KK+W   P  +  P  +WY MIEL +YW+ LF++  DVKRKDF E +IHH+ TI LI  +W  N+I     ++ LHD  DY +E+AKM +Y      CN +F VF + + ++RLVI P  I++    +   +    FG +   SM+ VLQ+LHI W  +ILR+A   F    + +D RSD
Sbjct:   13 RLWLPVNLTWADLEDRD-GRVYAKASDLYITLPLALLFLIVRYFFELYVATPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRRRRNQDRPSLLKKFREASWRFTFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQYWYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYIRAGTLIMALHDSSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFFGYYFFNSMMGVLQLLHIFWAYLILRMA-HKFITGKLVEDERSD 342          
BLAST of Ceramide synthase 5 vs. UniProt/SwissProt
Match: sp|Q924Z4|CERS2_MOUSE (Ceramide synthase 2 OS=Mus musculus OX=10090 GN=Cers2 PE=1 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 7.613e-73
Identity = 125/332 (37.65%), Postives = 183/332 (55.12%), Query Frame = 3
Query:   54 RLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQ-KRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAH---IGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSD 1037
            RLWLP N TW DL  +D    Y +  DL  +   A     +R F E  +  P+     +  +   +A  N  LE  Y+   K+P  + +  +S    L    ++RWFRRRRNQ++  +L KF+E+ WRF YYL  F+ G  V  D+ + +D +K+W   P  +I P  +WY MIEL +YW+ LF++  DVKRKDF E +IHH+ TI L+C +W  N++     ++ LHD  DY +E+AKM +Y      CN LF VF + + ++RLVI P  I++    +   +    FG +    M+ VLQ+LHI W   ILR+A   F    + +D RSD
Sbjct:   13 RLWLPVNLTWADLEDKD-GRVYAKASDLYITLPLALLFLVIRYFFELYVATPLAALLNVKEKTRLRAPPNATLEHFYQTSGKQPKQVEVDLLSRQSGLSGRQVERWFRRRRNQDRPSLLKKFREASWRFTYYLIAFVAGMAVTVDKPWFYDLRKVWEGYPIQSIIPSQYWYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILLCFSWFANYVRAGTLIMALHDASDYLLESAKMFNYAGWKNTCNNLFIVFAIVFIITRLVIMPFWILHCTMIYPLELYPAFFGYYFFNFMMAVLQMLHIFWAYFILRMA-HKFITGKLIEDERSD 342          
BLAST of Ceramide synthase 5 vs. UniProt/SwissProt
Match: sp|Q3ZBF8|CERS2_BOVIN (Ceramide synthase 2 OS=Bos taurus OX=9913 GN=CERS2 PE=2 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 1.925e-71
Identity = 124/344 (36.05%), Postives = 189/344 (54.94%), Query Frame = 3
Query:   18 IMNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEY-KRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAH---IGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSD 1037
            ++  ++D+    RLWLP N TW DL  +D    Y +  DL  +   A     +R F E  +  P+     +  +   +A  N  LE  Y    K+P    ++ +S    L    ++RWFRRRRNQ++  +L KF+E+ WRF +YL  F+ G  V+ D+ + +D +K+W   P  +I P  +WY MIEL +YW+ LF++  DVKRKDF E +IHH+ TI LI  +W  N++     ++ LHD  DY +E+AKM +Y      CN +F VF + + ++RLVI P  I++    +   +    FG +    M+ VLQ+LHI W  +ILR+A   F    + +D RSD
Sbjct:    1 MLQTLHDYFWWERLWLPVNLTWADLEDRD-GRVYAKASDLYITLPLALLFLIIRYFFELYVATPLAALLNVKEKTRLRAPPNPTLEHFYMTSGKQPKQADVELLSRQSGLSGRQVERWFRRRRNQDRPSLLKKFREASWRFTFYLIAFIAGTAVIVDKPWFYDLRKVWEGYPIQSIIPSQYWYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYVRAGTLIMALHDSSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFFGYYFFNFMMGVLQLLHIFWAYLILRMA-HKFITGKVVEDERSD 342          
BLAST of Ceramide synthase 5 vs. UniProt/SwissProt
Match: sp|Q5E9R6|CERS4_BOVIN (Ceramide synthase 4 OS=Bos taurus OX=9913 GN=CERS4 PE=2 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 1.944e-71
Identity = 131/354 (37.01%), Postives = 197/354 (55.65%), Query Frame = 3
Query:   30 VNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKR-PTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSA-FAHIG--LGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSD-SEMSLSDEEAVND 1076
            +NDW+ N RLWLP N +W  L   D    +  P+D   +   A  L  +R   ER +  P+ R+ G+ ++    AD N  LE  Y  + R PT   +  ++T   L     Q WFRRRRNQ++  +  KF ES W+FV+YL  F+ G  VL  + ++W   K W N P   + P ++ + ++EL +Y + L T+ FD KRKDF E +IHH VTI LI  ++  N + +   VL LHD  DY +EA+K+ +Y+    +C+ LF +F++ +F +RLV+FPT+I+Y+  F  IG     FG +    +L +LQ+LH+ W  +IL +         + KD RSD  E+  SD EA  +
Sbjct:    5 LNDWLWNERLWLPANISWAQLEDHD-GLVFPHPQDTLMAVPLALALVVVRFTFERFVALPLSRWLGVRNQIRRPADPNATLEKHYLMKGREPTESQMNLLATQCGLTLRQTQCWFRRRRNQDRPCLTKKFCESSWKFVFYLCCFVCGTMVLYHESWLWTPVKCWENYPHQPLKPGLYHWYLLELSFYISLLMTLPFDTKRKDFKEQVIHHFVTIILISFSYSLNLLRIGSLVLLLHDSADYLLEASKLFNYMHWRRMCDTLFIIFSLVFFYTRLVLFPTRILYTTFFESIGNFSPFFGYYFLNILLVILQLLHVFWSWLILCMIYSFIKKGQMEKDVRSDVEELDSSDGEAAEE 357          
BLAST of Ceramide synthase 5 vs. UniProt/SwissProt
Match: sp|Q9HA82|CERS4_HUMAN (Ceramide synthase 4 OS=Homo sapiens OX=9606 GN=CERS4 PE=1 SV=2)

HSP 1 Score: 219.935 bits (559), Expect = 9.792e-67
Identity = 126/360 (35.00%), Postives = 199/360 (55.28%), Query Frame = 3
Query:   18 IMNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEY-KRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAF----AHIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVNDKK 1082
            +++  N+W    R WLP N TW +L  +D    Y  P+DL  +   A  L  +R+  ER I  P+ R+ G+  +   +   N  LE  +     RP    +  ++    L     QRWFRRRRNQ++  +  KF E+ WRF++YLS F+ G  VL  + ++W     W   P   + P ++W+ ++ELG+Y + L  + FDVKRKDF E +IHH V + L+  ++  N + +   VL LHD  DY +EA KM++Y++   +C+ LF +F+  +F +RLV+FPT+I+Y+ +    ++ G   FG +    +L +LQ+LH+ W  +ILR+         + KD RSD E S S EEA   ++
Sbjct:    1 MLSSFNEWFWQDRFWLPPNVTWTELEDRD-GRVYPHPQDLLAALPLALVLLAMRLAFERFIGLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWRFLFYLSSFVGGLSVLYHESWLWAPVMCWDRYPNQTLKPSLYWWYLLELGFYLSLLIRLPFDVKRKDFKEQVIHHFVAVILMTFSYSANLLRIGSLVLLLHDSSDYLLEACKMVNYMQYQQVCDALFLIFSFVFFYTRLVLFPTQILYTTYYESISNRG-PFFGYYFFNGLLMLLQLLHVFWSCLILRMLYSFMKKGQMEKDIRSDVEESDSSEEAAAAQE 358          
BLAST of Ceramide synthase 5 vs. TrEMBL
Match: A0A210PWC6 (Ceramide synthase 5 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19149 PE=4 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 1.130e-86
Identity = 137/343 (39.94%), Postives = 207/343 (60.35%), Query Frame = 3
Query:   48 NPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAHIG--LGHF-GVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIH-KDSRSDSEMSLSDEE 1064
            + + WLP+  +W D  +   + Y+    DL Y       LF +R   ER I  PIGRYFG+ +    K   N  LE  +K  K P N  I+ +S   +L    ++RWFR RRNQ++   + +F E+ WRF +Y S+F+ G  VL D+ +  D+   WV  P  +I P +FWY MIE+G+Y + +F+ F DV+RKDFWEM  HH+ T+ L+C +W  NF+ V   VL +HD VD++MEAAKM  Y+K   +C+VLF +F + WFV+RLVIFP ++IYS +  +   +G+F  +++  +MLC+L VLH  WF +I+++      ++G    D RS  E ++S++E
Sbjct:   17 DEKFWLPEKISWKDFENHSDDLYHPVVSDLKYVILCGCLLFAVRKLYERHIAAPIGRYFGIRNTLPRKPPPNPVLENAFKCHKFPENDKIQSLSKQTDLSTRKVERWFRMRRNQDRPSFMKRFTEAAWRFTFYFSVFVYGVVVLWDKPWFVDSTHCWVGYPHHHIPPAIFWYYMIEIGFYSSLMFSQFIDVRRKDFWEMFTHHVATMLLLCFSWCGNFVRVGTLVLVIHDAVDFWMEAAKMAKYLKAQRLCDVLFAIFGIVWFVTRLVIFPVRVIYSTYFELPVIVGYFPAMYMFNAMLCLLLVLHAYWFSLIVKVTYDVLTNSGEEVTDIRSSEEENVSEDE 359          
BLAST of Ceramide synthase 5 vs. TrEMBL
Match: A0A1W0WZR1 (Ceramide synthase 2 OS=Hypsibius dujardini OX=232323 GN=BV898_05287 PE=4 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 1.280e-81
Identity = 141/353 (39.94%), Postives = 209/353 (59.21%), Query Frame = 3
Query:   30 VNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRR--NQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFA-HIGLGHFGV-HLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVND 1076
            ++D++ N   WLP N +W DL +  P   Y     L Y    A F++ +R+ VE+ I+EPIGR   +  RK +    N  LE  YK  +R T+  I  ++   ++ E  ++RWFR R    +  +  L KFKE+GWRF +YL IFL G WVLSD+ +  D+  +W   PF  +T  ++WY MIEL +YW+ LFT FFDVKRKDFWEM  HH++TI L+C +W+ N + +   VL LHD  D+++E AK+  Y K + + ++ F +F   W V+RL ++P +I+   F   +G   F   HL  ++L  LQ+LHI W   ILR+  +A  +TG  +D RSD++   S+ EA +D
Sbjct:    7 ISDFLWNESFWLPMNVSWRDL-THTPERPYPSFHALLYPIPLALFVYLVRLTVEKVIYEPIGRSLRIPCRKAHNVSPNPILEASYKWSRRLTHADILGLAKRCDMTERQVERWFRHRNAIRRGLTSQLDKFKETGWRFTFYLGIFLYGVWVLSDKPWFQDSSYVWTEYPFQIVTSDVWWYYMIELSFYWSLLFTQFFDVKRKDFWEMFFHHIITITLMCFSWIDNTVRIGTLVLVLHDVSDFWLEGAKLARYAKMSRLSSMFFAIFAAVWIVTRLGVYPYRILSYTFPCPLGEKCFPAFHLYNTLLGSLQILHIFWTFTILRVIYRAL-NTGETEDVRSDTDE--SENEASDD 355          
BLAST of Ceramide synthase 5 vs. TrEMBL
Match: A0A2L2YQ61 (Protein transporter of the tram translocating chain-associating membrane superfamily (Fragment) OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 4.722e-78
Identity = 137/335 (40.90%), Postives = 195/335 (58.21%), Query Frame = 3
Query:   18 IMNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAF--AHIGLGHFGV-HLCQSMLCVLQVLHIMWFIMILRIALQAFDDTG 1013
            I++ +N W  N  +WLP N TWDD I       Y +  DL Y+F  A  L  +R  +E+ I+ PIG Y GL   K YK   N  LE  YK   +     ++ ++   +L E  IQRWFR+R ++NK   L KF ES WRF +YL  F  G + L D+ ++ D    W + P  ++T  ++WY M+ELG+YW+  F+ F D KRKDF +M +HH+VTI L+  +W  N   V   VL +HDF D  +EAAKM  Y++   + +  F VFTVAW +SRL ++P +IIYS    A + +  F   ++  ++LC LQVLHI+W  MI++IAL+A   T 
Sbjct:    1 ILSNINTWFWNDYVWLPPNVTWDD-IRDTGTVKYAQFSDLNYAFNVAIALLIIRYILEKSIFAPIGCYLGL-KPKTYKLRDNPVLEKAYKENGKLEPKQLQGLAKQTDLSEREIQRWFRKRVSRNKPSTLNKFTESAWRFTFYLGAFSYGLYALWDKPWLLDTNFCWYDYPHHSMTNDIWWYYMLELGFYWSLTFSQFLDTKRKDFMQMFVHHIVTILLLTFSWTSNLFRVGSLVLVIHDFADVPLEAAKMAKYVENQRVADASFAVFTVAWIISRLGLYPYRIIYSTMYQALLIVPMFPAYYVFNTLLCALQVLHIVWTWMIVKIALRAVSATN 333          
BLAST of Ceramide synthase 5 vs. TrEMBL
Match: A0A3Q0SZ18 (Ceramide synthase 5 OS=Amphilophus citrinellus OX=61819 GN=CERS5 PE=4 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 4.784e-78
Identity = 138/357 (38.66%), Postives = 201/357 (56.30%), Query Frame = 3
Query:   30 VNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFA---HIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVNDKKKEN 1091
            ++ WI N R WLP+N +W DL    P   Y  P+D+ Y+   A  +F LR+  ER + +P      +      +A  N  LE  Y+  K P    ++ +S   +L+   IQRWFR RRNQ++  V  KF ES WRF +YL IF+ G   L    + WD ++ W N PF  ++P  + Y + EL +YW+ +F+ F D+KRKDF  ML+HHL TI LI  ++  N +     V+C+HD  D F+EAAK+ +Y K   +C+ LF VF++++F+SRLVIFP  II+S       I   +    L   +L VLQ LHI+WF +I+ IA++A     + KD RSD E S  +E + N    + 
Sbjct:    5 ISAWIWNERFWLPENVSWADLEHPPPGVEYPRPRDILYALPLAAGVFLLRILFERLVAKPCAHILQIQPGVPRQAQPNAVLEKLYQ-SKCPDIRQLEGLSKQLDLDVRKIQRWFRVRRNQDRPSVQKKFCESMWRFTFYLGIFIYGINHLWSTPWTWDTRQCWHNYPFQPVSPGQYSYYLAELAFYWSLMFSQFIDIKRKDFVIMLVHHLATIILITFSYANNMLRAGTLVMCVHDVSDIFLEAAKLANYAKYQRLCDGLFVVFSISFFISRLVIFPFWIIHSVLFESWEIAGPYQSWWLFNGLLVVLQFLHIIWFYLIMGIAIKAIFKGKVAKDDRSDVETSSDEELSSNTDPSQT 360          
BLAST of Ceramide synthase 5 vs. TrEMBL
Match: A0A3Q4HQ01 (Ceramide synthase 2a OS=Neolamprologus brichardi OX=32507 PE=4 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 3.236e-77
Identity = 133/356 (37.36%), Postives = 200/356 (56.18%), Query Frame = 3
Query:   36 DWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEY-KRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAH---IGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVNDKKKEN 1091
            DWI     W P+ + W DL   D    + +P+DL  +   AF    +R   ER +  P+    G++ ++  +A  N  LE  +    K P    I+ +S         +QRWFRRRRNQ++   L KF+E+ WRF +YL  F  G  VL D+ + +D K +W N P + + P  +WY MIELG+Y + +F+V  DVKRKDF E +IHH+ TI LI  +WL N+I     ++ +HD  DY ME+AKM +Y      CN +FT+F   + V+RL+I P  II++ F +   +    FG +    ++CVLQVLHI W ++ILR+ ++      I +D RSD E + SD+E  + +++E 
Sbjct:   12 DWI-----WFPEGHGWADLTDHD-GKVFPKPQDLWATIPIAFCFLVIRQIFERTVAIPLASLLGVSDKQRVRAPPNPVLESYFCSTSKHPKQSSIESLSKQTGCSVQQVQRWFRRRRNQDRPSKLKKFREASWRFTFYLLAFFAGLAVLIDKPWFYDVKLIWENFPKMPLLPSQYWYYMIELGFYISLIFSVASDVKRKDFKEQIIHHVATIALISFSWLVNYIRAGTLIMLVHDAADYLMESAKMFNYAGWRRTCNFIFTMFAAVFIVTRLIILPFWIIHTTFVYPLSLYSPFFGFYFFNGLMCVLQVLHIFWAVLILRMVVKFLPGNDIVEDERSDKEETESDDEDGDCERREK 361          
BLAST of Ceramide synthase 5 vs. Ensembl Cavefish
Match: cers2a (ceramide synthase 2-like [Source:NCBI gene;Acc:103047595])

HSP 1 Score: 236.113 bits (601), Expect = 4.714e-74
Identity = 121/343 (35.28%), Postives = 192/343 (55.98%), Query Frame = 3
Query:   18 IMNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEY-KRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAH---IGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRS 1034
            +++ +++W  N RLW P    W D+  +D  + Y +  DL  +   A     +R   ER +   +    G+  +   +A+SN  LE  +    K P   V++ +S      E+ +QRWFRRRRNQ + + L KF+E+ WRF +YL  F+ G   L D+ +++  +++W   P + + P  +WY MIELG+Y + LF+V  DVKRKDF E ++HH+ TI LI  +W  N+I     ++ +HD  DY +E+AKM +Y      CN +F +F   +FV+RLVI P  I++  + +   I    FG +    ++ VLQ LHI WF++ILR+A++      I +D RS
Sbjct:    1 MLSQLSEWFWNERLWFPVGLGWADIQDRD-GHTYAKGSDLWVTLPIALAFLIVRQIFERTVAPWLASLMGVKEKVRVRAESNPALESHFCTASKHPAQSVVESLSKQTGYSELQVQRWFRRRRNQERPNQLKKFREASWRFTFYLLAFIAGLGALIDKPWLYKMEEVWKGFPTLTLLPSQYWYYMIELGFYMSLLFSVASDVKRKDFKEQIVHHVATILLISFSWCVNYIRAGTLIMLVHDSSDYLLESAKMFNYAGWRKTCNYIFILFAAVFFVTRLVILPFWIMHCTWVYPVTIYPPFFGYYFFNGLMFVLQCLHIFWFVLILRMAIKFLPGNRIVEDERS 342          
BLAST of Ceramide synthase 5 vs. Ensembl Cavefish
Match: cers5 (ceramide synthase 5 [Source:NCBI gene;Acc:103035123])

HSP 1 Score: 230.335 bits (586), Expect = 1.085e-71
Identity = 133/366 (36.34%), Postives = 195/366 (53.28%), Query Frame = 3
Query:   21 MNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQ-KRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFP----TKIIYSAFAHIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVNDKKKEN*IRE 1103
            M  + DW  + R WLP N TW DL    P   Y +   L  +   A  +F +R+F ER I  P      +      +A  N  LE  +  + K P +  +  +S   + +   IQRWFR RRNQ+K    TKF ES WRF +YL IF  G   L    ++WD ++ W N P+  +TP ++ Y + EL +YW+ +F+ F D+KRKDF  M +HHL T+ LI  ++  N + V   VLC+HD  D+ +EAAK+ +Y K   +C+ LF VF  A+F +RL+I+P       ++ ++  +G  +    +   +L VLQVLHI+W  +I RIA +A     + KD RSD E S  +E   N     +  RE
Sbjct:    1 MAALVDWFWDERFWLPHNVTWADLADPAPGVEYPKAGHLLRALPLALGIFVVRIFFERFIAGPCANILQIQSEVIRRAQPNAILEKVFTSETKSPDSRKLDGLSKQLDWDVRKIQRWFRHRRNQDKPSTRTKFCESMWRFTFYLCIFTYGFCFLWQSPWMWDTRQCWYNYPYQVLTPGLYHYYVTELAFYWSLMFSQFTDIKRKDFLIMFVHHLATVSLISFSYANNMVRVGSLVLCVHDTSDFLLEAAKLANYAKYQRLCDFLFVVFGAAFFGTRLIIYPFWILNSTMFESWEIVG-PYASWWVFNPLLLVLQVLHIIWSYLIARIAFKALMRGKVSKDVRSDIESSSEEETETNQSHSASPKRE 365          
BLAST of Ceramide synthase 5 vs. Ensembl Cavefish
Match: cers2b (ceramide synthase 2b [Source:ZFIN;Acc:ZDB-GENE-110408-40])

HSP 1 Score: 220.32 bits (560), Expect = 4.425e-68
Identity = 118/326 (36.20%), Postives = 179/326 (54.91%), Query Frame = 3
Query:   30 VNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKR-QKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAH---IGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQ 995
            ++D     RLW P+   W DL  +D    Y + +DL      A     +R   ER +   +    G+      KA  N  LE  Y    K PT   ++ +       E  +QRWFRRRRNQ++ +++ KF+E+ WRF++YL  F+ G   L D+ +++D ++MW   P + + P  +WY M EL +Y + LF+V  DVKRKDF E +IHH+ TI LI  +W  N+I     ++ LHD  DY +E+AKM +Y      CN +F VF   + ++RL IFP +I+Y  + +   +    FG +   S+L VLQ LHI W ++I+R+AL+
Sbjct:    5 LSDIFWQERLWFPEGLGWADLEDRD-GRVYAKARDLWVVLPVALLFLVIRQIFERTVATYLASLLGIKESVRRKAAHNPTLESYYNHTSKYPTQSSVEKLCKQTGCSERQLQRWFRRRRNQDRPNLMKKFREASWRFLFYLLAFISGVVALIDKPWLYDLEEMWKGFPTLTLLPSQYWYYMFELSFYTSLLFSVATDVKRKDFKEQIIHHVATITLISFSWCMNYIRAGTLIMFLHDSSDYLLESAKMFNYAGWRKTCNYIFIVFAAFFIITRLFIFPFRIMYCTWVYPVTLYPPFFGYYFFNSLLLVLQCLHIFWAVLIIRMALR 329          
BLAST of Ceramide synthase 5 vs. Ensembl Cavefish
Match: cers4b (ceramide synthase 2-like [Source:NCBI gene;Acc:103027866])

HSP 1 Score: 213.772 bits (543), Expect = 3.483e-65
Identity = 118/342 (34.50%), Postives = 173/342 (50.58%), Query Frame = 3
Query:   21 MNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKR-PTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAF---AHIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRS 1034
            M + + W+     WLP   TW ++   + +     P+DL  S   A     LR   ER +  P+ R  G+  R    A     LE  Y +  R P    +  ++    L +  ++ WFR RRNQ++     KF E+ WRFV+YL  F+ G   L    +  D K+ W   P   I    +WY MIELG+YW+ L  V  DVKRKDF E +IHH+ TI L+  ++  N++ +   VL +HD  D+ +E+AKM +Y      C+ LF VF   + V+RLV+FP+KIIY+       +     G +   ++L VLQ LHI W  +ILR+  +      + KD RS
Sbjct:    1 MELFDQWLWRQEYWLPPGITWREMAQMEDSPL---PRDLLISLPLALGFIALRCAFERTVAVPLSRLLGVKDRIRLSASPAPSLEAFYTKHHRHPAQSEVSSLTKQSGLTQKQVEVWFRHRRNQDRPSNTKKFCEASWRFVFYLIAFIAGLASLISTPWFQDQKECWRGYPLQPIAKVHYWYYMIELGFYWSLLLCVSVDVKRKDFKEQIIHHIATILLLGFSYCANYVRIGTLVLLVHDSSDFLLESAKMFNYAGWKKTCDSLFVVFAAVFLVTRLVVFPSKIIYTTLILSMEVFQPFMGYYFFNALLLVLQALHIFWAWLILRMVYKFLFLGKLDKDERS 339          
BLAST of Ceramide synthase 5 vs. Ensembl Cavefish
Match: cers3a (ceramide synthase 3a [Source:ZFIN;Acc:ZDB-GENE-130320-1])

HSP 1 Score: 211.46 bits (537), Expect = 6.047e-65
Identity = 120/350 (34.29%), Postives = 193/350 (55.14%), Query Frame = 3
Query:   18 IMNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKA-DSNLKLEMEYKRQ-KRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAHIGLGH---FGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSL 1052
            ++  + +W    RLWLP N TW DL  +D   Y  +  DL  +   +     +R   ER +   +    G+  +   KA +SN  LE  Y  Q K P    I+ +S   +     ++RWFRRRRNQ +  VL KF+E+ WRFV+YL+ F+ G   L D+ + +D +++W+  P  ++    +WY ++E+ +YW+ LF++ FDVKRKDF E +IHHL T+ L+  +W  N+I V   V+ +HD  D  +E+AK+ +Y K    CN  F +F V + V+RLVIFP  II+  + +    +   FG +   ++L +L +LH+ W  +ILR+  +    +   + +  DS + L
Sbjct:    1 MIKTIGEWFWWDRLWLPVNLTWADLEDKDGRVY-AKVSDLYITLPYSIGFLIVRYVFERFVATALAECLGVRGKSRQKAVESNPILEQYYISQSKTPAKADIQGLSKKCSWSSRQVERWFRRRRNQERPGVLKKFREASWRFVFYLAAFIGGIVALYDKPWFYDLREVWMAYPKQSMLESQYWYYILEMSFYWSLLFSITFDVKRKDFKEQIIHHLATLTLLAFSWCGNYIRVGTLVMLVHDASDVLLESAKLFNYSKWERACNSSFVLFAVVFMVTRLVIFPFWIIHCTWVYPPDYYPVFFGYYFFNAVLVILLMLHVFWAYLILRMVKKFLFGSAARRRA-GDSALKL 348          
BLAST of Ceramide synthase 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009211.1 (pep scaffold:Pmarinus_7.0:GL476916:175486:192535:1 gene:ENSPMAG00000008314.1 transcript:ENSPMAT00000009211.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 223.402 bits (568), Expect = 7.509e-70
Identity = 123/340 (36.18%), Postives = 189/340 (55.59%), Query Frame = 3
Query:   30 VNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKR-QKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFA---HIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSD 1037
            +  W  +   WLP N +W+DL + +    + +  DL  +F  A  +F +R   ER + +P   Y  +  R++  A  +  LE  +K   KRP +  IK  S   +L+   I+ WFR+RRNQ K  ++TKF ES WRF +Y  IF  G   L    ++WD K  W N P+  +T  +FWY ++EL +YW+ +F+ F D+KRKDF  ML+HHL T+ L+  +++ N + V   VLCLHD  D+ +E AKM +Y K   +C+ +F +F + +  +RLV++P  I+ S       I   +    +   +L +LQVLH +W  +I  IA +AF    + KD RSD
Sbjct:    5 LKAWFWSESFWLPHNVSWEDLRNSEA-VTFPQASDLYLAFPLALAIFVVRQLFERFVAKPFAIYLNIQARRFTTAVPHAALENIFKTVTKRPDSARIKGYSKQLDLDVRTIEHWFRQRRNQEKPSLVTKFSESLWRFCFYFGIFCFGLQYLWKTPWLWDTKHCWYNYPYQPLTAGLFWYYIVELAFYWSLMFSQFVDIKRKDFVIMLVHHLATVSLVSFSYVTNMVRVGTLVLCLHDAADFLLETAKMANYAKFQKLCDTMFALFGLVFISTRLVLYPLWILNSTMFESWEIVGPYPSWWVFNPLLLLLQVLHAIWSYLIFCIAFKAFAKGKVSKDERSD 343          
BLAST of Ceramide synthase 5 vs. Ensembl Sea Lamprey
Match: cers6 (ceramide synthase 6 [Source:ZFIN;Acc:ZDB-GENE-070522-1])

HSP 1 Score: 199.134 bits (505), Expect = 8.681e-61
Identity = 113/319 (35.42%), Postives = 185/319 (57.99%), Query Frame = 3
Query:  144 SFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKR-QKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFP----TKIIYSAFAHIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVNDKKK 1085
            +F  A  +F +R+  ERCI  P      +      KA SN  LE  +    K P +  +  ++   + +   IQRWFRRRRNQ K   L KF ES WRF++YL +F+ G  +LS   ++WD+++ W N P+  +   + +Y ++EL +YW+ +F+ F D+KRKDF+ M +HHL+T+ LI  +++ N + +   +LC+HD  D+ +EAAKM +Y +   +C++LF +F + +FV+RL +FP       ++ ++  +G  +    +   +L +LQ LH++W  +ILRIA +      + KD RSD E S  D+E   D+ K
Sbjct:    3 AFPLALGIFVVRIIFERCIARPCANALKIQAAGPRKAQSNAILEKVFTSITKNPGDKHLDGLAKQLDWDVRTIQRWFRRRRNQEKPSPLAKFCESMWRFMFYLYVFVYGLRLLSQSNWVWDSRQCWYNHPYQPLPSDIQYYYIVELAFYWSLMFSQFTDIKRKDFFMMFMHHLITVSLISFSYIVNMVRMGSVILCMHDAADFLLEAAKMANYARYQKLCDLLFILFALVFFVTRLGLFPFWPVRSTMFESWEIVG-PYPSWWVFVGLLVLLQCLHVIWSYLILRIACKLLRKGKVSKDDRSDIESSSDDDERTGDRAK 320          
BLAST of Ceramide synthase 5 vs. Ensembl Sea Lamprey
Match: tram2 (translocation associated membrane protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2024])

HSP 1 Score: 54.6842 bits (130), Expect = 1.278e-8
Identity = 56/257 (21.79%), Postives = 117/257 (45.53%), Query Frame = 3
Query:  354 YIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFD-VKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFA---------HIGLGHFGVHLCQSMLCVLQVLHIMWFI-MILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVNDKKKEN 1091
            YI     RR + +K    +K+ ESG    + L     G +++  +E+     ++W   P   ++ Y+ +Y + +L Y+  +L  ++F  +K+++  + L H  + I  I  A+L N   + M ++ LH  V++    +++ ++I +N      F V+ V + +SRL+     ++   F           +  G+F   L +  L  L  L   W +   ++  L+ + +   +K S S+ +   + +   +  KKEN
Sbjct:   98 YILDKLHRRLHLSKMK-HSKYNESGQLSFFSLIFSFWGLYIIIVEEYATQLSRLWEGFPHTTMSCYVKFYYIFQLAYWVHALPELYFQKIKKEEISKQLQHISLYIIHIAAAYLLNLTRLGMLLIVLHYMVEFVFHISRIFYFIDENYQKG--FQVWAVLFGLSRLITLTLSVLTIGFGLARSENQTLDVAAGNFNTLLIRICLLALICLTQAWMMWTFIKFQLRQWRE---YKMSISNKKKQATLKLKKDSGKKEN 348          
BLAST of Ceramide synthase 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009225.1 (pep scaffold:Pmarinus_7.0:GL487342:1832:7642:1 gene:ENSPMAG00000008340.1 transcript:ENSPMAT00000009225.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 5.355e-8
Identity = 37/151 (24.50%), Postives = 76/151 (50.33%), Query Frame = 3
Query:  375 RRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYI------------MIELGYYWASLF-TVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQ 788
            R R Q+    + KF E+ W+ V+YL  +L   ++L  +++ + ++ +         + +  WY+            M++  +Y  S++ T+  D  R+D   M++HH++T+ LI  ++   F  + + VL LHD  D+ +E  K+  Y++ 
Sbjct:   10 RLRPQD----VAKFPENAWKLVFYLGAWLYSGYLLFMRDYNFFSQPL---------SAFAGWYVGMEVPSDIHLAYMLQGSFYLHSVYGTLCLDTWRRDSPVMILHHIITLSLIGFSYAFRFHNIGLLVLFLHDTSDFLLEFTKVNVYLRH 147          
BLAST of Ceramide synthase 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010799.1 (pep scaffold:Pmarinus_7.0:GL476346:662815:681391:1 gene:ENSPMAG00000009784.1 transcript:ENSPMAT00000010799.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 5.356e-8
Identity = 59/263 (22.43%), Postives = 109/263 (41.44%), Query Frame = 3
Query:  357 IQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQE--FIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFT-VFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIK---------QNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAHIGLGHFGVHLC---QSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEE---AVNDKKKEN 1091
            + +W R R          KF ES W+ ++YL+I+L    +L  +E  F  +   ++ +  +V +   M    ++   ++  SL++   F+      W++    L     +   W+  +  V M  L LHD  D  +E  K+  Y+K          NI+ N+    F V+WFV RL  FP K++Y+           +        +L  + ++++ WF +IL   ++         D   + ++ L   E   A  D   +N
Sbjct:    7 MAQWLRLRPADAD-----KFPESCWKLLFYLAIWLYAAHLLVKEEYPFYHNPAAVFYDCRYVALRTDMAVPWVLGGLFFCKSLYSYTVFNKMDTSVWKVNSGCLSLKCGMMYTWI-TYHNVGMLALFLHDVTDIQLEFTKLNVYLKTRNNTYHRLNNILSNIGCITFAVSWFVFRLYWFPLKVLYATCVSSMQTVPDIPFYFFFNCLLFTIALMNLYWFSLILMFVMKVVTGRITEVDDVREYDIELKKAEMRPAGGDASNKN 263          
BLAST of Ceramide synthase 5 vs. Ensembl Yeast
Match: LAG1 (Ceramide synthase component; involved in synthesis of ceramide from C26(acyl)-coenzyme A and dihydrosphingosine or phytosphingosine, functionally equivalent to Lac1p; forms ER foci upon DNA replication stress; homolog of human CERS2, a tumor metastasis suppressor gene whose silencing enhances invasion/metastasis of prostate cancer cells; LAG1 has a paralog, LAC1, that arose from the whole genome duplication [Source:SGD;Acc:S000000995])

HSP 1 Score: 71.633 bits (174), Expect = 3.711e-14
Identity = 59/216 (27.31%), Postives = 106/216 (49.07%), Query Frame = 3
Query:  495 IWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVF---FDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSA---FAHIG--LGHFGVHLCQS---------MLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVNDKKKEN 1091
            ++  K M+   P +   P++F    +    +WA    V     +  RKD+ E++ HH+VT+ LI  +++ +F  + + +    D  D+F+  +K L+Y+  ++    +F +F   W   R V+   +I++S    F H G  + +F     +          ++  LQ++++ W  +ILRI L      GI KD RSDS+   SDE A N++ KE 
Sbjct:  201 LFKTKPMYRTYPVIT-NPFLFKIFYLGQAAFWAQQACVLVLQLEKPRKDYKELVFHHIVTLLLIWSSYVFHFTKMGLAIYITMDVSDFFLSLSKTLNYL-NSVFTPFVFGLFVFFWIYLRHVV-NIRILWSVLTEFRHEGNYVLNFATQQYKCWISLPIVFVLIAALQLVNLYWLFLILRI-LYRLIWQGIQKDERSDSD---SDESAENEESKEK 409          
BLAST of Ceramide synthase 5 vs. Ensembl Yeast
Match: LAC1 (Ceramide synthase component; involved in synthesis of ceramide from C26(acyl)-coenzyme A and dihydrosphingosine or phytosphingosine, functionally equivalent to Lag1p; LAC1 has a paralog, LAG1, that arose from the whole genome duplication [Source:SGD;Acc:S000001491])

HSP 1 Score: 46.2098 bits (108), Expect = 4.845e-6
Identity = 47/195 (24.10%), Postives = 88/195 (45.13%), Query Frame = 3
Query:  456 FLIGCWVLSDQEFIWDAKKMWVNVP-FVNITPYMFWYIMIELGYYWAS---LFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAHIGL-GHFGVHLCQS-------------MLCVLQVLHIMWFIMILRI 986
            F I C   SD  F ++ K M+   P F N  P++F    +    +WA    +  +  +  RKD  E+  HH+VT+ LI  +++ +F  + + +    D  D+ +  +K L+Y+    +    F +F VAW   R  I   KI++S        G++ ++                 ++  LQ++++ W  +I R+
Sbjct:  189 FGIYCMYHSDLWF-FNTKAMYRTYPDFTN--PFLFKVFYLGQAAFWAQQACILVLQLEKPRKDHNELTFHHIVTLLLIWSSYVFHFTKMGLPIYITMDVSDFLLSFSKTLNYLDSG-LAFFSFAIFVVAWIYLRHYI-NLKILWSVLTQFRTEGNYVLNFATQQYKCWISLPIVFVLIGALQLVNLYWLFLIFRV 378          
BLAST of Ceramide synthase 5 vs. Ensembl Nematostella
Match: EDO43874 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXN1])

HSP 1 Score: 170.244 bits (430), Expect = 1.742e-49
Identity = 108/352 (30.68%), Postives = 179/352 (50.85%), Query Frame = 3
Query:   33 NDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRK------DFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAHIGLGH-FGVHLC-QSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEE 1064
            +DW      WLP N TW ++ ++  N    +  +L      A  L  LR+  ER I  P  +  G+  +K     +    ++     K P +  I  +S         ++RWFR RR Q+K  +L K KES WRFV+Y    + G  +L  ++++WD    ++      ++  ++ Y ++ELG+Y +   + F DV+RK      DFW+MLIHH+VTI L+  ++   F  +   ++ +HD  D F+EAAK+ +Y K   +C+ LF +F +++FV+RL I+P  ++ S +    L   F       ++L +LQ+LHI W   I+ + +         KD RSD E S  ++E
Sbjct:    9 HDWFWAESFWLPGNTTWAEVHARK-NLRVVQAGELYLCLPIAVALIVLRVAFERLIASPFVQSLGVKDKKINFTPNPFCEKVYQTINKFPPSDRILGLSKQIGWTTREVERWFRHRRMQSKPSLLKKAKESSWRFVFYTGATIYGFCILYKEKWLWDTDHCFIGYHGHVMSEELYIYYVVELGFYVSLTISQFVDVQRKASLRFNDFWQMLIHHIVTILLLSFSYAAAFFRIGAVIVLVHDVSDVFLEAAKVANYAKLRQLCDCLFVLFAISFFVARLFIYPVWVLASVYRANELAEPFNSWFTFMALLIMLQILHIFWGWSII-VVVYRLSHGKYAKDVRSDEESSAVEDE 358          
BLAST of Ceramide synthase 5 vs. Ensembl Nematostella
Match: EDO40047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8D5])

HSP 1 Score: 167.548 bits (423), Expect = 3.269e-48
Identity = 113/359 (31.48%), Postives = 188/359 (52.37%), Query Frame = 3
Query:   39 WILNPRLWLPKNYTWDDLIS-QDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVL----SDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAF--AHIGLGHFGVH-LCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVNDKKKEN 1091
            W  + R+WLP+   W+ + + ++P        D+      A  L  LR+  E  I  PI ++ G+  +K  K   +   E  Y++ ++P    I+D+S+        +++WFRRR  +     + K  ES WRF +YL+  + G  V+    S++ ++W+  + + +     I+  +++Y + ELG Y +  F+ F DVKRKDFW+ ++HH  TI L+  +++  +  +   ++ +HD  D F+E AK+ HY K   IC+VLF + T+ +F SRL+I P  ++ + F  A   +G F V+ +   +L VLQ LHI W   IL IA+ A    G+ +D RSD E    DE       KE 
Sbjct:   14 WFWSERIWLPEITNWEKVKALKNPQAV--ALGDIYLCIPVAVVLIILRIIFENFIARPIVKFLGVKEKKPVKIRESDLCEQVYRKSRKPNKEQIQDLSSRLGWSTQEVEKWFRRRPAKYNLSPMRKATESSWRFFFYLTATIYGFIVIVYKASNENWLWNLDECFKDFNSHVISMELYFYYVAELGMYISLSFSQFTDVKRKDFWQHMVHHASTIALLLYSYIAGYHRIGAVIVFVHDISDIFLEGAKVFHYAKLQKICDVLFGLLTLTFFGSRLMILPFWVLPACFTTATKYVGDFLVYRIMLGLLLVLQTLHIYWAKCILTIAIGAVTGKGV-EDVRSDEEYFTEDENHKKPAVKEE 369          
BLAST of Ceramide synthase 5 vs. Ensembl Nematostella
Match: EDO49866 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REX2])

HSP 1 Score: 78.1814 bits (191), Expect = 1.176e-16
Identity = 63/228 (27.63%), Postives = 104/228 (45.61%), Query Frame = 3
Query:  411 KFKESGWRFVYYLSIFLIGCWVL--------SDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLF-TVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQ---------NIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAHIGLGHFGVHLCQ---------SMLCVLQVLHIMWFIMILRIALQAFDDTG 1013
            KF ES W+ +YY S +   C+VL         D    W   +  + VP    T Y+     ++ G+Y+ S++ TVF D  R D   M+ HH++   LI  ++   +  + + VL LHD  D F+EA K+                 + N  F  F ++WF+ RL ++P K++++       GH G  L +         SML  L  ++I WF  IL + ++  + + 
Sbjct:   15 KFPESAWKLLYYGSAYSFTCYVLFSGKHQFFQDTVLCWKGWRKSMPVPSDIYTIYV-----VQAGFYFHSIYATVFMDKWRADSIVMICHHILANALILFSFATRYHNIGVIVLFLHDISDIFLEATKIFLCFNSRPNGPFRMFGFLVNAGFLSFALSWFICRLYLYPHKVLHTT------GHSGRRLYEDLPFYFFFNSMLWALFAMNIWWFHFILLLIVRVLNGSS 231          
BLAST of Ceramide synthase 5 vs. Ensembl Medaka
Match: CERS5 (ceramide synthase 5 [Source:NCBI gene;Acc:101166550])

HSP 1 Score: 228.794 bits (582), Expect = 1.496e-71
Identity = 126/347 (36.31%), Postives = 197/347 (56.77%), Query Frame = 3
Query:   18 IMNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFA---HIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMS 1049
            + + ++DWI + R WLP+N +W DL +  P   Y +   + Y+   A  +   R+  ER + +P      +      +   N  LE  Y+    P++  ++ +S   + +E  IQRWFR RRNQ+K  + TKF ES WRF +YL IF+ G   L    ++WD ++ W N PF + +P  F+Y + EL +Y + +F+ F D++RKDF+ M +HHL TI LI  ++  N + V   ++ LHD  D F+EAAK+ +Y K   +C+ +F VFT+ +F++RLV+FP  +IYS       I   +    L   +L VLQ LH++WF +I RIA++A     + KD RSD + S
Sbjct:    1 MTSFISDWIWSERFWLPENVSWADLENPPPGVEYPKLGHMVYALPLAVGILLSRLLFERLVAKPCAHILQIQAGVPRRVQPNAVLEKLYQSNTSPSSRDLEGLSKQLDWDERKIQRWFRVRRNQDKPSMQTKFCESMWRFTFYLLIFIYGLSQLWVSPWMWDTRQCWHNYPFQHRSPGQFYYYLAELAFYSSLMFSQFTDIRRKDFFIMFVHHLATILLITFSYTNNMVRVGTMIMSLHDASDIFLEAAKLANYAKYQRLCDSMFVVFTLIFFLTRLVVFPFWVIYSVLFESWEIVGPYRAWWLLNGLLLVLQCLHVIWFYLIARIAIKAIFKGKVAKDDRSDVKRS 347          
BLAST of Ceramide synthase 5 vs. Ensembl Medaka
Match: cers2b (ceramide synthase 2-like [Source:NCBI gene;Acc:101160439])

HSP 1 Score: 228.409 bits (581), Expect = 5.048e-71
Identity = 120/316 (37.97%), Postives = 171/316 (54.11%), Query Frame = 3
Query:   30 VNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKR-QKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAH---IGLGHFGVHLCQSMLCVLQVLHIMW 965
            +++W    RLW PK   W DL+ +D    Y +  DL  +   A     +R   ER +  P+    G+      KA  N  LE  Y    K P+   I  +       E  IQRWFRRRRNQ++  +L KF+E+ WRF +YL  F+ G   L D+ +++D K+MW   P + + P  +WY MIELG+Y + LF+V  DVKRKDF E ++HH+ TI LI  +W  N+I     ++ +HD  DYF+E+AKM +Y      CN +F +F   + V+RL+IFP  IIY  + +   I    FG +    +L  LQ LHI W
Sbjct:    5 LSEWFWQERLWFPKGLGWADLVDRD-GRVYAKANDLWVALPIALVFLIVRQIFERTVATPLASLLGVKETVRLKAPHNPTLECYYCNISKTPSQSSIASLCKQTGSSERQIQRWFRRRRNQDRPSLLKKFREASWRFTFYLLAFIAGLASLIDKPWLYDVKQMWEGFPVMTLLPSQYWYYMIELGFYGSLLFSVASDVKRKDFKEQIVHHVATILLISFSWCVNYIRAGTLIMLVHDSSDYFLESAKMFNYAGWRNACNYIFIIFAAVFIVTRLIIFPFWIIYCTWVYPVTIYKPFFGYYFFNGLLMTLQCLHIFW 319          
BLAST of Ceramide synthase 5 vs. Ensembl Medaka
Match: cers4a (ceramide synthase 2 [Source:NCBI gene;Acc:101175635])

HSP 1 Score: 226.483 bits (576), Expect = 1.260e-69
Identity = 132/362 (36.46%), Postives = 193/362 (53.31%), Query Frame = 3
Query:   21 MNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKR-PTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAHIGLG----HFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVNDKKKEN 1091
            M  +N+W+     WLP    W D    +   ++  P+DL  +   AF    LR   ER +  P+ R  G+  R   +A S  KLE  YK+  R P+   +  +S    L +  IQ WFR RRNQ++ D   KF E+ WRFV+YL+ FL G   L D  + WD  + W   P   +    +WY M+E+G+Y + L +V  DVKRKDF E +IHH+ T+FLI  ++  N++ V   V+ +HD  D  +E+AKMLHY      C+ LF VF V + VSRLV+FP ++I++    + L      FG +   ++L VLQ LHI W  +ILR+  +      + +D RSD E    D E  + + K+ 
Sbjct:   38 MEWLNEWLWREEYWLPPGIGWKDTHLDEDQGHFPLPRDLLCTLPLAFTFIVLRYVFERVVAVPLSRCLGVKDRIRIQAPSVPKLEAFYKQTSRQPSQPEVLALSKQCGLSQRKIQTWFRHRRNQDRPDNTKKFCEASWRFVFYLTAFLGGLGSLIDTPWFWDQTECWRGYPKQAVATAHYWYYMLEMGFYLSLLLSVSVDVKRKDFKEQVIHHIATLFLIGFSYCANYVRVGTLVMLVHDSSDILLESAKMLHYAVWTRTCDSLFVVFAVVFLVSRLVVFPCRVIHTTLL-VSLDFYQPFFGYYFFNALLLVLQALHIFWAYLILRMVNKFIFKGKVERDERSDEESEADDNEDEDKEHKKE 398          
BLAST of Ceramide synthase 5 vs. Ensembl Medaka
Match: cers2a (ceramide synthase 2 [Source:NCBI gene;Acc:101162853])

HSP 1 Score: 223.016 bits (567), Expect = 6.547e-69
Identity = 122/337 (36.20%), Postives = 181/337 (53.71%), Query Frame = 3
Query:   36 DWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEY-KRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAHIGLGH---FGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRS 1034
            DWI     W P+ ++W++L   D    + + +DL  S   AF     R   +  + +P+    G+  +    A  N  LE  + +  K PT   I+++S         +Q WFRRRRNQ +   LTKF+E+ WRF +YL  F  G  VL D+ +  D +K+W + P + +    +WY MIELG+Y + LF+V  DVKRKDFWE ++HH+VTI LI  +WL N++     ++ +HD  DY ME AKM +Y      CN LF  F   + ++RL+I P  I++         H   FGV     +L VLQ+LH  W  +ILR+A++    + I +D RS
Sbjct:   12 DWI-----WFPEGHSWEELKDHD-GKVFPKIQDLWASIPVAFLFLVGRRIFDWKVAKPLAALLGVDLKHRVSASQNPTLESHFCQYSKHPTQSAIENLSKQTGCSVRQVQSWFRRRRNQERPSKLTKFQEASWRFTFYLFAFYAGLAVLIDKPWFQDIRKVWEDFPKMPLLASQYWYYMIELGFYLSLLFSVASDVKRKDFWEQIVHHVVTIVLISFSWLVNYVRAGSLIMLVHDAADYLMELAKMFNYAGWKRTCNFLFVAFAAVFVITRLMILPVWIVFMTLTFPVARHTPFFGVFFFDGLLFVLQILHFFWAGLILRMAIKFLPGSDIVEDERS 342          
BLAST of Ceramide synthase 5 vs. Ensembl Medaka
Match: cers5 (ceramide synthase 5 [Source:NCBI gene;Acc:101175231])

HSP 1 Score: 220.705 bits (561), Expect = 6.222e-68
Identity = 130/361 (36.01%), Postives = 187/361 (51.80%), Query Frame = 3
Query:   21 MNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEY-KRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAF--AHIGLGHFGV-HLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVNDKKKEN 1091
            M   + W  N R WLP N TW DL    P   Y +   L  +   A  +F +R+  ER I     R   +      +A  N  LE  +    K P +  +  +S   + E   +QRWFR RRNQ+K    TKF ES WRF +YL IF  G   L    ++WD +  W   P+  +T  ++ Y + EL +YW+ +F+ F D+KRKDF  M +HHL T+ LI  +++ N   V   VL +HD  D+ +EAAK+ +Y K   +C+ LF +F V +F++RLVI+P  ++ S    +   +G F    L   +L VLQVLHI W  +I RIA++A     + KD RSD E S  DE        ++
Sbjct:    1 MATFSAWFWNERFWLPHNVTWADLADPAPGVEYPKAGHLLTALPLALGIFAVRILFERFIASACARRLHIQPGAGRRAQPNAVLEKVFISITKNPDSRHLDGLSKQLDWEVRKVQRWFRHRRNQDKPSTHTKFCESMWRFTFYLGIFTYGVQFLWQTPWMWDTRHCWYGYPYQVMTRGLYLYYVTELAFYWSLMFSQFRDIKRKDFLIMFVHHLATVGLISFSYVNNMARVGSLVLFVHDTSDFLLEAAKLANYAKSQRLCDFLFILFGVVFFITRLVIYPYWVLNSTMFESWTIVGPFPSWWLFNFLLLVLQVLHIFWSYLIARIAIKAMLRGKVCKDVRSDVESSSEDESNTTTGGSKS 361          
BLAST of Ceramide synthase 5 vs. Planmine SMEST
Match: SMESG000039123.1 (SMESG000039123.1)

HSP 1 Score: 740.339 bits (1910), Expect = 0.000e+0
Identity = 356/357 (99.72%), Postives = 357/357 (100.00%), Query Frame = 3
Query:   21 MNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAHIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVNDKKKEN 1091
            MNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMW+NVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAHIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVNDKKKEN
Sbjct:    1 MNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWINVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAHIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVNDKKKEN 357          
BLAST of Ceramide synthase 5 vs. Planmine SMEST
Match: SMESG000039123.1 (SMESG000039123.1)

HSP 1 Score: 732.25 bits (1889), Expect = 0.000e+0
Identity = 355/363 (97.80%), Postives = 357/363 (98.35%), Query Frame = 3
Query:   21 MNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPT------KIIYSAFAHIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVNDKKKEN 1091
            MNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMW+NVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPT      +IIYSAFAHIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVNDKKKEN
Sbjct:    1 MNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWINVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTNLEGQRRIIYSAFAHIGLGHFGVHLCQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAVNDKKKEN 363          
BLAST of Ceramide synthase 5 vs. Planmine SMEST
Match: SMESG000039123.1 (SMESG000039123.1)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 280/283 (98.94%), Postives = 282/283 (99.65%), Query Frame = 3
Query:   21 MNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKI 869
            MNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMW+NVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPT +
Sbjct:    1 MNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLFFLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKRPTNIVIKDMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVLSDQEFIWDAKKMWINVPFVNITPYMFWYIMIELGYYWASLFTVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVLFTVFTVAWFVSRLVIFPTNL 283          
BLAST of Ceramide synthase 5 vs. Planmine SMEST
Match: SMESG000057441.1 (SMESG000057441.1)

HSP 1 Score: 70.8626 bits (172), Expect = 3.108e-13
Identity = 59/209 (28.23%), Postives = 104/209 (49.76%), Query Frame = 3
Query:  357 IQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGCWVL--SDQEFIWD-AKKMWVNVPFVN------ITPYMFWYIMIELGYYWASLF-TVFFDVKRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKMLHYIKQNIICNVL---------FTVFTVAWFVSRLVIFPTKIIYSAFAHIGLGHFGVHLCQ 926
            + +W R R     SD+ +KF ES W+ + Y + + +  +V+  S    I+    ++W  + F N      I   ++W  + +LG+Y  S+F T+  D  R D   +++HH++T FLI  +++  +  V M VL LHD  D  +E  K+  Y+K    CNV          + VF   W   RL ++P K+++       + ++GV++ Q
Sbjct:   89 LSKWLRVR----PSDI-SKFNESVWKTMVYATFWSLTRYVIITSGNYTIYQYPLRIWKGLTFTNDILKTDIPSDIYWLYVFQLGFYIHSIFATLKLDAWRTDSNMLVLHHILTTFLIGFSFIMRYHMVGMLVLYLHDIADVILEFTKVNVYLKSRPDCNVTINQFCANSGYVVFVSVWAWFRLYLYPLKVLH-------VTNWGVYITQ 285          
The following BLAST results are available for this feature:
BLAST of Ceramide synthase 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CERS21.439e-7337.65ceramide synthase 2 [Source:HGNC Symbol;Acc:HGNC:1... [more]
CERS21.439e-7337.65ceramide synthase 2 [Source:HGNC Symbol;Acc:HGNC:1... [more]
CERS25.628e-6837.66ceramide synthase 2 [Source:HGNC Symbol;Acc:HGNC:1... [more]
CERS42.039e-6735.00ceramide synthase 4 [Source:HGNC Symbol;Acc:HGNC:2... [more]
CERS42.039e-6735.00ceramide synthase 4 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of Ceramide synthase 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hyl-15.622e-4234.27Ceramide synthase hyl-1 [Source:UniProtKB/Swiss-P... [more]
hyl-14.119e-4134.27Ceramide synthase hyl-1 [Source:UniProtKB/Swiss-P... [more]
hyl-14.119e-4134.27Ceramide synthase hyl-1 [Source:UniProtKB/Swiss-P... [more]
hyl-14.719e-4134.27Ceramide synthase hyl-1 [Source:UniProtKB/Swiss-P... [more]
hyl-22.764e-2824.73Ceramide synthase hyl-2 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Ceramide synthase 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
schlank2.584e-6735.88gene:FBgn0040918 transcript:FBtr0070938[more]
schlank2.584e-6735.88gene:FBgn0040918 transcript:FBtr0070937[more]
back to top
BLAST of Ceramide synthase 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cers54.290e-7137.21ceramide synthase 5 [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
cers2b5.587e-6935.05ceramide synthase 2b [Source:ZFIN;Acc:ZDB-GENE-110... [more]
cers2b5.587e-6935.05ceramide synthase 2b [Source:ZFIN;Acc:ZDB-GENE-110... [more]
cers2a2.078e-6734.99ceramide synthase 2a [Source:ZFIN;Acc:ZDB-GENE-020... [more]
cers2a2.078e-6734.99ceramide synthase 2a [Source:ZFIN;Acc:ZDB-GENE-020... [more]
back to top
BLAST of Ceramide synthase 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cers22.244e-7138.86ceramide synthase 2 [Source:NCBI gene;Acc:10003672... [more]
cers28.194e-6637.95ceramide synthase 2 [Source:NCBI gene;Acc:10003672... [more]
cers39.371e-6535.38ceramide synthase 3 [Source:NCBI gene;Acc:448139][more]
cers34.063e-6437.31ceramide synthase 3 [Source:NCBI gene;Acc:448139][more]
ENSXETT00000051557.12.663e-6235.91pep primary_assembly:Xenopus_tropicalis_v9.1:1:738... [more]
back to top
BLAST of Ceramide synthase 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cers21.088e-7337.65ceramide synthase 2 [Source:MGI Symbol;Acc:MGI:192... [more]
Cers52.099e-6635.09ceramide synthase 5 [Source:MGI Symbol;Acc:MGI:191... [more]
Cers52.452e-6434.30ceramide synthase 5 [Source:MGI Symbol;Acc:MGI:191... [more]
Cers42.783e-6433.52ceramide synthase 4 [Source:MGI Symbol;Acc:MGI:191... [more]
Cers61.346e-5834.53ceramide synthase 6 [Source:MGI Symbol;Acc:MGI:244... [more]
back to top
BLAST of Ceramide synthase 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96G23|CERS2_HUMAN6.912e-7337.65Ceramide synthase 2 OS=Homo sapiens OX=9606 GN=CER... [more]
sp|Q924Z4|CERS2_MOUSE7.613e-7337.65Ceramide synthase 2 OS=Mus musculus OX=10090 GN=Ce... [more]
sp|Q3ZBF8|CERS2_BOVIN1.925e-7136.05Ceramide synthase 2 OS=Bos taurus OX=9913 GN=CERS2... [more]
sp|Q5E9R6|CERS4_BOVIN1.944e-7137.01Ceramide synthase 4 OS=Bos taurus OX=9913 GN=CERS4... [more]
sp|Q9HA82|CERS4_HUMAN9.792e-6735.00Ceramide synthase 4 OS=Homo sapiens OX=9606 GN=CER... [more]
back to top
BLAST of Ceramide synthase 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PWC61.130e-8639.94Ceramide synthase 5 OS=Mizuhopecten yessoensis OX=... [more]
A0A1W0WZR11.280e-8139.94Ceramide synthase 2 OS=Hypsibius dujardini OX=2323... [more]
A0A2L2YQ614.722e-7840.90Protein transporter of the tram translocating chai... [more]
A0A3Q0SZ184.784e-7838.66Ceramide synthase 5 OS=Amphilophus citrinellus OX=... [more]
A0A3Q4HQ013.236e-7737.36Ceramide synthase 2a OS=Neolamprologus brichardi O... [more]
back to top
BLAST of Ceramide synthase 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cers2a4.714e-7435.28ceramide synthase 2-like [Source:NCBI gene;Acc:103... [more]
cers51.085e-7136.34ceramide synthase 5 [Source:NCBI gene;Acc:10303512... [more]
cers2b4.425e-6836.20ceramide synthase 2b [Source:ZFIN;Acc:ZDB-GENE-110... [more]
cers4b3.483e-6534.50ceramide synthase 2-like [Source:NCBI gene;Acc:103... [more]
cers3a6.047e-6534.29ceramide synthase 3a [Source:ZFIN;Acc:ZDB-GENE-130... [more]
back to top
BLAST of Ceramide synthase 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009211.17.509e-7036.18pep scaffold:Pmarinus_7.0:GL476916:175486:192535:1... [more]
cers68.681e-6135.42ceramide synthase 6 [Source:ZFIN;Acc:ZDB-GENE-0705... [more]
tram21.278e-821.79translocation associated membrane protein 2 [Sourc... [more]
ENSPMAT00000009225.15.355e-824.50pep scaffold:Pmarinus_7.0:GL487342:1832:7642:1 gen... [more]
ENSPMAT00000010799.15.356e-822.43pep scaffold:Pmarinus_7.0:GL476346:662815:681391:1... [more]
back to top
BLAST of Ceramide synthase 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
LAG13.711e-1427.31Ceramide synthase component; involved in synthesis... [more]
LAC14.845e-624.10Ceramide synthase component; involved in synthesis... [more]
back to top
BLAST of Ceramide synthase 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO438741.742e-4930.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400473.269e-4831.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498661.176e-1627.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ceramide synthase 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CERS51.496e-7136.31ceramide synthase 5 [Source:NCBI gene;Acc:10116655... [more]
cers2b5.048e-7137.97ceramide synthase 2-like [Source:NCBI gene;Acc:101... [more]
cers4a1.260e-6936.46ceramide synthase 2 [Source:NCBI gene;Acc:10117563... [more]
cers2a6.547e-6936.20ceramide synthase 2 [Source:NCBI gene;Acc:10116285... [more]
cers56.222e-6836.01ceramide synthase 5 [Source:NCBI gene;Acc:10117523... [more]
back to top
BLAST of Ceramide synthase 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000039123.10.000e+099.72SMESG000039123.1[more]
SMESG000039123.10.000e+097.80SMESG000039123.1[more]
SMESG000039123.10.000e+098.94SMESG000039123.1[more]
SMESG000057441.13.108e-1328.23SMESG000057441.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003975 ID=SMED30003975|Name=Ceramide synthase 5|organism=Schmidtea mediterranea sexual|type=transcript|length=1188bp
CACTTATTTAAATATTCATTATGAATATAGTGAATGATTGGATATTAAAT
CCAAGACTTTGGTTGCCAAAGAATTACACATGGGATGATCTTATATCTCA
AGATCCAAATTACTATTATGGAGAACCTAAAGACTTAGCCTATTCATTTT
ATACAGCCTTCTTTTTATTTTTTCTTCGAATGTTCGTTGAAAGATGCATT
TGGGAGCCAATTGGTCGATATTTTGGACTAACTCATAGAAAATATTACAA
AGCCGATTCGAATTTAAAGTTAGAAATGGAGTACAAAAGACAAAAACGAC
CGACAAATATCGTCATAAAAGACATGAGCACAATGTACAATTTGGAAGAG
ATTTATATCCAACGATGGTTCCGACGGCGAAGGAATCAAAACAAATCCGA
TGTATTGACGAAATTCAAAGAATCTGGATGGAGATTTGTATATTATCTCT
CAATATTTCTTATTGGATGTTGGGTGCTTAGTGACCAAGAATTTATTTGG
GATGCCAAAAAAATGTGGGTAAATGTTCCATTTGTTAATATCACTCCATA
CATGTTTTGGTATATCATGATCGAATTGGGATACTATTGGGCGTCCTTAT
TTACTGTTTTCTTCGATGTCAAAAGAAAAGATTTCTGGGAAATGCTCATT
CATCATTTGGTGACGATCTTTTTAATTTGCATGGCATGGTTGCAGAATTT
TATCGGAGTGTCAATGTTTGTGTTATGCCTTCATGACTTTGTTGATTATT
TTATGGAGGCTGCAAAAATGCTTCATTACATCAAACAAAATATAATTTGC
AATGTTTTATTTACAGTTTTCACTGTGGCTTGGTTTGTCTCGAGATTGGT
CATCTTTCCAACGAAAATTATTTATTCTGCATTTGCTCACATTGGCTTAG
GTCATTTTGGAGTTCATTTGTGTCAATCAATGCTTTGTGTTTTACAAGTT
TTGCATATCATGTGGTTTATTATGATTCTCAGAATCGCCTTGCAAGCCTT
CGATGACACTGGAATACATAAGGATAGTCGTAGTGATAGTGAAATGTCTC
TTTCTGACGAAGAAGCAGTTAATGATAAAAAAAAAGAAAATTAAATAAGG
GAACTTTGATATAAAATTAATTATTTAAATTTTATTTAGTATGTAATCTT
TTTTATTTAAACAGTTATTATTATTATTATTATTATTA
back to top

protein sequence of SMED30003975-orf-1

>SMED30003975-orf-1 ID=SMED30003975-orf-1|Name=SMED30003975-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=358bp
MNIVNDWILNPRLWLPKNYTWDDLISQDPNYYYGEPKDLAYSFYTAFFLF
FLRMFVERCIWEPIGRYFGLTHRKYYKADSNLKLEMEYKRQKRPTNIVIK
DMSTMYNLEEIYIQRWFRRRRNQNKSDVLTKFKESGWRFVYYLSIFLIGC
WVLSDQEFIWDAKKMWVNVPFVNITPYMFWYIMIELGYYWASLFTVFFDV
KRKDFWEMLIHHLVTIFLICMAWLQNFIGVSMFVLCLHDFVDYFMEAAKM
LHYIKQNIICNVLFTVFTVAWFVSRLVIFPTKIIYSAFAHIGLGHFGVHL
CQSMLCVLQVLHIMWFIMILRIALQAFDDTGIHKDSRSDSEMSLSDEEAV
NDKKKEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006634TLC-dom
IPR001356Homeobox_dom
IPR016439Lag1/Lac1-like
IPR009057Homeobox-like_sf
IPR013599TRAM1
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005783endoplasmic reticulum
GO:0005634nucleus
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0031965nuclear membrane
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0050291sphingosine N-acyltransferase activity
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
GO:0030148sphingolipid biosynthetic process
GO:0046513ceramide biosynthetic process
GO:0048681negative regulation of axon regeneration
GO:1900148negative regulation of Schwann cell migration
GO:1905045negative regulation of Schwann cell proliferation involved in axon regeneration
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006634TRAM/LAG1/CLN8 homology domainSMARTSM00724lag1_27coord: 130..328
e-value: 9.7E-54
score: 194.5
IPR006634TRAM/LAG1/CLN8 homology domainPFAMPF03798TRAM_LAG1_CLN8coord: 131..321
e-value: 3.1E-36
score: 125.0
IPR006634TRAM/LAG1/CLN8 homology domainPROSITEPS50922TLCcoord: 130..328
score: 17.091
IPR016439Sphingosine N-acyltransferase Lag1/Lac1-likePIRSFPIRSF005225LAG1_LAC1coord: 1..357
e-value: 3.1E-77
score: 258.2
IPR016439Sphingosine N-acyltransferase Lag1/Lac1-likePANTHERPTHR12560LONGEVITY ASSURANCE FACTOR 1 LAG1coord: 3..352
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 76..126
e-value: 3.6E-8
score: 35.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 336..357
NoneNo IPR availablePANTHERPTHR12560:SF6CERAMIDE SYNTHASE 4coord: 3..352
NoneNo IPR availableTMHMMTMhelixcoord: 178..200
NoneNo IPR availableTMHMMTMhelixcoord: 291..313
NoneNo IPR availableTMHMMTMhelixcoord: 39..56
NoneNo IPR availableTMHMMTMhelixcoord: 139..158
NoneNo IPR availableTMHMMTMhelixcoord: 257..279
NoneNo IPR availableTMHMMTMhelixcoord: 213..235
IPR013599TRAM1-like proteinPFAMPF08390TRAM1coord: 27..74
e-value: 1.4E-6
score: 27.9
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 73..127
score: 9.313
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 72..125
e-value: 6.68595E-5
score: 38.3785
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 72..126