SJCHGC04698 protein

Overview
NameSJCHGC04698 protein
Smed IDSMED30003974
Length (bp)1661
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SJCHGC04698 protein (SMED30003974) t-SNE clustered cells

Violin plots show distribution of expression levels for SJCHGC04698 protein (SMED30003974) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SJCHGC04698 protein (SMED30003974) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SJCHGC04698 protein (SMED30003974) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003974

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30003974SMESG000023534.1 Contig48328newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30003974SMESG000023534.1 Contig48328uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testis primordiumSMED30003974SMESG000023534.1 Contig5702_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SJCHGC04698 protein vs. TrEMBL
Match: A0A5J4NG94 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0000667 PE=4 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 1.950e-33
Identity = 85/192 (44.27%), Postives = 106/192 (55.21%), Query Frame = 3
Query:  621 FDVDFLEPILFTCEFTKRQVEL-----------------EKVNTSVRLRSFM-----EVKPKATCIDDDPQE-----------------IIELRNESMTQLIQFLTDVSTRYRDVKGNLDVSSLFSLSGGRRFYFDLRDTRWGKRLHISQVTDLHRNVIGIPLESLVSFRDRLNEVIKFLKLDDCQKIKNSL 1079
            F +  L+PI   CE T+  VE+                 EKV  +   R ++     E +P      + P E                 I+EL    M QL  FL DV TRYR V    +V SL+S SGGRRF+FDLRDTRWGKRLHISQVTDLHRNVIGIPLE+LVSFR RL+ VIK L L+D  ++++ +
Sbjct:  172 FQLSKLKPIRIVCEATRCVVEVSAKDPNTKRTANGSEEQEKVVQADPSRRWIVSTPSETRPMTNSSGEQPAENNGGSSNRRRHPWESRGILELHESLMAQLSAFLADVVTRYRSVHELPEVRSLYSASGGRRFFFDLRDTRWGKRLHISQVTDLHRNVIGIPLEALVSFRSRLDTVIKSLGLEDQHQLRSEI 363          
BLAST of SJCHGC04698 protein vs. TrEMBL
Match: A0A4S2MEU7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001812 PE=4 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 2.543e-32
Identity = 67/103 (65.05%), Postives = 80/103 (77.67%), Query Frame = 3
Query:  771 IIELRNESMTQLIQFLTDVSTRYRDVKGNLDVSSLFSLSGGRRFYFDLRDTRWGKRLHISQVTDLHRNVIGIPLESLVSFRDRLNEVIKFLKLDDCQKIKNSL 1079
            I+EL    M QL  FLTDV TRYR V    +V SL+S SGGRRF+FDLRDTRWGKRLHISQVTDLHRNVIGIPLE+LVSFR RL+ +I+ L L+D   +++ +
Sbjct:  257 ILELHESLMPQLSAFLTDVVTRYRSVNQLPEVRSLYSASGGRRFFFDLRDTRWGKRLHISQVTDLHRNVIGIPLEALVSFRARLDMIIRSLSLEDQHVLRSEI 359          
BLAST of SJCHGC04698 protein vs. TrEMBL
Match: A0A074ZVY8 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_03421 PE=4 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 2.934e-32
Identity = 73/140 (52.14%), Postives = 93/140 (66.43%), Query Frame = 3
Query:  771 IIELRNESMTQLIQFLTDVSTRYRDVKGNLDVSSLFSLSGGRRFYFDLRDTRWGKRLHISQVTDLHRNVIGIPLESLVSFRDRLNEVIKFLKLDDCQKIKNSLTNGKSVPNDTNNVEKSRSKNRKHRDIRQGRSKSANSV 1190
            I+EL    M QL  FLTDV TRYR V    +V SL+S SGGRRF+FDLRDTRWGKRLHISQVTDLHRNVIGIPLE+LVSFR RL+ +I+ L L+D   +++ +         T +    R + +    +R G +++A S 
Sbjct:  257 ILELHESLMPQLSAFLTDVVTRYRSVNQLPEVRSLYSASGGRRFFFDLRDTRWGKRLHISQVTDLHRNVIGIPLEALVSFRARLDMIIRSLSLEDQHVLRSEIF------GTTLDGASPRGQRQGDAGLRDGSNEAAESA 390          
BLAST of SJCHGC04698 protein vs. TrEMBL
Match: A0A3R7GBX0 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CSKR_4395s PE=4 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 9.410e-32
Identity = 73/140 (52.14%), Postives = 93/140 (66.43%), Query Frame = 3
Query:  771 IIELRNESMTQLIQFLTDVSTRYRDVKGNLDVSSLFSLSGGRRFYFDLRDTRWGKRLHISQVTDLHRNVIGIPLESLVSFRDRLNEVIKFLKLDDCQKIKNSLTNGKSVPNDTNNVEKSRSKNRKHRDIRQGRSKSANSV 1190
            I+EL    M QL  FLTDV TRYR V    +V SL+S SGGRRF+FDLRDTRWGKRLHISQVTDLHRNVIGIPLE+LVSFR RL+ +I+ L L+D   +++ +         T +    R + +    +R G +++A S 
Sbjct:  257 ILELHESLMPQLSAFLTDVVTRYRSVNQLPEVRSLYSASGGRRFFFDLRDTRWGKRLHISQVTDLHRNVIGIPLEALVSFRARLDMIIRSLSLEDQHVLRSEIF------GTTLDGASPRGQRQGDAGLRDGSNEAAESA 390          
BLAST of SJCHGC04698 protein vs. TrEMBL
Match: A0A183A7M2 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2957 PE=4 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 2.605e-31
Identity = 73/144 (50.69%), Postives = 92/144 (63.89%), Query Frame = 3
Query:  774 IELRNESMTQLIQFLTDVSTRYRDVKGNLDVSSLFSLSGGRRFYFDLRDTRWGKRLHISQVTDLHRNVIGIPLESLVSFRDRLNEVIKFLKLDDCQKIKNSL-------TNGKSVPNDTNNVEKSRSKNRKHRDIRQGRSKSAN 1184
            IEL    M QL  FL DV TRY  V    +V SL+S SGGRRF+FDLRDTRWGKRLHISQVTDLHRNVIGIPLE+LVSFR R++ VI+ LKL+D   +++ +          +++P  T +      +  +  D   G  KSA+
Sbjct:  398 IELHETLMAQLCAFLADVVTRYLSVNPVPEVRSLYSASGGRRFFFDLRDTRWGKRLHISQVTDLHRNVIGIPLETLVSFRARIDAVIQGLKLEDQHTLRSEIYPSLGDRVGARNLPRGTGSPHGRSDEAGESADNASGGRKSAS 541          
BLAST of SJCHGC04698 protein vs. Planmine SMEST
Match: SMESG000023534.1 (SMESG000023534.1)

HSP 1 Score: 661.374 bits (1705), Expect = 0.000e+0
Identity = 337/340 (99.12%), Postives = 339/340 (99.71%), Query Frame = 3
Query:  339 MVYTYICPDMFNPLRPLIRHVVRNRHERKDEYILEIREFHSDYKQRPNPFVVIKDVKKIMPNRNKQFPCWIPVHLCNEVVQYXXXXXXXXXXXXFDVDFLEPILFTCEFTKRQVELEKVNTSVRLRSFMEVKPKATCIDDDPQEIIELRNESMTQLIQFLTDVSTRYRDVKGNLDVSSLFSLSGGRRFYFDLRDTRWGKRLHISQVTDLHRNVIGIPLESLVSFRDRLNEVIKFLKLDDCQKIKNSLTNGKSVPNDTNNVEKSRSKNRKHRDIRQGRSKSANSVSDRKINNAASDDDSDPKSVETQTNHTRDSETNDRETPDKFIIESVKDEIEAAFNEC 1358
            MVYTYICPDMFNPLRPLIRHVVRNRHERKDEYILEIREFHSDYKQRPNPFVVIKDVKKIMPNRNKQFPCWIPVHLCNEVVQYLLSSSSNKEESKFDVDFLEPILFTCEFTKRQVELEKVNTSVRLRSFMEVKPKATCI+DDPQEIIELRNESMTQLIQFLTDVSTRYRDVKGNLDVSSLFSLSGGRRFYFDLRDTRWGKRLHISQVTDLHRNVIGIPLESLVSFRDRLNEVIKFLKLDDCQKIKNSLTNGKSVPNDTNN EKSRSKNRKHRDIRQGRSKSANSVSDRKINNAASDDDSDPKSVETQTNHTRDSETNDRETPDKFII+SVKDEIEAAFNEC
Sbjct:    1 MVYTYICPDMFNPLRPLIRHVVRNRHERKDEYILEIREFHSDYKQRPNPFVVIKDVKKIMPNRNKQFPCWIPVHLCNEVVQYLLSSSSNKEESKFDVDFLEPILFTCEFTKRQVELEKVNTSVRLRSFMEVKPKATCIEDDPQEIIELRNESMTQLIQFLTDVSTRYRDVKGNLDVSSLFSLSGGRRFYFDLRDTRWGKRLHISQVTDLHRNVIGIPLESLVSFRDRLNEVIKFLKLDDCQKIKNSLTNGKSVPNDTNNGEKSRSKNRKHRDIRQGRSKSANSVSDRKINNAASDDDSDPKSVETQTNHTRDSETNDRETPDKFIIDSVKDEIEAAFNEC 340          
BLAST of SJCHGC04698 protein vs. Planmine SMEST
Match: SMESG000023534.1 (SMESG000023534.1)

HSP 1 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 328/331 (99.09%), Postives = 330/331 (99.70%), Query Frame = 3
Query:  366 MFNPLRPLIRHVVRNRHERKDEYILEIREFHSDYKQRPNPFVVIKDVKKIMPNRNKQFPCWIPVHLCNEVVQYXXXXXXXXXXXXFDVDFLEPILFTCEFTKRQVELEKVNTSVRLRSFMEVKPKATCIDDDPQEIIELRNESMTQLIQFLTDVSTRYRDVKGNLDVSSLFSLSGGRRFYFDLRDTRWGKRLHISQVTDLHRNVIGIPLESLVSFRDRLNEVIKFLKLDDCQKIKNSLTNGKSVPNDTNNVEKSRSKNRKHRDIRQGRSKSANSVSDRKINNAASDDDSDPKSVETQTNHTRDSETNDRETPDKFIIESVKDEIEAAFNEC 1358
            MFNPLRPLIRHVVRNRHERKDEYILEIREFHSDYKQRPNPFVVIKDVKKIMPNRNKQFPCWIPVHLCNEVVQYLLSSSSNKEESKFDVDFLEPILFTCEFTKRQVELEKVNTSVRLRSFMEVKPKATCI+DDPQEIIELRNESMTQLIQFLTDVSTRYRDVKGNLDVSSLFSLSGGRRFYFDLRDTRWGKRLHISQVTDLHRNVIGIPLESLVSFRDRLNEVIKFLKLDDCQKIKNSLTNGKSVPNDTNN EKSRSKNRKHRDIRQGRSKSANSVSDRKINNAASDDDSDPKSVETQTNHTRDSETNDRETPDKFII+SVKDEIEAAFNEC
Sbjct:    1 MFNPLRPLIRHVVRNRHERKDEYILEIREFHSDYKQRPNPFVVIKDVKKIMPNRNKQFPCWIPVHLCNEVVQYLLSSSSNKEESKFDVDFLEPILFTCEFTKRQVELEKVNTSVRLRSFMEVKPKATCIEDDPQEIIELRNESMTQLIQFLTDVSTRYRDVKGNLDVSSLFSLSGGRRFYFDLRDTRWGKRLHISQVTDLHRNVIGIPLESLVSFRDRLNEVIKFLKLDDCQKIKNSLTNGKSVPNDTNNGEKSRSKNRKHRDIRQGRSKSANSVSDRKINNAASDDDSDPKSVETQTNHTRDSETNDRETPDKFIIDSVKDEIEAAFNEC 331          
BLAST of SJCHGC04698 protein vs. Planmine SMEST
Match: SMESG000023534.1 (SMESG000023534.1)

HSP 1 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 322/340 (94.71%), Postives = 324/340 (95.29%), Query Frame = 3
Query:  339 MVYTYICPDMFNPLRPLIRHVVRNRHERKDEYILEIREFHSDYKQRPNPFVVIKDVKKIMPNRNKQFPCWIPVHLCNEVVQYXXXXXXXXXXXXFDVDFLEPILFTCEFTKRQVELEKVNTSVRLRSFMEVKPKATCIDDDPQEIIELRNESMTQLIQFLTDVSTRYRDVKGNLDVSSLFSLSGGRRFYFDLRDTRWGKRLHISQVTDLHRNVIGIPLESLVSFRDRLNEVIKFLKLDDCQKIKNSLTNGKSVPNDTNNVEKSRSKNRKHRDIRQGRSKSANSVSDRKINNAASDDDSDPKSVETQTNHTRDSETNDRETPDKFIIESVKDEIEAAFNEC 1358
            MVYTYICPDMFNPLRPLIRHVVRNRHERKDEYILEIREFHSDYKQRPNPFVVIKDVKKIMPNRNKQFPCWIPVHLCNEVVQYLLSSSSNKEESKFDVDFLEPILFTCEFTKRQVELEKVNTSVRLRSFMEVKPKATCI+DDPQEIIELRNESMTQLIQFLTDVSTRYRDVKGNLDVSSLFSLSGGRRFYFDLRDTRWGKRLHISQVTDLHRNVIGIPLESL               LDDCQKIKNSLTNGKSVPNDTNN EKSRSKNRKHRDIRQGRSKSANSVSDRKINNAASDDDSDPKSVETQTNHTRDSETNDRETPDKFII+SVKDEIEAAFNEC
Sbjct:    1 MVYTYICPDMFNPLRPLIRHVVRNRHERKDEYILEIREFHSDYKQRPNPFVVIKDVKKIMPNRNKQFPCWIPVHLCNEVVQYLLSSSSNKEESKFDVDFLEPILFTCEFTKRQVELEKVNTSVRLRSFMEVKPKATCIEDDPQEIIELRNESMTQLIQFLTDVSTRYRDVKGNLDVSSLFSLSGGRRFYFDLRDTRWGKRLHISQVTDLHRNVIGIPLESL---------------LDDCQKIKNSLTNGKSVPNDTNNGEKSRSKNRKHRDIRQGRSKSANSVSDRKINNAASDDDSDPKSVETQTNHTRDSETNDRETPDKFIIDSVKDEIEAAFNEC 325          
BLAST of SJCHGC04698 protein vs. Planmine SMEST
Match: SMESG000023534.1 (SMESG000023534.1)

HSP 1 Score: 602.438 bits (1552), Expect = 0.000e+0
Identity = 313/331 (94.56%), Postives = 315/331 (95.17%), Query Frame = 3
Query:  366 MFNPLRPLIRHVVRNRHERKDEYILEIREFHSDYKQRPNPFVVIKDVKKIMPNRNKQFPCWIPVHLCNEVVQYXXXXXXXXXXXXFDVDFLEPILFTCEFTKRQVELEKVNTSVRLRSFMEVKPKATCIDDDPQEIIELRNESMTQLIQFLTDVSTRYRDVKGNLDVSSLFSLSGGRRFYFDLRDTRWGKRLHISQVTDLHRNVIGIPLESLVSFRDRLNEVIKFLKLDDCQKIKNSLTNGKSVPNDTNNVEKSRSKNRKHRDIRQGRSKSANSVSDRKINNAASDDDSDPKSVETQTNHTRDSETNDRETPDKFIIESVKDEIEAAFNEC 1358
            MFNPLRPLIRHVVRNRHERKDEYILEIREFHSDYKQRPNPFVVIKDVKKIMPNRNKQFPCWIPVHLCNEVVQYLLSSSSNKEESKFDVDFLEPILFTCEFTKRQVELEKVNTSVRLRSFMEVKPKATCI+DDPQEIIELRNESMTQLIQFLTDVSTRYRDVKGNLDVSSLFSLSGGRRFYFDLRDTRWGKRLHISQVTDLHRNVIGIPLESL               LDDCQKIKNSLTNGKSVPNDTNN EKSRSKNRKHRDIRQGRSKSANSVSDRKINNAASDDDSDPKSVETQTNHTRDSETNDRETPDKFII+SVKDEIEAAFNEC
Sbjct:    1 MFNPLRPLIRHVVRNRHERKDEYILEIREFHSDYKQRPNPFVVIKDVKKIMPNRNKQFPCWIPVHLCNEVVQYLLSSSSNKEESKFDVDFLEPILFTCEFTKRQVELEKVNTSVRLRSFMEVKPKATCIEDDPQEIIELRNESMTQLIQFLTDVSTRYRDVKGNLDVSSLFSLSGGRRFYFDLRDTRWGKRLHISQVTDLHRNVIGIPLESL---------------LDDCQKIKNSLTNGKSVPNDTNNGEKSRSKNRKHRDIRQGRSKSANSVSDRKINNAASDDDSDPKSVETQTNHTRDSETNDRETPDKFIIDSVKDEIEAAFNEC 316          
The following BLAST results are available for this feature:
BLAST of SJCHGC04698 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04698 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04698 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04698 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04698 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04698 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04698 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04698 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NG941.950e-3344.27Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A4S2MEU72.543e-3265.05Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A074ZVY82.934e-3252.14Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A3R7GBX09.410e-3252.14Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A183A7M22.605e-3150.69Uncharacterized protein OS=Echinostoma caproni OX=... [more]
back to top
BLAST of SJCHGC04698 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04698 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04698 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04698 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04698 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC04698 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000023534.10.000e+099.12SMESG000023534.1[more]
SMESG000023534.10.000e+099.09SMESG000023534.1[more]
SMESG000023534.10.000e+094.71SMESG000023534.1[more]
SMESG000023534.10.000e+094.56SMESG000023534.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003974 ID=SMED30003974|Name=SJCHGC04698 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1661bp
CAAATTTTGACTACGGCAGCATACAAATTTAAATTTATATTAAATAGCAC
CATTATGCTATCCGGCATTTTATTAAACAGGTTTTTATTTTCCAAAACAA
AAGATATTATGAATTCCTTACAAAGTGTAGTGAATTTAGTCGCAAATCAA
GCTTGAGTAACTGAAAATTTTATTATGATTTTAATCATTATTTTCAATAA
TCTGAAAATCTAAATTTATACAAATATCAATCGAAAAATGAATTTGAAAA
TTTAATCAATGTAACCAAAACAATATTTTACTTTTAAATTTCAATTTGCT
ATAGCAAATTATTCTTTAAATTTTATATTTATCAAGTTATGGTATATACT
TACATTTGTCCTGATATGTTCAATCCATTGCGTCCTTTAATACGACATGT
CGTTAGGAATCGACATGAAAGAAAAGATGAATATATTCTAGAAATAAGAG
AATTTCATTCTGATTACAAACAACGACCAAATCCATTCGTTGTCATAAAG
GATGTGAAAAAAATCATGCCAAATCGAAACAAACAGTTCCCATGTTGGAT
ACCTGTTCATTTATGTAATGAAGTCGTTCAATATCTATTAAGTTCCTCGT
CGAATAAAGAGGAGTCGAAGTTTGATGTTGATTTTCTCGAACCGATTTTG
TTTACTTGTGAATTTACGAAACGTCAAGTGGAATTGGAAAAAGTTAATAC
TTCGGTTCGTTTGCGTAGTTTCATGGAAGTTAAACCGAAAGCGACTTGCA
TTGATGACGACCCACAGGAAATAATCGAACTCAGAAATGAATCAATGACT
CAATTAATACAGTTTTTGACGGACGTATCAACGAGATATAGAGATGTTAA
AGGAAACTTAGATGTGAGTTCATTGTTTAGTCTGTCGGGAGGCAGGCGAT
TTTACTTTGACCTAAGAGACACAAGGTGGGGTAAACGATTGCATATTTCT
CAAGTGACAGATTTGCATCGAAATGTTATTGGAATTCCTCTCGAAAGTCT
CGTTAGTTTTCGTGATAGATTGAATGAAGTGATCAAGTTTCTAAAGCTCG
ATGATTGTCAAAAGATCAAGAATTCTCTGACTAACGGAAAAAGTGTGCCG
AACGATACAAATAACGTTGAGAAATCCCGATCGAAAAACCGCAAGCATCG
AGACATCAGACAAGGCCGATCAAAATCGGCTAACAGCGTTTCCGACAGAA
AGATCAACAATGCCGCCTCGGACGATGACAGTGATCCGAAATCAGTAGAA
ACCCAAACGAATCACACGAGAGATTCGGAAACCAATGATCGAGAAACCCC
AGACAAATTTATCATAGAATCAGTGAAAGATGAAATTGAAGCCGCGTTCA
ATGAATGTTAAAATTATTTTTTCATAGTTAATTTGTTCGATAGAGTCGTA
ATGTTGTGATTATCAAGTGTTCCCAGCGGAGAAATTCTGATTTGCATACG
TGTTTGTTTGCTTTTAAGTCACTTTTATTTAATACAATTTGTTTTTAATG
CAGTTTACTGGAATTGTTTAAATTTTGTTTACGTTAGATTTCTCATATGA
TAACCGGCAATCATTAGCATCAATGCAATTACTGATTAACATTAATGAAA
CAATGGTTCAAATAGGCAATTAAAATTATTCTCATAAATGTATTTTTAAT
TGAAATACGAC
back to top

protein sequence of SMED30003974-orf-1

>SMED30003974-orf-1 ID=SMED30003974-orf-1|Name=SMED30003974-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=341bp
MVYTYICPDMFNPLRPLIRHVVRNRHERKDEYILEIREFHSDYKQRPNPF
VVIKDVKKIMPNRNKQFPCWIPVHLCNEVVQYLLSSSSNKEESKFDVDFL
EPILFTCEFTKRQVELEKVNTSVRLRSFMEVKPKATCIDDDPQEIIELRN
ESMTQLIQFLTDVSTRYRDVKGNLDVSSLFSLSGGRRFYFDLRDTRWGKR
LHISQVTDLHRNVIGIPLESLVSFRDRLNEVIKFLKLDDCQKIKNSLTNG
KSVPNDTNNVEKSRSKNRKHRDIRQGRSKSANSVSDRKINNAASDDDSDP
KSVETQTNHTRDSETNDRETPDKFIIESVKDEIEAAFNEC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000977RNA polymerase II regulatory region sequence-specific DNA binding
GO:0032422purine-rich negative regulatory element binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR006628PUR-bd_fam
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006628Purine-rich element binding protein familyPFAMPF04845PurAcoord: 142..232
e-value: 6.6E-8
score: 32.1
NoneNo IPR availableGENE3DG3DSA:3.10.450.700coord: 169..240
e-value: 3.8E-12
score: 47.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 248..324
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 290..324