Zinc finger and SCAN domain-containing protein 2

Overview
NameZinc finger and SCAN domain-containing protein 2
Smed IDSMED30003965
Length (bp)5197
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger and SCAN domain-containing protein 2 (SMED30003965) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger and SCAN domain-containing protein 2 (SMED30003965) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger and SCAN domain-containing protein 2 (SMED30003965) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger and SCAN domain-containing protein 2 (SMED30003965) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003965

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30003965SMESG000031886.1 SmedASXL_011996SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30003965SMESG000031886.1 SmedASXL_011996SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30003965SMESG000031886.1 dd_Smed_v4_2890_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30003965SMESG000081298.1 SMESG000023765.1 SMESG000016276.1 SMESG000004841.1 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003965SMESG000081298.1 SMESG000023765.1 SMESG000016276.1 SMESG000004841.1 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003965SMESG000081298.1 SMESG000023765.1 SMESG000016276.1 SMESG000004841.1 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003965SMESG000081298.1 SMESG000023765.1 SMESG000016276.1 SMESG000004841.1 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003965SMESG000081298.1 SMESG000023765.1 SMESG000016276.1 SMESG000004841.1 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003965SMESG000031886.1 Contig37080uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003965SMESG000031886.1 Contig37080newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30003965SMESG000031886.1 dd_Smed_v4_2890_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Human
Match: ZNF333 (zinc finger protein 333 [Source:HGNC Symbol;Acc:HGNC:15624])

HSP 1 Score: 112.464 bits (280), Expect = 2.309e-24
Identity = 81/307 (26.38%), Postives = 124/307 (40.39%), Query Frame = 3
Query:  318 SGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHE-----------------LREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGH 1187
            S ++ V + I +   +Y C  C +S++ ++   +H +     K + C++C Q ++  S L  H  RTH          G   F C  C         +  H+R HTG KP+ C  CGK F Q +++++H   H   ++ F C  CGKAF  +     HLRT   E                 L  H ++    KL   C  C      +  L  H R+       E  + C+ C   FS+  +L+ H ++H G +  +C  CG      F Q +H I         R + C  CE  F     L  H
Sbjct:  350 SAHLIVPEKIRSGDKSYACNKCEKSFRYSSDLIRHEKTHTAEKCFDCQECGQAFKYSSNLRRHM-RTHT---------GEKPFECSQCGKTFTRNFNLILHQRNHTGEKPYECKDCGKAFNQPSSLRSHVRTHT-GEKPFECSQCGKAFREHSSLKTHLRTHTREKPYECNQCGKPFRTSTHLNVHKRIHTGEKL-YECATCGQVLSRLSTLKSHMRT----HTGEKPYVCQECGRAFSEPSSLRKHARTHSGKKPYACQECGR----AFGQSSHLIVHVRTHSAGRPYQCNQCEKAFRHSSSLTVH 636          

HSP 2 Score: 65.4698 bits (158), Expect = 7.482e-10
Identity = 42/145 (28.97%), Postives = 61/145 (42.07%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRT 800
            Y C  C + ++ +     H R     K+Y C  C Q    LS L  H R TH          G   + C +C    +   ++  H R H+G KP++C  CG+ F Q +++  H   H    R ++C  C KAF        H RT
Sbjct:  506 YECNQCGKPFRTSTHLNVHKRIHTGEKLYECATCGQVLSRLSTLKSHMR-THT---------GEKPYVCQECGRAFSEPSSLRKHARTHSGKKPYACQECGRAFGQSSHLIVHVRTH-SAGRPYQCNQCEKAFRHSSSLTVHKRT 639          

HSP 3 Score: 56.6102 bits (135), Expect = 4.395e-7
Identity = 39/148 (26.35%), Postives = 62/148 (41.89%), Query Frame = 3
Query:  303 NQTG----SSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRI 734
            NQ G    +S ++ V + I      Y C +C Q     +    HMR     K Y C++C + +   S L  HAR TH          G   + C +C         +  H R H+  +P+ C+ C K F   +++  HK  H+ ++ I
Sbjct:  509 NQCGKPFRTSTHLNVHKRIHTGEKLYECATCGQVLSRLSTLKSHMRTHTGEKPYVCQECGRAFSEPSSLRKHAR-TH---------SGKKPYACQECGRAFGQSSHLIVHVRTHSAGRPYQCNQCEKAFRHSSSLTVHKRTHVGRETI 646          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Human
Match: ZNF774 (zinc finger protein 774 [Source:HGNC Symbol;Acc:HGNC:33108])

HSP 1 Score: 107.842 bits (268), Expect = 1.651e-23
Identity = 83/349 (23.78%), Postives = 146/349 (41.83%), Query Frame = 3
Query:  144 SLFASGNVQTLSNDDEIIQVSDSGIISDTIVQLEGESY--------HVISDENGQTYLAPTNQTG--SSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTF 1160
            +L   G +++ S + ++ ++ D  +    +    G+S+        H+ +    + Y       G   S ++   +        Y+C  C + + +++   KH R     + Y C +C + +     L +H +RTH          G   + C +C+   +       H+R HTGVKP+ C+ CG+ F+Q +++  H+  H   +R F+C  CGK F     ++AH+ T             S +    C  C+ +F    +L  H R+       E  F C++C   F+D   L  H + H G +   C  CG+     FNQ +H IT       +R + C  C  TF
Sbjct:  123 TLPGEGQLESFSQERDLNKLLDGYVGEKPMCAECGKSFNQSSYLIRHLRTHTGERPYTCIECGKGFKQSSDLVTHRRTHTGEKPYQCKGCEKKFSDSSTLIKHQRTHTGERPYECPECGKTFGRKPHLIMH-QRTHT---------GEKPYACLECHKSFSRSSNFITHQRTHTGVKPYRCNDCGESFSQSSDLIKHQRTHT-GERPFKCPECGKGFRDSSHFVAHMSTH------------SGERPFSCPDCHKSFSQSSHLVTHQRT----HTGERPFKCENCGKGFADSSALIKHQRIHTGERPYKCGECGK----SFNQSSHFITHQRIHLGDRPYRCPECGKTF 440          

HSP 2 Score: 96.6709 bits (239), Expect = 8.276e-20
Identity = 74/281 (26.33%), Postives = 117/281 (41.64%), Query Frame = 3
Query:  372 CPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEER 1214
            C  C +S+  ++   +H+R     + YTC +C + ++  S L  H RRTH          G   + C  C    ++  T+  H+R HTG +P+ C  CGK F +K ++  H+  H   ++ + C  C K+F+    ++ H RT             +      C  C  +F    +L KH R+       E  F C  C   F D     +H+ +H G +  SCP C +     F+Q +H +T        R   C  C   F     L  H   +H+ ER
Sbjct:  153 CAECGKSFNQSSYLIRHLRTHTGERPYTCIECGKGFKQSSDLVTH-RRTHT---------GEKPYQCKGCEKKFSDSSTLIKHQRTHTGERPYECPECGKTFGRKPHLIMHQRTHT-GEKPYACLECHKSFSRSSNFITHQRTH------------TGVKPYRCNDCGESFSQSSDLIKHQRT----HTGERPFKCPECGKGFRDSSHFVAHMSTHSGERPFSCPDCHK----SFSQSSHLVTHQRTHTGERPFKCENCGKGFADSSALIKH-QRIHTGER 401          

HSP 3 Score: 87.4261 bits (215), Expect = 6.898e-17
Identity = 63/247 (25.51%), Postives = 98/247 (39.68%), Query Frame = 3
Query:  312 GSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVC 1052
            G   ++ + Q        Y C  C +S+  ++ F  H R    VK Y C  C + +   S L  H +RTH          G   F CP+C     +      H   H+G +PFSC  C K F+Q +++ TH+  H   +R F+CE CGK F      + H            Q I + +    C  C  +F+   +   H R    +   +  + C  C   F+      +H ++H G +   C  C
Sbjct:  245 GRKPHLIMHQRTHTGEKPYACLECHKSFSRSSNFITHQRTHTGVKPYRCNDCGESFSQSSDLIKH-QRTHT---------GERPFKCPECGKGFRDSSHFVAHMSTHSGERPFSCPDCHKSFSQSSHLVTHQRTHT-GERPFKCENCGKGFADSSALIKH------------QRIHTGERPYKCGECGKSFNQSSHFITHQR----IHLGDRPYRCPECGKTFNQRSHFLTHQRTHTGEKPFHCSKC 464          

HSP 4 Score: 83.5741 bits (205), Expect = 1.275e-15
Identity = 63/240 (26.25%), Postives = 95/240 (39.58%), Query Frame = 3
Query:  318 SGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQII 1037
            S N    Q        YRC  C +S+  ++   KH R     + + C +C + +   S    H   TH          G   F CPDC+   +    +  H+R HTG +PF C+ CGK FA  + +  H+  H   +R ++C  CGK+FN    ++ H            Q I        C  C  TF+   +   H R+       E  F C  C+  F      K+H+  H+   +I
Sbjct:  275 SSNFITHQRTHTGVKPYRCNDCGESFSQSSDLIKHQRTHTGERPFKCPECGKGFRDSSHFVAHMS-TH---------SGERPFSCPDCHKSFSQSSHLVTHQRTHTGERPFKCENCGKGFADSSALIKHQRIHT-GERPYKCGECGKSFNQSSHFITH------------QRIHLGDRPYRCPECGKTFNQRSHFLTHQRT----HTGEKPFHCSKCNKSFRQ----KAHLLCHQNTHLI 483          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Human
Match: ZNF583 (zinc finger protein 583 [Source:HGNC Symbol;Acc:HGNC:26427])

HSP 1 Score: 108.227 bits (269), Expect = 2.838e-23
Identity = 83/306 (27.12%), Postives = 127/306 (41.50%), Query Frame = 3
Query:  318 SGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHE-------LREHFQMIA---------SSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGH 1187
            S N+A  + I      Y C  C +++       +H R     K Y C++C++ +  ++ L  H +R H          G   F C +C    +NG  +  H+R HTG KP+ C++CGK F+ +  +  H+  H   +R + C+ C KAF+ Y     H R    E        R+ F  IA         + +    C+ C   F +  +L +H RS       E  + CK C   FS    L  H + H G +   C VCG + F     L  H  R H     R + C+ C  +F  +  L  H
Sbjct:  252 SANLAQHKRIHTGEKPYECKECRKAFSQNAHLAQHQRVHTGEKPYQCKECKKAFSQIAHLTQH-QRVHT---------GERPFECIECGKAFSNGSFLAQHQRIHTGEKPYVCNVCGKAFSHRGYLIVHQRIHT-GERPYECKECRKAFSQYAHLAQHQRVHTGEKPYECKVCRKAFSQIAYLDQHQRVHTGEKPYECIECGKAFSNSSSLAQHQRS----HTGEKPYMCKECRKTFSQNAGLAQHQRIHTGEKPYECNVCG-KAFSYSGSLTLH-QRIHT--GERPYECKDCRKSFRQRAHLAHH 538          

HSP 2 Score: 85.1149 bits (209), Expect = 6.288e-16
Identity = 68/252 (26.98%), Postives = 105/252 (41.67%), Query Frame = 3
Query:  570 CPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHT 1325
            C DC  + N   ++  H+R HTG KP++C  CGK F+Q AN+  HK  H   ++ + C+ C KAF S + +LA             Q + + +    C  C   F  + +L +H R    +   E  F C  C   FS+   L  H + H G +   C VCG+     F+   + I         R + C+ C   F     L  H   +H+ E+             C+   C    + +  +D+H R HT
Sbjct:  214 CNDCEKVFNQSSSLTLHQRIHTGEKPYACVECGKTFSQSANLAQHKRIHT-GEKPYECKECRKAF-SQNAHLA-----------QHQRVHTGEKPYQCKECKKAFSQIAHLTQHQR----VHTGERPFECIECGKAFSNGSFLAQHQRIHTGEKPYVCNVCGK----AFSHRGYLIVHQRIHTGERPYECKECRKAFSQYAHLAQH-QRVHTGEKP----------YECKV--CRKAFSQIAYLDQHQRVHT 431          

HSP 3 Score: 82.4185 bits (202), Expect = 4.261e-15
Identity = 69/267 (25.84%), Postives = 109/267 (40.82%), Query Frame = 3
Query:  387 QSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGH 1187
            +SY+  +   KH +     K+  C  CE+ +   S L LH +R H          G   + C +C    +    +  H+R HTG KP+ C  C K F+Q A++  H+  H   ++ ++C+ C KAF+     +AHL           Q + + +    C+ C   F +   L +H R    +   E  + C  C   FS    L  H + H G +   C  C  + F  +  L  H  R H     + + C+ C   F     LD H
Sbjct:  191 KSYRKKSVEMKHRKVYVEKKLLKCNDCEKVFNQSSSLTLH-QRIHT---------GEKPYACVECGKTFSQSANLAQHKRIHTGEKPYECKECRKAFSQNAHLAQHQRVHT-GEKPYQCKECKKAFSQ----IAHLTQH--------QRVHTGERPFECIECGKAFSNGSFLAQHQR----IHTGEKPYVCNVCGKAFSHRGYLIVHQRIHTGERPYECKEC-RKAFSQYAHLAQH-QRVHT--GEKPYECKVCRKAFSQIAYLDQH 426          

HSP 4 Score: 57.3806 bits (137), Expect = 2.464e-7
Identity = 33/126 (26.19%), Postives = 58/126 (46.03%), Query Frame = 3
Query:  339 QTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRH 716
            Q +      Y C  C +++ N+++  +H R     K Y C++C + +   + L  H +R H          G   + C  C    +  G++  H+R HTG +P+ C  C K F Q+A++  H+  H
Sbjct:  427 QRVHTGEKPYECIECGKAFSNSSSLAQHQRSHTGEKPYMCKECRKTFSQNAGLAQH-QRIHT---------GEKPYECNVCGKAFSYSGSLTLHQRIHTGERPYECKDCRKSFRQRAHLAHHERIH 542          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Human
Match: ZNF583 (zinc finger protein 583 [Source:HGNC Symbol;Acc:HGNC:26427])

HSP 1 Score: 108.227 bits (269), Expect = 2.838e-23
Identity = 83/306 (27.12%), Postives = 127/306 (41.50%), Query Frame = 3
Query:  318 SGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHE-------LREHFQMIA---------SSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGH 1187
            S N+A  + I      Y C  C +++       +H R     K Y C++C++ +  ++ L  H +R H          G   F C +C    +NG  +  H+R HTG KP+ C++CGK F+ +  +  H+  H   +R + C+ C KAF+ Y     H R    E        R+ F  IA         + +    C+ C   F +  +L +H RS       E  + CK C   FS    L  H + H G +   C VCG + F     L  H  R H     R + C+ C  +F  +  L  H
Sbjct:  252 SANLAQHKRIHTGEKPYECKECRKAFSQNAHLAQHQRVHTGEKPYQCKECKKAFSQIAHLTQH-QRVHT---------GERPFECIECGKAFSNGSFLAQHQRIHTGEKPYVCNVCGKAFSHRGYLIVHQRIHT-GERPYECKECRKAFSQYAHLAQHQRVHTGEKPYECKVCRKAFSQIAYLDQHQRVHTGEKPYECIECGKAFSNSSSLAQHQRS----HTGEKPYMCKECRKTFSQNAGLAQHQRIHTGEKPYECNVCG-KAFSYSGSLTLH-QRIHT--GERPYECKDCRKSFRQRAHLAHH 538          

HSP 2 Score: 85.1149 bits (209), Expect = 6.288e-16
Identity = 68/252 (26.98%), Postives = 105/252 (41.67%), Query Frame = 3
Query:  570 CPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHT 1325
            C DC  + N   ++  H+R HTG KP++C  CGK F+Q AN+  HK  H   ++ + C+ C KAF S + +LA             Q + + +    C  C   F  + +L +H R    +   E  F C  C   FS+   L  H + H G +   C VCG+     F+   + I         R + C+ C   F     L  H   +H+ E+             C+   C    + +  +D+H R HT
Sbjct:  214 CNDCEKVFNQSSSLTLHQRIHTGEKPYACVECGKTFSQSANLAQHKRIHT-GEKPYECKECRKAF-SQNAHLA-----------QHQRVHTGEKPYQCKECKKAFSQIAHLTQHQR----VHTGERPFECIECGKAFSNGSFLAQHQRIHTGEKPYVCNVCGK----AFSHRGYLIVHQRIHTGERPYECKECRKAFSQYAHLAQH-QRVHTGEKP----------YECKV--CRKAFSQIAYLDQHQRVHT 431          

HSP 3 Score: 82.4185 bits (202), Expect = 4.261e-15
Identity = 69/267 (25.84%), Postives = 109/267 (40.82%), Query Frame = 3
Query:  387 QSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGH 1187
            +SY+  +   KH +     K+  C  CE+ +   S L LH +R H          G   + C +C    +    +  H+R HTG KP+ C  C K F+Q A++  H+  H   ++ ++C+ C KAF+     +AHL           Q + + +    C+ C   F +   L +H R    +   E  + C  C   FS    L  H + H G +   C  C  + F  +  L  H  R H     + + C+ C   F     LD H
Sbjct:  191 KSYRKKSVEMKHRKVYVEKKLLKCNDCEKVFNQSSSLTLH-QRIHT---------GEKPYACVECGKTFSQSANLAQHKRIHTGEKPYECKECRKAFSQNAHLAQHQRVHT-GEKPYQCKECKKAFSQ----IAHLTQH--------QRVHTGERPFECIECGKAFSNGSFLAQHQR----IHTGEKPYVCNVCGKAFSHRGYLIVHQRIHTGERPYECKEC-RKAFSQYAHLAQH-QRVHT--GEKPYECKVCRKAFSQIAYLDQH 426          

HSP 4 Score: 57.3806 bits (137), Expect = 2.464e-7
Identity = 33/126 (26.19%), Postives = 58/126 (46.03%), Query Frame = 3
Query:  339 QTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRH 716
            Q +      Y C  C +++ N+++  +H R     K Y C++C + +   + L  H +R H          G   + C  C    +  G++  H+R HTG +P+ C  C K F Q+A++  H+  H
Sbjct:  427 QRVHTGEKPYECIECGKAFSNSSSLAQHQRSHTGEKPYMCKECRKTFSQNAGLAQH-QRIHT---------GEKPYECNVCGKAFSYSGSLTLHQRIHTGERPYECKDCRKSFRQRAHLAHHERIH 542          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Human
Match: ZNF497 (zinc finger protein 497 [Source:HGNC Symbol;Acc:HGNC:23714])

HSP 1 Score: 106.686 bits (265), Expect = 4.880e-23
Identity = 79/274 (28.83%), Postives = 112/274 (40.88%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGH 1187
            Y CP C +++  ++  ++H R     K Y CR+C + +   SQL +H + TH          G   F CPDC        T+  HRR HTG KP+ C  CGK F+  +N   H+  H    R   C  CGKAF+               L EH ++ A ++    C  C   F  +  L +H R+       E  F C  C   F +   L  H ++H G +   C  CG+    G     H   R H     + H C  C   F  + +L  H
Sbjct:  134 YTCPECGKAFAWSSNLSQHQRIHSGEKPYACRECGKAFRAHSQL-IHHQETH---------SGLKPFRCPDCGKSFGRSTTLVQHRRTHTGEKPYECPECGKAFSWNSNFLEHRRVHT-GARPHACRDCGKAFSQSS-----------NLAEHLKIHAGAR-PHACPDCGKAFVRVAGLRQHRRT----HSSEKPFPCAECGKAFRESSQLLQHQRTHTGERPFECAECGQAFVMGSYLAEH--RRVHT--GEKPHACAQCGKAFSQRSNLLSH 376          

HSP 2 Score: 103.99 bits (258), Expect = 4.007e-22
Identity = 72/247 (29.15%), Postives = 102/247 (41.30%), Query Frame = 3
Query:  318 SGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGE 1058
            S N+A    I      + CP C +++       +H R     K + C +C + +   SQL  H +RTH          G   F C +C      G  +  HRR HTG KP +C  CGK F+Q++N+ +H+  H    + F C  CGKAF      LAH R           +  + +    C  C   F     L +H R    L   E  F C  C   F     L SH ++H G +  +C  CG+
Sbjct:  258 SSNLAEHLKIHAGARPHACPDCGKAFVRVAGLRQHRRTHSSEKPFPCAECGKAFRESSQLLQH-QRTHT---------GERPFECAECGQAFVMGSYLAEHRRVHTGEKPHACAQCGKAFSQRSNLLSHRRTHS-GAKPFACADCGKAFRG-SSGLAHHR-----------LSHTGERPFACAECGKAFRGSSELRQHQR----LHSGERPFVCAHCSKAFVRKSELLSHRRTHTGERPYACGECGK 477          

HSP 3 Score: 75.8702 bits (185), Expect = 3.391e-13
Identity = 51/187 (27.27%), Postives = 74/187 (39.57%), Query Frame = 3
Query:  570 CPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRS-----------CGILKQMETKF-------------CCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGE 1058
            C +C    + G  +  HRR HTG KP++C  CGK FA  +N+  H+  H   ++ + C  CGKAF ++   +            H Q   S      C  C  +F     L +H R+           CG      + F              C+ C   FS    L  H+K H G +  +CP CG+
Sbjct:  108 CGECGKAFSQGSYLLQHRRVHTGEKPYTCPECGKAFAWSSNLSQHQRIHS-GEKPYACRECGKAFRAHSQLI------------HHQETHSGLKPFRCPDCGKSFGRSTTLVQHRRTHTGEKPYECPECGKAFSWNSNFLEHRRVHTGARPHACRDCGKAFSQSSNLAEHLKIHAGARPHACPDCGK 281          

HSP 4 Score: 53.5286 bits (127), Expect = 3.279e-6
Identity = 29/117 (24.79%), Postives = 52/117 (44.44%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRH 716
            + C  C ++++ ++    H       + + C +C + +   S+L  H R           + G   F C  C+        +  HRR HTG +P++C  CGK F+ + N+  H+ RH
Sbjct:  386 FACADCGKAFRGSSGLAHHRLSHTGERPFACAECGKAFRGSSELRQHQR----------LHSGERPFVCAHCSKAFVRKSELLSHRRTHTGERPYACGECGKPFSHRCNLNEHQKRH 492          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 102.449 bits (254), Expect = 1.440e-22
Identity = 95/371 (25.61%), Postives = 188/371 (50.67%), Query Frame = 2
Query: 3665 DFSDKISI-ISVVLLLAASGIISNKLYYINPLQCYTAVHPTGEKIDKFINAYTWTHGT--IP-KSAFSNQLPETKAQWIDVYDKYGIQYYQWIPFILILQAAMLYLPILLWDHCCSFAMRIDLVSVFNEARNALYKGDEARKKSIEKIXXXXXXXXXXXXXXXXXIAKIRRKIRNWMIAYTFSQSQRNFLFSSYIGLKVLSLVMCMIEIAMLH-FMFNINLIS----MISYFQGAPNDISLSFPIETYGLLSDLRVLGADNIYYSECRLTVNMINEKLFVMXXXXXXXXXXXXXXXXXXXXXRVKVFYRQMRTIKKVFKIKGIEIPDSKLLKEFVCEFLKTDGIFLINMLERNAGDLVSTDVVYELWLKYS 4750
            DF DK++   +  ++ A + I+S K Y   P+QC+     T +  +++   Y W   T  +P  SAF  +  + +A+         I YYQW+PF+L L+A   Y+P ++W     +   I++ S+   A +A     +AR  +++ I+  +E  L           +I+R++ + +      +   N++   Y+ +K+L L   ++++ ML+ F+   NL      +     G   ++S +FP  T     ++RVLG  + +  +C L +NM NEK+F+ +W    ++  +  +S+  WI    +  + M+ I+K  +   +   D + +K+FV +FL  DG+F + M+  +AGD+++T+++  LW  ++
Sbjct:   20 DFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFT-DAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRAR--------QISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDAL-----------EIQREVTD-VSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDF-EVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLA-TDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFN 367          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 102.449 bits (254), Expect = 1.440e-22
Identity = 95/371 (25.61%), Postives = 188/371 (50.67%), Query Frame = 2
Query: 3665 DFSDKISI-ISVVLLLAASGIISNKLYYINPLQCYTAVHPTGEKIDKFINAYTWTHGT--IP-KSAFSNQLPETKAQWIDVYDKYGIQYYQWIPFILILQAAMLYLPILLWDHCCSFAMRIDLVSVFNEARNALYKGDEARKKSIEKIXXXXXXXXXXXXXXXXXIAKIRRKIRNWMIAYTFSQSQRNFLFSSYIGLKVLSLVMCMIEIAMLH-FMFNINLIS----MISYFQGAPNDISLSFPIETYGLLSDLRVLGADNIYYSECRLTVNMINEKLFVMXXXXXXXXXXXXXXXXXXXXXRVKVFYRQMRTIKKVFKIKGIEIPDSKLLKEFVCEFLKTDGIFLINMLERNAGDLVSTDVVYELWLKYS 4750
            DF DK++   +  ++ A + I+S K Y   P+QC+     T +  +++   Y W   T  +P  SAF  +  + +A+         I YYQW+PF+L L+A   Y+P ++W     +   I++ S+   A +A     +AR  +++ I+  +E  L           +I+R++ + +      +   N++   Y+ +K+L L   ++++ ML+ F+   NL      +     G   ++S +FP  T     ++RVLG  + +  +C L +NM NEK+F+ +W    ++  +  +S+  WI    +  + M+ I+K  +   +   D + +K+FV +FL  DG+F + M+  +AGD+++T+++  LW  ++
Sbjct:   20 DFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFT-DAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRAR--------QISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDAL-----------EIQREVTD-VSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDF-EVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLA-TDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFN 367          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 102.449 bits (254), Expect = 2.557e-22
Identity = 95/371 (25.61%), Postives = 188/371 (50.67%), Query Frame = 2
Query: 3665 DFSDKISI-ISVVLLLAASGIISNKLYYINPLQCYTAVHPTGEKIDKFINAYTWTHGT--IP-KSAFSNQLPETKAQWIDVYDKYGIQYYQWIPFILILQAAMLYLPILLWDHCCSFAMRIDLVSVFNEARNALYKGDEARKKSIEKIXXXXXXXXXXXXXXXXXIAKIRRKIRNWMIAYTFSQSQRNFLFSSYIGLKVLSLVMCMIEIAMLH-FMFNINLIS----MISYFQGAPNDISLSFPIETYGLLSDLRVLGADNIYYSECRLTVNMINEKLFVMXXXXXXXXXXXXXXXXXXXXXRVKVFYRQMRTIKKVFKIKGIEIPDSKLLKEFVCEFLKTDGIFLINMLERNAGDLVSTDVVYELWLKYS 4750
            DF DK++   +  ++ A + I+S K Y   P+QC+     T +  +++   Y W   T  +P  SAF  +  + +A+         I YYQW+PF+L L+A   Y+P ++W     +   I++ S+   A +A     +AR  +++ I+  +E  L           +I+R++ + +      +   N++   Y+ +K+L L   ++++ ML+ F+   NL      +     G   ++S +FP  T     ++RVLG  + +  +C L +NM NEK+F+ +W    ++  +  +S+  WI    +  + M+ I+K  +   +   D + +K+FV +FL  DG+F + M+  +AGD+++T+++  LW  ++
Sbjct:   20 DFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFT-DAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRAR--------QISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDAL-----------EIQREVTD-VSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDF-EVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLAT-DRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFN 367          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Celegans
Match: unc-9 (Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O01393])

HSP 1 Score: 97.4413 bits (241), Expect = 6.393e-21
Identity = 107/375 (28.53%), Postives = 184/375 (49.07%), Query Frame = 2
Query: 3665 DFSDKISIISVVLLLAASGI-ISNKLYYINPLQCYTAVHPTGEKIDKFINAYTWTHGT--IPKSAFSNQLPETKAQWIDVYDKYGIQYYQWIPFILILQAAMLYLPILLWDHCCSFAMRIDLVSVFNEARNALYKGDEARKKSIEKIXXXXXXXXXXXXXXXXXIAKIRRKIRNWMIAYTFSQSQRNFLFSSYIGLKVLSLVMCMIEIAMLH-FMFN----INLISMISYFQGAPNDISLSFPIETYGLLSD--LRVLGADNIYYSECRLTVNMINEKLFVMXXXXXXXXXXXXXXXXXXXXXRVKVFYRQMRTIKKVFK-IKGIEIPDSKLLKEFVCEFLKTDGIFLINMLERNAGDLVSTDVVYELWLKYSTN 4756
            D  DK++      ++    I +S K Y   P+QC+     T E ++++   Y W   T  +P     + +P   A+     +   I YYQW+PF+L L+A + Y+P ++W    S+   I + S+   A ++     E+R ++++ I+ ++E  L  K +    ++  R K+ N +I    S +   FL   YI +K+L  V  + +I +L+ F+ N      L  +     G   + S  FP  T   L D  ++VLG  + +  +C L +NM NEK+F+ +W    ++    L SL  WI    V  RQ+  + K    I+G ++ DS+ L+ FV  FL+ DG+FL+ M+  +AG+L   ++   LW  Y  N
Sbjct:   22 DIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLP---LHDYIPHNYAE----RENRQIGYYQWVPFVLALEALLFYVPTIVW-RLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQV---MSGNRLKLLNLIICTRSSGAAVTFL---YISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVT---LCDFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDN 378          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Celegans
Match: inx-19 (Innexin-19 [Source:UniProtKB/Swiss-Prot;Acc:O61715])

HSP 1 Score: 95.5153 bits (236), Expect = 4.340e-20
Identity = 99/395 (25.06%), Postives = 173/395 (43.80%), Query Frame = 2
Query: 3665 DFSDKISIISVVLLLAASG-IISNKLYYINPLQCYTAVHPTGEKIDKFINAYTWTHGTIPKSAFSNQLPETKAQWIDVYDKYGIQYYQWIPFILILQAAMLYLPILLWDHCCSFAMRIDLVSVFNEARNALYKGDEA-RKKSIEKIXXXXXXXXXXXXXXXXXIAKIRRKIRNWMIAYTFSQ-----------SQRNFLFSSYIGLKVLSLVMCMIEIAMLHFMFNINLISMISYFQGAPNDISLSFPIETYGLLSDLRVLGADNIYYSECRLTVNMINEKLFVM-----XXXXXXXXXXXXXXXXXXXXXRVKVFY----------RQMRTIKKVFKIKGIE------IPDSKLLKEFVCEFLKTDGIFLINMLERNAGDLVSTDVVYELWLKY 4747
            D  D+++     L+LA    +IS K Y   P++C+   H + E ++++I +Y W   T     + N   +  A+     ++  I YYQW+PFILI +A M  LP + W   CSF   +++ ++ N A +     D + R+K++E I+ +    L  +          R + R W+    FS+           S    L+S  +  + L L  C+     L F F +    +   + G P   +  FP  T     ++R L   N Y  +C L +N+INEK+F       + + ++            +I   KV Y           + + ++K  K   +E           LL  FV +FLK+DG+ ++ M+  +AGD++   +V  LW ++
Sbjct:   22 DAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPH-SRESMEEYIESYCWIQNTYWIPMYENVPDDHTAR-----EEKQIGYYQWVPFILIAEALMFSLPCIFW-RLCSFQSGLNIQTLINAACDGQALLDASDRQKAVEAITTNFVDNLDLQS------PNGRIRARGWIARIKFSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLKSSDFLFFGFQV----LNDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQEF 398          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Fly
Match: Meics (gene:FBgn0025874 transcript:FBtr0333030)

HSP 1 Score: 102.449 bits (254), Expect = 1.012e-21
Identity = 82/296 (27.70%), Postives = 123/296 (41.55%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTRE-----------------HELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSH----EGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHI 1190
            ++CP CP++Y +      HM      K + C QC++ + T   L  H +R          + G   + CPDC         ++ H R H   +PF C++CGK F Q  ++ TH   H + DR F+C  C K+F      + H RT                   H L+ H + I + +    C  C   F +  +L KHT     +   +  F C  C   +    +L+ H K+H    E   +  CP C  R F     L+ HIT +H +   R H C  C   F S+K L  H+
Sbjct:  288 FKCPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQR----------HTGERPYKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVH-NGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLR-IHTGEKPYKCDQCGKGFSANQSLMKHT--LWHVDNNDRPFKCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVR-FALKKTLDKHIT-SHKI---RPHPCPQCPEGFFSQKSLKKHL 564          

HSP 2 Score: 98.5969 bits (244), Expect = 1.617e-20
Identity = 67/251 (26.69%), Postives = 111/251 (44.22%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALK 1118
            Y+CP CPQ++   +    H R     + + C  C + +     L  H R           + G+ +F CPDC+        M  H+R H+G+KPF C+ CG+ F+   ++K+H   H   ++ ++C+ CGK F++    + H              + ++     C  C   +D+  +L  H ++     + +T   C  CD  F+   TL  H+ SH+  +   CP C E GF     L  H+ R H LK
Sbjct:  344 YKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLR----------VHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHT-GEKPYKCDQCGKGFSANQSLMKHT----------LWHVDNNDRPFKCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKI-RPHPCPQCPE-GFFSQKSLKKHL-RLHNLK 570          

HSP 3 Score: 92.0485 bits (227), Expect = 1.868e-18
Identity = 97/401 (24.19%), Postives = 152/401 (37.91%), Query Frame = 3
Query:  102 VVISEETLDMNTLQSLFASGNVQT---LSNDDEIIQVSDSGIISDTIVQLEGESYHVISDENGQTYLAPTNQTGSSGNIAVAQTIDNNGI--------------TYRCPSCPQSYQNANAFT----KHMREKHFVKVYTCRQCEQFYETLSQLFLHARR----------------THVDXXXXXXXXGN-YKFH-CPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGH 1187
            +V  E+ LD N  +      +V+T      D +   V+ + I ++  V ++        +EN         +      +   +  D   I              +  C  C  SY    A      KH  +    K + C  C + + T +QL  H RR                TH    K   +  +  K H CP C+      G +  H + HTG +P+ C  C + FA+ + +K H   H  ++R F+CE CGK F      + HLR            + +      C  C+ +F    N+ KH R+   +K     F C+ C   FS    LKSH++ H G +   C  CG +GF     L  H T  H    +R   C  C   +++++ L GH
Sbjct:  123 IVGCEDPLDTNVTKLDANRPDVKTDIDEPTDGKATNVTMNDIKTEDEVSIQETFEDAFDEENDNNNTDSEREDSDQWTVGSTEDQDEPWIPGGGGRQTVGGNNQSLLCTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGERPFKCPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDCPQTFAKNSGLKLHSRLH-KEERPFKCELCGKGFVQNQHLITHLR------------VHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIK----PFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCG-KGFSANQSLMKH-TLWHVDNNDRPFKCSQCPKAYDTQQSLRGH 504          

HSP 4 Score: 64.3142 bits (155), Expect = 8.751e-10
Identity = 54/226 (23.89%), Postives = 84/226 (37.17%), Query Frame = 3
Query:  345 IDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHI-HKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSH 1019
            + N    ++CP C +S+   +   KH R    +K + C +C        Q F H                                  ++ H R HTG KP+ CD CGK F+   ++  H   H+ + DR F+C  C KA+++      H +T ++            K +  C  C+  F     L+KH  S  I         C  C   F    +LK H++ H
Sbjct:  393 VHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCEEC-------GQAFSHNHH-------------------------------LKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEKTHKNP--------DEPKTLHQCPHCDVRFALKKTLDKHITSHKIRPHP-----CPQCPEGFFSQKSLKKHLRLH 567          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Fly
Match: Meics (gene:FBgn0025874 transcript:FBtr0075791)

HSP 1 Score: 102.064 bits (253), Expect = 1.205e-21
Identity = 82/296 (27.70%), Postives = 123/296 (41.55%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTRE-----------------HELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSH----EGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHI 1190
            ++CP CP++Y +      HM      K + C QC++ + T   L  H +R          + G   + CPDC         ++ H R H   +PF C++CGK F Q  ++ TH   H + DR F+C  C K+F      + H RT                   H L+ H + I + +    C  C   F +  +L KHT     +   +  F C  C   +    +L+ H K+H    E   +  CP C  R F     L+ HIT +H +   R H C  C   F S+K L  H+
Sbjct:  300 FKCPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQR----------HTGERPYKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVH-NGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLR-IHTGEKPYKCDQCGKGFSANQSLMKHT--LWHVDNNDRPFKCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVR-FALKKTLDKHIT-SHKI---RPHPCPQCPEGFFSQKSLKKHL 576          

HSP 2 Score: 98.5969 bits (244), Expect = 1.619e-20
Identity = 67/251 (26.69%), Postives = 111/251 (44.22%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALK 1118
            Y+CP CPQ++   +    H R     + + C  C + +     L  H R           + G+ +F CPDC+        M  H+R H+G+KPF C+ CG+ F+   ++K+H   H   ++ ++C+ CGK F++    + H              + ++     C  C   +D+  +L  H ++     + +T   C  CD  F+   TL  H+ SH+  +   CP C E GF     L  H+ R H LK
Sbjct:  356 YKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLR----------VHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHT-GEKPYKCDQCGKGFSANQSLMKHT----------LWHVDNNDRPFKCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHK-IRPHPCPQCPE-GFFSQKSLKKHL-RLHNLK 582          

HSP 3 Score: 91.6633 bits (226), Expect = 2.622e-18
Identity = 83/300 (27.67%), Postives = 122/300 (40.67%), Query Frame = 3
Query:  354 NGITYRCPSCPQSYQNANAFT----KHMREKHFVKVYTCRQCEQFYETLSQLFLHARR----------------THVDXXXXXXXXGN-YKFH-CPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGH 1187
            N  +  C  C  SY    A      KH  +    K + C  C + + T +QL  H RR                TH    K   +  +  K H CP C+      G +  H + HTG +P+ C  C + FA+ + +K H   H  ++R F+CE CGK F      + HLR            + +      C  C+ +F    N+ KH R+   +K     F C+ C   FS    LKSH++ H G +   C  CG +GF     L  H T  H    +R   C  C   +++++ L GH
Sbjct:  236 NNQSLLCTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGERPFKCPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDCPQTFAKNSGLKLHSRLH-KEERPFKCELCGKGFVQNQHLITHLR------------VHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIK----PFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCG-KGFSANQSLMKH-TLWHVDNNDRPFKCSQCPKAYDTQQSLRGH 516          

HSP 4 Score: 64.3142 bits (155), Expect = 8.035e-10
Identity = 54/226 (23.89%), Postives = 84/226 (37.17%), Query Frame = 3
Query:  345 IDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHI-HKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSH 1019
            + N    ++CP C +S+   +   KH R    +K + C +C        Q F H                                  ++ H R HTG KP+ CD CGK F+   ++  H   H+ + DR F+C  C KA+++      H +T ++            K +  C  C+  F     L+KH  S  I         C  C   F    +LK H++ H
Sbjct:  405 VHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCEEC-------GQAFSHNHH-------------------------------LKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEKTHKNP--------DEPKTLHQCPHCDVRFALKKTLDKHITSHKIRPHP-----CPQCPEGFFSQKSLKKHLRLH 579          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Fly
Match: CG12299 (gene:FBgn0032295 transcript:FBtr0080113)

HSP 1 Score: 98.2117 bits (243), Expect = 3.647e-20
Identity = 85/339 (25.07%), Postives = 132/339 (38.94%), Query Frame = 3
Query:  321 GNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHEL-------REHFQMIASSKLI-----------LGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAH-------------ALKVNRRH---VCRYCESTFESKKDLDGHISDMHSEERNARQSRG 1235
            G   +   ++ N   ++C  C  S+ NA   +KH+R     K + C  C++ +  +  L  H R           + G   + C  C        ++  H R+H+  KP  C  C K F   +++  H+  HI     F C  C + F +  +   H+R    EL       RE F+  ASS+L+             C  C+ +F    +LN H R    +   E  F CK CD  F+   +L  H+K H G +   CP+CG + +     LN HI +AH              L   + H   VC  C S       L  H+   H+   +  +  G
Sbjct:  239 GAPVMDPALNGNQKCFQCTHCEASFPNAGDLSKHVRSHITNKPFQCSICQKTFTHIGSLNTHIR----------IHSGEKPYKCELCPKAFTQSSSLMVHMRSHSVRKPHQCVQCDKGFINYSSLLLHQKTHIAPTETFICPECEREFKAEALLDEHMRMHTQELVYQCAICREAFR--ASSELVQHMKNHMGEKPFTCSLCDRSFTQSGSLNIHMR----IHTGEKPFQCKLCDKCFTQASSLSVHMKIHAGEKPYPCPICG-KSYSQQAYLNKHI-QAHQMASAASASTSPGLLVAKQPHETLVCIVCGSLHADATALASHVHSQHAALLDTMKQSG 559          

HSP 2 Score: 77.7962 bits (190), Expect = 7.373e-14
Identity = 67/278 (24.10%), Postives = 104/278 (37.41%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHT----------------------------GVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRS------------CGIL--KQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPG 1073
            Y+C  CP+++  +++   HMR     K + C QC++ +   S L LH ++TH+             F CP+C         ++ H R HT                            G KPF+C +C + F Q  ++  H   H   ++ F+C+ C K F           T+   L  H ++ A  K    C  C  ++     LNKH ++             G+L  KQ      C  C S  +D   L SHV S     + +    G    PG
Sbjct:  310 YKCELCPKAFTQSSSLMVHMRSHSVRKPHQCVQCDKGFINYSSLLLH-QKTHI--------APTETFICPECEREFKAEALLDEHMRMHTQELVYQCAICREAFRASSELVQHMKNHMGEKPFTCSLCDRSFTQSGSLNIHMRIHT-GEKPFQCKLCDKCF-----------TQASSLSVHMKIHAGEK-PYPCPICGKSYSQQAYLNKHIQAHQMASAASASTSPGLLVAKQPHETLVCIVCGSLHADATALASHVHSQHAALLDTMKQSGMNTAPG 565          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Fly
Match: CG6654 (gene:FBgn0038301 transcript:FBtr0083139)

HSP 1 Score: 93.5893 bits (231), Expect = 7.988e-19
Identity = 80/315 (25.40%), Postives = 128/315 (40.63%), Query Frame = 3
Query:  312 GSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFV-KVYTCRQCEQFYETLSQLFLHA----------------RRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCG----ERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHIS 1193
            G S     A T +   + Y C  C   +    +   H R+K  + + Y C +CE+ + +   L  H                  +  +     + +  N +  C  C  +     T+  H R HTG KPF C+ICGK F Q AN++ HK RH  + + F+CE C  +F +     +H RT  H   + F+          C  C   F +  +L KH R        E  + C  C   F+ +  LK+H ++H G +   CP C     +RG    +Q  H        +  R ++C  C   F+S  ++  H++
Sbjct:  314 GPSTTSGAATTPE---LKYHCDRCNAGFAVEKSLMIHRRQKGCINRNYKCNECEKVFVSPDHLAEHQASHGAHNCPECGIRCDSKEALSKHMVQGHKRNLRNQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANLRQHKLRH-SETKSFKCELCPHSFVTKAELTSHART--HTGDKPFE----------CEVCLARFTTSCSLAKHKRK----HTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRTH--------QGERIYICPVCNEEFKSMPEMRSHLA 600          

HSP 2 Score: 68.5514 bits (166), Expect = 3.843e-11
Identity = 44/161 (27.33%), Postives = 69/161 (42.86%), Query Frame = 3
Query:  363 TYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTRE-HELR-EHFQMIA 839
            +++C  CP S+      T H R     K + C  C   + T   L  H R+          + G   + C  C         +++HRR HTG +P+ C  C K F Q+ + + H+  H   +RI+ C  C + F S     +HL   E H+ R  HF  ++
Sbjct:  467 SFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAKHKRK----------HTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRTH-QGERIYICPVCNEEFKSMPEMRSHLAGHEQHDKRLVHFTFLS 616          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Fly
Match: CG15436 (gene:FBgn0031610 transcript:FBtr0077442)

HSP 1 Score: 87.0409 bits (214), Expect = 1.467e-17
Identity = 77/303 (25.41%), Postives = 114/303 (37.62%), Query Frame = 3
Query:  153 ASGNVQTLSNDDEI-IQVSDSGIISDTIVQLEGESYHVISDENGQTYLA-PTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCG 1055
            A G  QT     +   +V D GI       LE E + +  DE+ +   A   +  G S         D+  + + C  C + YQ    F +HMR     + + C  C++ +     L  H + TH              + C  C        T++ H R HTG +PF C  C K F + ++++ H   H   +R F+C  C K F           TR+  L  HF+     +    C  C   F    +L +H+R    L   +  F C  C   F    TLK H   H   +   CP C 
Sbjct:   62 AYGIRQTCEESHQFYCRVRDEGIEDALCALLEEEDWEISEDEDARIDSASAADDDGKS---------DSKKVAFECRECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKAHMK-TH---------NAAKPYECSHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTH-GSERPFKCSKCTKTF-----------TRKFHLDNHFRSHTGER-PFKCSHCPKAFAMKQHLKQHSR----LHLPDRPFRCSHCPKTFRLSSTLKEHKLVHNAERTFKCPHCA 328          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Zebrafish
Match: BX936382.1 (pep chromosome:GRCz11:4:64530121:64542903:-1 gene:ENSDARG00000100262.2 transcript:ENSDART00000143176.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX936382.1)

HSP 1 Score: 120.168 bits (300), Expect = 1.164e-27
Identity = 89/300 (29.67%), Postives = 131/300 (43.67%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHE-----------------LREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEER 1214
            + C  C +S+ N+    +HMR     K +TC QC + +   S L +H R           + G   F CP C    +    +  H R HTG KPF+C  CGK F+Q +++  H   H   ++ F C  CGK+FN   I   H+R    E                 L +H ++    KL   C  C  +F +  NLN+H R    +   E  F C  C   FS    L  H++ H G +  +CP CG + F     LNHH+ R H  +  +   C  C  +F    +L+ H+ + HS E+
Sbjct:  122 FTCTQCGKSFSNSANLNQHMRIHTGEKPFTCTQCGKSFSQSSYLNIHMR----------IHTGEKPFTCPQCGKSFSQSQYLNQHMRIHTGEKPFTCSQCGKSFSQSSSLNLHIRIHT-GEKPFTCTQCGKSFNKSSILNIHMRNHTGEKPFTCLQCGKSFSQSTSLNQHMRIHTGEKLFT-CTQCGKSFSNSANLNQHMR----IHTGEKPFTCSQCGKSFSQSSYLNIHMRIHTGEKPFTCPQCG-KSFSQSPYLNHHM-RIHTGE--KPFTCTQCGKSFSQSSNLNIHMRN-HSGEK 400          

HSP 2 Score: 101.293 bits (251), Expect = 1.859e-21
Identity = 78/283 (27.56%), Postives = 121/283 (42.76%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEER 1214
            + C  C +S  N +    HMR  +  K++TC QC + +   S L  H R           + G   F C  C    +N   +  H R HTG KPF+C  CGK F+Q + +  H   H   ++ F C  CGK+F+       H+R            I + +    C  C  +F    +LN H R    +   E  F C  C   F+    L  H+++H G +  +C  CG + F     LN H+ R H  +  +   C  C  +F +  +L+ H+  +H+ E+
Sbjct:   66 FTCNQCGKSLANKSKLKIHMRIHNREKLFTCTQCGKNFNQSSHLNQHMR----------IHTGEKPFTCTQCGKSFSNSANLNQHMRIHTGEKPFTCTQCGKSFSQSSYLNIHMRIHT-GEKPFTCPQCGKSFSQSQYLNQHMR------------IHTGEKPFTCSQCGKSFSQSSSLNLHIR----IHTGEKPFTCTQCGKSFNKSSILNIHMRNHTGEKPFTCLQCG-KSFSQSTSLNQHM-RIHTGE--KLFTCTQCGKSFSNSANLNQHM-RIHTGEK 316          

HSP 3 Score: 94.7449 bits (234), Expect = 2.342e-19
Identity = 64/223 (28.70%), Postives = 97/223 (43.50%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQI 1034
            + C  C +S+ N+    +HMR     K +TC QC + +   S L +H R           + G   F CP C    +    + HH R HTG KPF+C  CGK F+Q +N+  H   H   ++ F C  C K+F+       H+            MI + +    C+ C  TF +   L +H R    +   E  + C  C   F+   TLK+H + H G ++
Sbjct:  290 FTCTQCGKSFSNSANLNQHMRIHTGEKPFTCSQCGKSFSQSSYLNIHMR----------IHTGEKPFTCPQCGKSFSQSPYLNHHMRIHTGEKPFTCTQCGKSFSQSSNLNIHMRNHS-GEKPFTCTQCEKSFSQSTSLNRHM------------MIHTGEKEFMCLKCEKTFITAAELKRHQR----VHTGEKTYKCSQCSKRFARSGTLKTHERIHTGEKL 485          

HSP 4 Score: 88.1965 bits (217), Expect = 2.289e-17
Identity = 62/232 (26.72%), Postives = 95/232 (40.95%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGER 1061
            + C  C +S+  + +  +HMR     K++TC QC + +   + L  H R           + G   F C  C    +    +  H R HTG KPF+C  CGK F+Q   +  H   H   ++ F C  CGK+F+       H+R              S +    C  C  +F    +LN+H     ++   E +F C  C+  F     LK H + H G +   C  C +R
Sbjct:  262 FTCLQCGKSFSQSTSLNQHMRIHTGEKLFTCTQCGKSFSNSANLNQHMR----------IHTGEKPFTCSQCGKSFSQSSYLNIHMRIHTGEKPFTCPQCGKSFSQSPYLNHHMRIHT-GEKPFTCTQCGKSFSQSSNLNIHMRNH------------SGEKPFTCTQCEKSFSQSTSLNRHM----MIHTGEKEFMCLKCEKTFITAAELKRHQRVHTGEKTYKCSQCSKR 466          

HSP 5 Score: 70.0922 bits (170), Expect = 1.413e-11
Identity = 63/234 (26.92%), Postives = 97/234 (41.45%), Query Frame = 3
Query:  513 RTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEER 1214
            +TH++     K      F C  C     N   ++ H R H   K F+C  CGK+F Q +++  H   H   ++ F C  CGK+F++      H+R            I + +    C  C  +F     LN H R    +   E  F C  C   FS    L  H++ H G +  +C  CG + F   + LN HI R H  +  +   C  C  +F     L+ H+ + H+ E+
Sbjct:   49 KTHLETDDILKMRDKRCFTCNQCGKSLANKSKLKIHMRIHNREKLFTCTQCGKNFNQSSHLNQHMRIHT-GEKPFTCTQCGKSFSNSANLNQHMR------------IHTGEKPFTCTQCGKSFSQSSYLNIHMR----IHTGEKPFTCPQCGKSFSQSQYLNQHMRIHTGEKPFTCSQCG-KSFSQSSSLNLHI-RIHTGE--KPFTCTQCGKSFNKSSILNIHMRN-HTGEK 260          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Zebrafish
Match: znf1042 (zinc finger protein 1042 [Source:ZFIN;Acc:ZDB-GENE-120703-14])

HSP 1 Score: 119.013 bits (297), Expect = 1.254e-27
Identity = 102/388 (26.29%), Postives = 159/388 (40.98%), Query Frame = 3
Query:   99 MVVISEETLDMNTLQSLFASGNVQTLSNDDEIIQVSDSGIISDTIVQLEGESYHVISDENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILG----------------CMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEER 1214
            MV I EE+ D+   ++            D  +++    G       Q   +   +++DE        T +T S G +  +++    G  + C  C +S+   +    HMR     + YTC QC + +  +     H R           + G  KF C +C       G    H R HTG KPFSC  CGK F+QK+N+  H   H  +++ + CE CGK+F     + AH+R    E +   Q    S    G                C  C  +F    NL+ H R    +   E  + C+ C   FS   +  +H++ H G +  SC  CG+  F   N L+ H+ R H     + H C  C  +F  K+DL  H+  +H+ E+
Sbjct:    1 MVFIKEESEDVKIEETFTVKQEDLQEQTDLMVLKEETHGQNEIDEKQQFQKPQEIMTDEK----PTLTKKTSSHGRLRKSKS----GCNFSCKQCRKSFSQKSKLDVHMRVHTREQPYTCEQCGKSFGQIQGFKAHMR----------IHTGEGKFTCQECGKSFYQAGNFAAHMRIHTGEKPFSCKQCGKSFSQKSNLDVHMRVHT-REQPYTCEQCGKSFGQIQSFKAHMRIHTGEGKFTCQECGKSFYQAGNFAAHMRIHTGEKPFSCKQCGKSFSQKSNLDVHMR----VHTREQPYTCEQCGKSFSQKQSFNTHMRIHTGEKPFSCKQCGKSFFQKPN-LDVHM-RVHT--GEKPHTCEQCGKSFGQKQDLYIHMR-IHTGEK 360          

HSP 2 Score: 103.99 bits (258), Expect = 1.455e-22
Identity = 77/284 (27.11%), Postives = 112/284 (39.44%), Query Frame = 3
Query:  318 SGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTR-----------SCGI-------------LKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHI 1097
            +GN A    I      + C  C +S+   +    HMR     + YTC QC + +  +     H R           + G  KF C +C       G    H R HTG KPFSC  CGK F+QK+N+  H   H  +++ + CE CGK+F+    +  H+R            I + +    C  C  +F    NL+ H R            CG              +   E  + C  C   F  I TLK H++ H G +  +C  CG + F     L +H+
Sbjct:  150 AGNFAAHMRIHTGEKPFSCKQCGKSFSQKSNLDVHMRVHTREQPYTCEQCGKSFGQIQSFKAHMR----------IHTGEGKFTCQECGKSFYQAGNFAAHMRIHTGEKPFSCKQCGKSFSQKSNLDVHMRVHT-REQPYTCEQCGKSFSQKQSFNTHMR------------IHTGEKPFSCKQCGKSFFQKPNLDVHMRVHTGEKPHTCEQCGKSFGQKQDLYIHMRIHTGEKPYTCTECGKSFPHISTLKHHMRIHTGEKPFACAQCG-KSFTTKTSLKNHM 409          

HSP 3 Score: 95.1301 bits (235), Expect = 9.480e-20
Identity = 66/231 (28.57%), Postives = 95/231 (41.13%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGE 1058
            + C  C +S+  A  F  HMR     K ++C+QC + +   S L +H R  H              + C  C    +   +   H R HTG KPFSC  CGK F QK N+  H   H   ++   CE CGK+F        H+R            I + +    C  C  +F  +  L  H R    +   E  F C  C   F+   +LK+H+  H G  + +C  CG+
Sbjct:  222 FTCQECGKSFYQAGNFAAHMRIHTGEKPFSCKQCGKSFSQKSNLDVHMR-VHTR---------EQPYTCEQCGKSFSQKQSFNTHMRIHTGEKPFSCKQCGKSFFQKPNLDVHMRVHT-GEKPHTCEQCGKSFGQKQDLYIHMR------------IHTGEKPYTCTECGKSFPHISTLKHHMR----IHTGEKPFACAQCGKSFTTKTSLKNHMNGHTGTIVFTCDQCGK 425          

HSP 4 Score: 71.633 bits (174), Expect = 3.473e-12
Identity = 43/137 (31.39%), Postives = 63/137 (45.99%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYD 776
            + C  C +S+        HMR     K +TC QC + +     L++H R           + G   + C +C     +  T++HH R HTG KPF+C  CGK F  K ++K H N H     +F C+ CGK+    D
Sbjct:  306 FSCKQCGKSFFQKPNLDVHMRVHTGEKPHTCEQCGKSFGQKQDLYIHMR----------IHTGEKPYTCTECGKSFPHISTLKHHMRIHTGEKPFACAQCGKSFTTKTSLKNHMNGHT-GTIVFTCDQCGKSLTRKD 431          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Zebrafish
Match: znf971 (zinc finger protein 971 [Source:ZFIN;Acc:ZDB-GENE-050306-52])

HSP 1 Score: 116.701 bits (291), Expect = 5.294e-27
Identity = 80/291 (27.49%), Postives = 124/291 (42.61%), Query Frame = 3
Query:  318 SGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHI 1190
            SG + V   I      Y C  C ++++ +     HMR     K Y+C+QC + +       +H R           + G   + C  C    N    ++ H R HTG KPF+C  CGK F +K  +K H   H  ++++F C+TCG  F   +I+  H+            +I +S+    C  C  +FD       H R        E  F C  C   F      + H+++H G ++ +CP C ER F    +L+ HI R H  +  R   C  C  +F  K +L+ H+
Sbjct:  111 SGTLKVHMRIHTGEKPYSCQQCGKTFRQSTTLNVHMRTHTGGKPYSCQQCGKSFSHRLSFTMHMR----------VHTGEKPYPCSQCEKSFNRNSDLQLHMRVHTGEKPFTCQQCGKGFTRKGTLKDHMTTHT-QEKLFTCKTCGITFTQKEIFKIHI------------VIHNSEKPFTCNQCGKSFDQEEKFKLHKR----FHSAEKHFPCSHCGKTFRQKQHFEDHMRTHTGEEVYACPHC-ERSFSFKYRLDDHI-RIHN-REKREFPCDQCGKSFSQKSELNRHM 371          

HSP 2 Score: 80.8777 bits (198), Expect = 2.979e-15
Identity = 62/245 (25.31%), Postives = 98/245 (40.00%), Query Frame = 3
Query:  552 GNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCG------------------ERGFPGFNQLNHHITRAHALKVNRR-------HVCRYCESTFESKKDLDGHISDMHSEE 1211
            G   F C +C    +  GT++ H R HTG KP+SC  CGK F Q   +  H   H    + + C+ CGK+F+    +  H+R            + + +    C  C  +F+   +L  H R    +   E  F C+ C   F+   TLK H+ +H   ++ +C  CG                  E+ F   NQ      +    K+++R         C +C  TF  K+  + H+     EE
Sbjct:   95 GANSFTCQECGRSFSQSGTLKVHMRIHTGEKPYSCQQCGKTFRQSTTLNVHMRTHT-GGKPYSCQQCGKSFSHRLSFTMHMR------------VHTGEKPYPCSQCEKSFNRNSDLQLHMR----VHTGEKPFTCQQCGKGFTRKGTLKDHMTTHTQEKLFTCKTCGITFTQKEIFKIHIVIHNSEKPFTC-NQCGKSFDQEEKFKLHKRFHSAEKHFPCSHCGKTFRQKQHFEDHMRTHTGEE 321          

HSP 3 Score: 55.8398 bits (133), Expect = 2.977e-7
Identity = 35/117 (29.91%), Postives = 52/117 (44.44%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRH 716
            + C  C ++++    F  HMR     +VY C  CE+ +    +L  H R  + + +         +F C  C    +    +  H R HTG KPFSC  CGK F   + +K H N H
Sbjct:  295 FPCSHCGKTFRQKQHFEDHMRTHTGEEVYACPHCERSFSFKYRLDDHIRIHNREKR---------EFPCDQCGKSFSQKSELNRHMRVHTGEKPFSCGHCGKSFKHNSGLKYHMNSH 402          

HSP 4 Score: 51.9878 bits (123), Expect = 5.322e-6
Identity = 38/159 (23.90%), Postives = 62/159 (38.99%), Query Frame = 3
Query:  321 GNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLR 797
            G +    T       + C +C  ++     F  H+   +  K +TC QC + ++   +  LH R           +     F C  C          E H R HTG + ++C  C + F+ K  +  H   H  + R F C+ CGK+F+       H+R
Sbjct:  224 GTLKDHMTTHTQEKLFTCKTCGITFTQKEIFKIHIVIHNSEKPFTCNQCGKSFDQEEKFKLHKR----------FHSAEKHFPCSHCGKTFRQKQHFEDHMRTHTGEEVYACPHCERSFSFKYRLDDHIRIHNREKREFPCDQCGKSFSQKSELNRHMR 372          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Zebrafish
Match: znf971 (zinc finger protein 971 [Source:ZFIN;Acc:ZDB-GENE-050306-52])

HSP 1 Score: 116.701 bits (291), Expect = 5.294e-27
Identity = 80/291 (27.49%), Postives = 124/291 (42.61%), Query Frame = 3
Query:  318 SGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHI 1190
            SG + V   I      Y C  C ++++ +     HMR     K Y+C+QC + +       +H R           + G   + C  C    N    ++ H R HTG KPF+C  CGK F +K  +K H   H  ++++F C+TCG  F   +I+  H+            +I +S+    C  C  +FD       H R        E  F C  C   F      + H+++H G ++ +CP C ER F    +L+ HI R H  +  R   C  C  +F  K +L+ H+
Sbjct:  111 SGTLKVHMRIHTGEKPYSCQQCGKTFRQSTTLNVHMRTHTGGKPYSCQQCGKSFSHRLSFTMHMR----------VHTGEKPYPCSQCEKSFNRNSDLQLHMRVHTGEKPFTCQQCGKGFTRKGTLKDHMTTHT-QEKLFTCKTCGITFTQKEIFKIHI------------VIHNSEKPFTCNQCGKSFDQEEKFKLHKR----FHSAEKHFPCSHCGKTFRQKQHFEDHMRTHTGEEVYACPHC-ERSFSFKYRLDDHI-RIHN-REKREFPCDQCGKSFSQKSELNRHM 371          

HSP 2 Score: 80.8777 bits (198), Expect = 2.979e-15
Identity = 62/245 (25.31%), Postives = 98/245 (40.00%), Query Frame = 3
Query:  552 GNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCG------------------ERGFPGFNQLNHHITRAHALKVNRR-------HVCRYCESTFESKKDLDGHISDMHSEE 1211
            G   F C +C    +  GT++ H R HTG KP+SC  CGK F Q   +  H   H    + + C+ CGK+F+    +  H+R            + + +    C  C  +F+   +L  H R    +   E  F C+ C   F+   TLK H+ +H   ++ +C  CG                  E+ F   NQ      +    K+++R         C +C  TF  K+  + H+     EE
Sbjct:   95 GANSFTCQECGRSFSQSGTLKVHMRIHTGEKPYSCQQCGKTFRQSTTLNVHMRTHT-GGKPYSCQQCGKSFSHRLSFTMHMR------------VHTGEKPYPCSQCEKSFNRNSDLQLHMR----VHTGEKPFTCQQCGKGFTRKGTLKDHMTTHTQEKLFTCKTCGITFTQKEIFKIHIVIHNSEKPFTC-NQCGKSFDQEEKFKLHKRFHSAEKHFPCSHCGKTFRQKQHFEDHMRTHTGEE 321          

HSP 3 Score: 55.8398 bits (133), Expect = 2.977e-7
Identity = 35/117 (29.91%), Postives = 52/117 (44.44%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRH 716
            + C  C ++++    F  HMR     +VY C  CE+ +    +L  H R  + + +         +F C  C    +    +  H R HTG KPFSC  CGK F   + +K H N H
Sbjct:  295 FPCSHCGKTFRQKQHFEDHMRTHTGEEVYACPHCERSFSFKYRLDDHIRIHNREKR---------EFPCDQCGKSFSQKSELNRHMRVHTGEKPFSCGHCGKSFKHNSGLKYHMNSH 402          

HSP 4 Score: 51.9878 bits (123), Expect = 5.322e-6
Identity = 38/159 (23.90%), Postives = 62/159 (38.99%), Query Frame = 3
Query:  321 GNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLR 797
            G +    T       + C +C  ++     F  H+   +  K +TC QC + ++   +  LH R           +     F C  C          E H R HTG + ++C  C + F+ K  +  H   H  + R F C+ CGK+F+       H+R
Sbjct:  224 GTLKDHMTTHTQEKLFTCKTCGITFTQKEIFKIHIVIHNSEKPFTCNQCGKSFDQEEKFKLHKR----------FHSAEKHFPCSHCGKTFRQKQHFEDHMRTHTGEEVYACPHCERSFSFKYRLDDHIRIHNREKREFPCDQCGKSFSQKSELNRHMR 372          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Zebrafish
Match: znf971 (zinc finger protein 971 [Source:ZFIN;Acc:ZDB-GENE-050306-52])

HSP 1 Score: 116.701 bits (291), Expect = 5.294e-27
Identity = 80/291 (27.49%), Postives = 124/291 (42.61%), Query Frame = 3
Query:  318 SGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHI 1190
            SG + V   I      Y C  C ++++ +     HMR     K Y+C+QC + +       +H R           + G   + C  C    N    ++ H R HTG KPF+C  CGK F +K  +K H   H  ++++F C+TCG  F   +I+  H+            +I +S+    C  C  +FD       H R        E  F C  C   F      + H+++H G ++ +CP C ER F    +L+ HI R H  +  R   C  C  +F  K +L+ H+
Sbjct:  111 SGTLKVHMRIHTGEKPYSCQQCGKTFRQSTTLNVHMRTHTGGKPYSCQQCGKSFSHRLSFTMHMR----------VHTGEKPYPCSQCEKSFNRNSDLQLHMRVHTGEKPFTCQQCGKGFTRKGTLKDHMTTHT-QEKLFTCKTCGITFTQKEIFKIHI------------VIHNSEKPFTCNQCGKSFDQEEKFKLHKR----FHSAEKHFPCSHCGKTFRQKQHFEDHMRTHTGEEVYACPHC-ERSFSFKYRLDDHI-RIHN-REKREFPCDQCGKSFSQKSELNRHM 371          

HSP 2 Score: 80.8777 bits (198), Expect = 2.979e-15
Identity = 62/245 (25.31%), Postives = 98/245 (40.00%), Query Frame = 3
Query:  552 GNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCG------------------ERGFPGFNQLNHHITRAHALKVNRR-------HVCRYCESTFESKKDLDGHISDMHSEE 1211
            G   F C +C    +  GT++ H R HTG KP+SC  CGK F Q   +  H   H    + + C+ CGK+F+    +  H+R            + + +    C  C  +F+   +L  H R    +   E  F C+ C   F+   TLK H+ +H   ++ +C  CG                  E+ F   NQ      +    K+++R         C +C  TF  K+  + H+     EE
Sbjct:   95 GANSFTCQECGRSFSQSGTLKVHMRIHTGEKPYSCQQCGKTFRQSTTLNVHMRTHT-GGKPYSCQQCGKSFSHRLSFTMHMR------------VHTGEKPYPCSQCEKSFNRNSDLQLHMR----VHTGEKPFTCQQCGKGFTRKGTLKDHMTTHTQEKLFTCKTCGITFTQKEIFKIHIVIHNSEKPFTC-NQCGKSFDQEEKFKLHKRFHSAEKHFPCSHCGKTFRQKQHFEDHMRTHTGEE 321          

HSP 3 Score: 55.8398 bits (133), Expect = 2.977e-7
Identity = 35/117 (29.91%), Postives = 52/117 (44.44%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRH 716
            + C  C ++++    F  HMR     +VY C  CE+ +    +L  H R  + + +         +F C  C    +    +  H R HTG KPFSC  CGK F   + +K H N H
Sbjct:  295 FPCSHCGKTFRQKQHFEDHMRTHTGEEVYACPHCERSFSFKYRLDDHIRIHNREKR---------EFPCDQCGKSFSQKSELNRHMRVHTGEKPFSCGHCGKSFKHNSGLKYHMNSH 402          

HSP 4 Score: 51.9878 bits (123), Expect = 5.322e-6
Identity = 38/159 (23.90%), Postives = 62/159 (38.99%), Query Frame = 3
Query:  321 GNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLR 797
            G +    T       + C +C  ++     F  H+   +  K +TC QC + ++   +  LH R           +     F C  C          E H R HTG + ++C  C + F+ K  +  H   H  + R F C+ CGK+F+       H+R
Sbjct:  224 GTLKDHMTTHTQEKLFTCKTCGITFTQKEIFKIHIVIHNSEKPFTCNQCGKSFDQEEKFKLHKR----------FHSAEKHFPCSHCGKTFRQKQHFEDHMRTHTGEEVYACPHCERSFSFKYRLDDHIRIHNREKREFPCDQCGKSFSQKSELNRHMR 372          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Xenopus
Match: ENSXETT00000020796.1 (gastrula zinc finger protein XlCGF57.1-like [Source:NCBI gene;Acc:100494833])

HSP 1 Score: 112.079 bits (279), Expect = 1.294e-24
Identity = 85/288 (29.51%), Postives = 128/288 (44.44%), Query Frame = 3
Query:  270 DENGQTYLA----PTNQT--GSSGNIAVAQTIDNNGI-TYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHA 1112
            D+ G+  L+    PT Q+     G   V Q + NNG+  + C  C +S+   +  T H++     + ++C +C + +   S+L +H + TH + K          F C +C    +  G +  H+R HTG KPFSC  CGK F +K+ +  H+  H      F C  CGK F+     ++H            Q I + +    C  C+  F     L KH R    +   E  F C  C   F+ I  L +H++SH G +  +CP CG R F G   L  H  R HA
Sbjct:  290 DQCGKNVLSRGKSPTQQSERQGKGGKGVTQLVTNNGVKPFTCSECGKSFTKRSNLTMHLKIHSGERPFSCSECGKCFTQSSKLLIH-QGTHTEEK---------PFACSECGKSFSQMGYLLTHKRIHTGEKPFSCPQCGKLFTRKSTLLKHQRIHTGS---FPCSYCGKCFSQKSNLMSH------------QRIHTREKPFACASCDKCFTDKSALIKHER----VHTGERPFICTHCGKGFTQITHLTTHLRSHTGEKPFACPDCG-RCFAGKPALVKH-RRLHA 546          

HSP 2 Score: 73.559 bits (179), Expect = 1.830e-12
Identity = 79/329 (24.01%), Postives = 108/329 (32.83%), Query Frame = 3
Query:  441 VKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCN-----------------------------------------------YMTNNG----------------GTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLR-----------------TREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGH 1187
             K YTC  C + +   S    H +RTH              F C DC+                                                +TNNG                  +  H + H+G +PFSC  CGK F Q + +  H+  H  +++ F C  CGK+F+     L H R                 TR+  L +H ++   S     C  C   F    NL  H R    +   E  F C SCD  F+D   L  H + H G +   C  CG+    GF Q+ H  T   +    +   C  C   F  K  L  H
Sbjct:  236 AKGYTCTDCGKHFTIESDCICH-QRTHSPEM----------FRCSDCHNCFGSLAELVIHQTLYKDQCGKNVLSRGKSPTQQSERQGKGGKGVTQLVTNNGVKPFTCSECGKSFTKRSNLTMHLKIHSGERPFSCSECGKCFTQSSKLLIHQGTHT-EEKPFACSECGKSFSQMGYLLTHKRIHTGEKPFSCPQCGKLFTRKSTLLKHQRIHTGS---FPCSYCGKCFSQKSNLMSHQR----IHTREKPFACASCDKCFTDKSALIKHERVHTGERPFICTHCGK----GFTQITHLTTHLRSHTGEKPFACPDCGRCFAGKPALVKH 541          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Xenopus
Match: ENSXETT00000047268.1 (oocyte zinc finger protein XlCOF7.1-like [Source:NCBI gene;Acc:100497875])

HSP 1 Score: 104.375 bits (259), Expect = 2.974e-22
Identity = 95/350 (27.14%), Postives = 142/350 (40.57%), Query Frame = 3
Query:   72 DNQSMHDEDMVVISEETLDMNTLQSLFASGNVQTLSNDDEIIQVSDSGI----ISDTIVQLEGESYHVISDENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRT-----------------REHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGE 1058
            +N S  D  +VVI EE             G  Q+    +  +Q +D+       S  I+Q++G +Y    +EN      P+ Q     N  + +        Y C  C +     N F KH R     K ++C  C + + T  +L  H  +TH          G   F C DC         ++ H R HTG KPFSC  CGK F   +N+  H+  H   ++ F C  CGK F++    + H RT                 ++  L  H Q   + +    C  C   F ++ NL +H R    +   E  F C  C   FS+   LK+H+++H G +  SC VCG+
Sbjct:  177 NNSSAEDYTLVVIKEEESS--------CEGGGQSDCRINPQMQGTDTPTPIMGFSLNILQMKGNNY----NENA----YPSPQKSDKKNKLLGK--------YSCNECHKHVTQKNDFDKHHRTHTGEKPFSCSDCRKSFSTEPELDRH-HKTHT---------GEKPFSCSDCGKCFITKPELDRHHRTHTGEKPFSCSDCGKCFTNVSNLIRHQRTHT-GEKPFFCSECGKCFSNGSNLIRHRRTHTGEKPFSCCECGKCFSKQSHLDRH-QRTHTGEKPFSCSECGKLFSNVTNLIRHQR----IHTGEKPFACSICGKCFSNPSHLKTHLRTHTGEKPYSCSVCGK 486          

HSP 2 Score: 88.1965 bits (217), Expect = 4.551e-17
Identity = 61/226 (26.99%), Postives = 96/226 (42.48%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISC 1043
            + C  C + +       +H R     K ++C  C + +  +S L  H +RTH          G   F C +C    +NG  +  HRR HTG KPFSC  CGK F++++++  H+  H   ++ F C  CGK F++    + H            Q I + +    C  C   F +  +L  H R+       E  + C  C   FS       H ++H G + +SC
Sbjct:  311 FSCSDCGKCFITKPELDRHHRTHTGEKPFSCSDCGKCFTNVSNLIRH-QRTHT---------GEKPFFCSECGKCFSNGSNLIRHRRTHTGEKPFSCCECGKCFSKQSHLDRHQRTHT-GEKPFSCSECGKLFSNVTNLIRH------------QRIHTGEKPFACSICGKCFSNPSHLKTHLRT----HTGEKPYSCSVCGKCFSSSSYRYHHQRTHTGEKPLSC 509          

HSP 3 Score: 54.299 bits (129), Expect = 1.841e-6
Identity = 57/226 (25.22%), Postives = 85/226 (37.61%), Query Frame = 3
Query:  648 FSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHT 1325
            +SC+ C KH  QK +   H   H   ++ F C  C K+F++           E EL  H +     K    C  C   F +   L++H R+       E  F C  C   F+++  L  H ++H G +   C  CG+    G N + H   R H  +  +   C  C   F  +  LD             R  R   G      + C    ++V  + RH R HT
Sbjct:  255 YSCNECHKHVTQKNDFDKHHRTHT-GEKPFSCSDCRKSFST-----------EPELDRHHKTHTGEK-PFSCSDCGKCFITKPELDRHHRT----HTGEKPFSCSDCGKCFTNVSNLIRHQRTHTGEKPFFCSECGKCFSNGSNLIRHR--RTHTGE--KPFSCCECGKCFSKQSHLD-------------RHQRTHTGEKPFSCSECGKLFSNVTNLIRHQRIHT 446          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Xenopus
Match: ENSXETT00000047265.1 (oocyte zinc finger protein XlCOF7.1-like [Source:NCBI gene;Acc:100497875])

HSP 1 Score: 104.375 bits (259), Expect = 2.974e-22
Identity = 95/350 (27.14%), Postives = 142/350 (40.57%), Query Frame = 3
Query:   72 DNQSMHDEDMVVISEETLDMNTLQSLFASGNVQTLSNDDEIIQVSDSGI----ISDTIVQLEGESYHVISDENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRT-----------------REHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGE 1058
            +N S  D  +VVI EE             G  Q+    +  +Q +D+       S  I+Q++G +Y    +EN      P+ Q     N  + +        Y C  C +     N F KH R     K ++C  C + + T  +L  H  +TH          G   F C DC         ++ H R HTG KPFSC  CGK F   +N+  H+  H   ++ F C  CGK F++    + H RT                 ++  L  H Q   + +    C  C   F ++ NL +H R    +   E  F C  C   FS+   LK+H+++H G +  SC VCG+
Sbjct:  177 NNSSAEDYTLVVIKEEESS--------CEGGGQSDCRINPQMQGTDTPTPIMGFSLNILQMKGNNY----NENA----YPSPQKSDKKNKLLGK--------YSCNECHKHVTQKNDFDKHHRTHTGEKPFSCSDCRKSFSTEPELDRH-HKTHT---------GEKPFSCSDCGKCFITKPELDRHHRTHTGEKPFSCSDCGKCFTNVSNLIRHQRTHT-GEKPFFCSECGKCFSNGSNLIRHRRTHTGEKPFSCCECGKCFSKQSHLDRH-QRTHTGEKPFSCSECGKLFSNVTNLIRHQR----IHTGEKPFACSICGKCFSNPSHLKTHLRTHTGEKPYSCSVCGK 486          

HSP 2 Score: 88.1965 bits (217), Expect = 4.551e-17
Identity = 61/226 (26.99%), Postives = 96/226 (42.48%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISC 1043
            + C  C + +       +H R     K ++C  C + +  +S L  H +RTH          G   F C +C    +NG  +  HRR HTG KPFSC  CGK F++++++  H+  H   ++ F C  CGK F++    + H            Q I + +    C  C   F +  +L  H R+       E  + C  C   FS       H ++H G + +SC
Sbjct:  311 FSCSDCGKCFITKPELDRHHRTHTGEKPFSCSDCGKCFTNVSNLIRH-QRTHT---------GEKPFFCSECGKCFSNGSNLIRHRRTHTGEKPFSCCECGKCFSKQSHLDRHQRTHT-GEKPFSCSECGKLFSNVTNLIRH------------QRIHTGEKPFACSICGKCFSNPSHLKTHLRT----HTGEKPYSCSVCGKCFSSSSYRYHHQRTHTGEKPLSC 509          

HSP 3 Score: 54.299 bits (129), Expect = 1.841e-6
Identity = 57/226 (25.22%), Postives = 85/226 (37.61%), Query Frame = 3
Query:  648 FSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHT 1325
            +SC+ C KH  QK +   H   H   ++ F C  C K+F++           E EL  H +     K    C  C   F +   L++H R+       E  F C  C   F+++  L  H ++H G +   C  CG+    G N + H   R H  +  +   C  C   F  +  LD             R  R   G      + C    ++V  + RH R HT
Sbjct:  255 YSCNECHKHVTQKNDFDKHHRTHT-GEKPFSCSDCRKSFST-----------EPELDRHHKTHTGEK-PFSCSDCGKCFITKPELDRHHRT----HTGEKPFSCSDCGKCFTNVSNLIRHQRTHTGEKPFFCSECGKCFSNGSNLIRHR--RTHTGE--KPFSCCECGKCFSKQSHLD-------------RHQRTHTGEKPFSCSECGKLFSNVTNLIRHQRIHT 446          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Xenopus
Match: ENSXETT00000047261.1 (oocyte zinc finger protein XlCOF7.1-like [Source:NCBI gene;Acc:100497875])

HSP 1 Score: 104.375 bits (259), Expect = 2.974e-22
Identity = 95/350 (27.14%), Postives = 142/350 (40.57%), Query Frame = 3
Query:   72 DNQSMHDEDMVVISEETLDMNTLQSLFASGNVQTLSNDDEIIQVSDSGI----ISDTIVQLEGESYHVISDENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRT-----------------REHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGE 1058
            +N S  D  +VVI EE             G  Q+    +  +Q +D+       S  I+Q++G +Y    +EN      P+ Q     N  + +        Y C  C +     N F KH R     K ++C  C + + T  +L  H  +TH          G   F C DC         ++ H R HTG KPFSC  CGK F   +N+  H+  H   ++ F C  CGK F++    + H RT                 ++  L  H Q   + +    C  C   F ++ NL +H R    +   E  F C  C   FS+   LK+H+++H G +  SC VCG+
Sbjct:  177 NNSSAEDYTLVVIKEEESS--------CEGGGQSDCRINPQMQGTDTPTPIMGFSLNILQMKGNNY----NENA----YPSPQKSDKKNKLLGK--------YSCNECHKHVTQKNDFDKHHRTHTGEKPFSCSDCRKSFSTEPELDRH-HKTHT---------GEKPFSCSDCGKCFITKPELDRHHRTHTGEKPFSCSDCGKCFTNVSNLIRHQRTHT-GEKPFFCSECGKCFSNGSNLIRHRRTHTGEKPFSCCECGKCFSKQSHLDRH-QRTHTGEKPFSCSECGKLFSNVTNLIRHQR----IHTGEKPFACSICGKCFSNPSHLKTHLRTHTGEKPYSCSVCGK 486          

HSP 2 Score: 88.1965 bits (217), Expect = 4.551e-17
Identity = 61/226 (26.99%), Postives = 96/226 (42.48%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISC 1043
            + C  C + +       +H R     K ++C  C + +  +S L  H +RTH          G   F C +C    +NG  +  HRR HTG KPFSC  CGK F++++++  H+  H   ++ F C  CGK F++    + H            Q I + +    C  C   F +  +L  H R+       E  + C  C   FS       H ++H G + +SC
Sbjct:  311 FSCSDCGKCFITKPELDRHHRTHTGEKPFSCSDCGKCFTNVSNLIRH-QRTHT---------GEKPFFCSECGKCFSNGSNLIRHRRTHTGEKPFSCCECGKCFSKQSHLDRHQRTHT-GEKPFSCSECGKLFSNVTNLIRH------------QRIHTGEKPFACSICGKCFSNPSHLKTHLRT----HTGEKPYSCSVCGKCFSSSSYRYHHQRTHTGEKPLSC 509          

HSP 3 Score: 54.299 bits (129), Expect = 1.841e-6
Identity = 57/226 (25.22%), Postives = 85/226 (37.61%), Query Frame = 3
Query:  648 FSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHT 1325
            +SC+ C KH  QK +   H   H   ++ F C  C K+F++           E EL  H +     K    C  C   F +   L++H R+       E  F C  C   F+++  L  H ++H G +   C  CG+    G N + H   R H  +  +   C  C   F  +  LD             R  R   G      + C    ++V  + RH R HT
Sbjct:  255 YSCNECHKHVTQKNDFDKHHRTHT-GEKPFSCSDCRKSFST-----------EPELDRHHKTHTGEK-PFSCSDCGKCFITKPELDRHHRT----HTGEKPFSCSDCGKCFTNVSNLIRHQRTHTGEKPFFCSECGKCFSNGSNLIRHR--RTHTGE--KPFSCCECGKCFSKQSHLD-------------RHQRTHTGEKPFSCSECGKLFSNVTNLIRHQRIHT 446          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Xenopus
Match: ENSXETT00000047257.1 (oocyte zinc finger protein XlCOF7.1-like [Source:NCBI gene;Acc:100497875])

HSP 1 Score: 104.375 bits (259), Expect = 2.974e-22
Identity = 95/350 (27.14%), Postives = 142/350 (40.57%), Query Frame = 3
Query:   72 DNQSMHDEDMVVISEETLDMNTLQSLFASGNVQTLSNDDEIIQVSDSGI----ISDTIVQLEGESYHVISDENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRT-----------------REHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGE 1058
            +N S  D  +VVI EE             G  Q+    +  +Q +D+       S  I+Q++G +Y    +EN      P+ Q     N  + +        Y C  C +     N F KH R     K ++C  C + + T  +L  H  +TH          G   F C DC         ++ H R HTG KPFSC  CGK F   +N+  H+  H   ++ F C  CGK F++    + H RT                 ++  L  H Q   + +    C  C   F ++ NL +H R    +   E  F C  C   FS+   LK+H+++H G +  SC VCG+
Sbjct:  177 NNSSAEDYTLVVIKEEESS--------CEGGGQSDCRINPQMQGTDTPTPIMGFSLNILQMKGNNY----NENA----YPSPQKSDKKNKLLGK--------YSCNECHKHVTQKNDFDKHHRTHTGEKPFSCSDCRKSFSTEPELDRH-HKTHT---------GEKPFSCSDCGKCFITKPELDRHHRTHTGEKPFSCSDCGKCFTNVSNLIRHQRTHT-GEKPFFCSECGKCFSNGSNLIRHRRTHTGEKPFSCCECGKCFSKQSHLDRH-QRTHTGEKPFSCSECGKLFSNVTNLIRHQR----IHTGEKPFACSICGKCFSNPSHLKTHLRTHTGEKPYSCSVCGK 486          

HSP 2 Score: 88.1965 bits (217), Expect = 4.551e-17
Identity = 61/226 (26.99%), Postives = 96/226 (42.48%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISC 1043
            + C  C + +       +H R     K ++C  C + +  +S L  H +RTH          G   F C +C    +NG  +  HRR HTG KPFSC  CGK F++++++  H+  H   ++ F C  CGK F++    + H            Q I + +    C  C   F +  +L  H R+       E  + C  C   FS       H ++H G + +SC
Sbjct:  311 FSCSDCGKCFITKPELDRHHRTHTGEKPFSCSDCGKCFTNVSNLIRH-QRTHT---------GEKPFFCSECGKCFSNGSNLIRHRRTHTGEKPFSCCECGKCFSKQSHLDRHQRTHT-GEKPFSCSECGKLFSNVTNLIRH------------QRIHTGEKPFACSICGKCFSNPSHLKTHLRT----HTGEKPYSCSVCGKCFSSSSYRYHHQRTHTGEKPLSC 509          

HSP 3 Score: 54.299 bits (129), Expect = 1.841e-6
Identity = 57/226 (25.22%), Postives = 85/226 (37.61%), Query Frame = 3
Query:  648 FSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHT 1325
            +SC+ C KH  QK +   H   H   ++ F C  C K+F++           E EL  H +     K    C  C   F +   L++H R+       E  F C  C   F+++  L  H ++H G +   C  CG+    G N + H   R H  +  +   C  C   F  +  LD             R  R   G      + C    ++V  + RH R HT
Sbjct:  255 YSCNECHKHVTQKNDFDKHHRTHT-GEKPFSCSDCRKSFST-----------EPELDRHHKTHTGEK-PFSCSDCGKCFITKPELDRHHRT----HTGEKPFSCSDCGKCFTNVSNLIRHQRTHTGEKPFFCSECGKCFSNGSNLIRHR--RTHTGE--KPFSCCECGKCFSKQSHLD-------------RHQRTHTGEKPFSCSECGKLFSNVTNLIRHQRIHT 446          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Mouse
Match: Zfp26 (zinc finger protein 26 [Source:MGI Symbol;Acc:MGI:99173])

HSP 1 Score: 114.39 bits (285), Expect = 6.677e-25
Identity = 90/336 (26.79%), Postives = 147/336 (43.75%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRT----REHELREHFQMIASSKLILG------------CMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHT 1325
            Y C  C +++   +  T H+R+    + Y C +CE+ + + +QL  H + TH          G   F C  C     N   ++ H R HTG+KP+ C+ CGK F  ++ +  H   H + ++ + C+ CGKAF++    + H+R     +  E  +  + +A S  ++G            C  C+ TF     L  H R+       E  + CK C   F +   L  H+++H G +   C  CG +GF  F QL  HI + H+    R   C+ C  +F +   L+ H   +H+           V   +C Y    FT+ S + +  H R HT
Sbjct:  484 YECKVCGKAFSGRSWLTIHLRKHTGERPYPCTECEKAFTSFAQLTEHIK-THT---------GEKPFRCKVCARTFRNSSCLKTHFRIHTGIKPYKCNYCGKAFTARSGLTKHVLIH-NGEKPYECKECGKAFSTSSGLVEHIRIHTGEKPFECYQCGKALAHSSSLVGHLRTHTGEKPFECNQCDKTFTRSSYLRIHMRT----HTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYECKECG-KGFISFAQLTVHI-KTHS--SERPFQCKVCTKSFRNSSSLETHFR-IHT----------GVKPYKCSYCGKAFTARSGLTI--HLRNHT 787          

HSP 2 Score: 110.923 bits (276), Expect = 7.067e-24
Identity = 77/275 (28.00%), Postives = 127/275 (46.18%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHI 1190
            Y C  C +++   +  TKH+R     + Y C++C + + + +QL +H + TH   +          F C  C     N  ++E H R HTGVKP+ C  CGK F  ++ +  H   H   ++ + C+ CGKAF++    +AH+R+  H+  + F+          C  C   F S   LN H +    +   E  F C  C   F+    L  H+++H G +   C +CG + F   + L  H+ R H  +  + +VC+YC   F     L+ H+
Sbjct:  680 YECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIK-THSSER---------PFQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTARSGLTIHLRNHT-GEKSYACQECGKAFSTSSGLIAHIRS--HKGEKPFE----------CDHCGKAFASSSYLNVHLK----IHTGEKPFQCTVCGKTFTCSSYLPVHMRTHTGEKPFQCIICG-KSFLWSSYLRVHM-RIHTGE--KPYVCQYCGKAFTEHSGLNKHL 923          

HSP 3 Score: 100.523 bits (249), Expect = 1.327e-20
Identity = 89/357 (24.93%), Postives = 136/357 (38.10%), Query Frame = 3
Query:  147 LFASGNVQTLSNDDEIIQVSDSGIISDTIV-QLEGESYHVI--------SDENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHI 1190
            +F     Q     ++ ++ SD G   +T V QLE +++           S+E GQ    P +  G          I      Y C  C + + +      HM+     K Y C++C + +   S L +H R+   +            + C +C         +  H R+HTG KP+ CD CG  FA  + + TH   H   ++ F C  CGKAF      L H+RT  H   + ++          C  C   F     L  H R        E  + C  C+  F+    L  H+K+H G +   C VC  R F   + L  H      +K  +   C YC   F ++  L  H+
Sbjct:  273 IFTPDVSQKKCTPEKSVECSDCG---ETFVNQLELQTHSSSHREKNIHKSEECGQASTHPISHGG--------HVIPTEKKYYECKKCEKFFTHPVYLNIHMQSHTVEKPYDCKECGKAFTERSSLIVHLRQHTREKS----------YECKECGKTFIQPSRLTEHMRSHTGEKPYQCDQCGNAFASSSYLTTHLRTHT-GEKPFECNICGKAFTRSSYLLGHIRT--HTGEKPYE----------CKVCGKAFSGRSWLTIHLRK----HTGERPYPCTECEKAFTSFAQLTEHIKTHTGEKPFRCKVCA-RTFRNSSCLKTHFRIHTGIKPYK---CNYCGKAFTARSGLTKHV 587          

HSP 4 Score: 95.5153 bits (236), Expect = 4.792e-19
Identity = 79/299 (26.42%), Postives = 119/299 (39.80%), Query Frame = 3
Query:  345 IDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHE-----------------LREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHI 1190
            I N    Y C  C +++  ++   +H+R     K + C QC +     S L  H  RTH          G   F C  C+        +  H R HTG KP+ C  CGK F +++ +  H   H   +R + C+ CGK F S+     H++T   E                 L  HF++    K    C  C   F +   L  H R+       E  + C+ C   FS    L +H++SH+G +   C  CG + F   + LN H+ + H  +  +   C  C  TF     L  H+
Sbjct:  589 IHNGEKPYECKECGKAFSTSSGLVEHIRIHTGEKPFECYQCGKALAHSSSLVGHL-RTHT---------GEKPFECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHT-GERPYECKECGKGFISFAQLTVHIKTHSSERPFQCKVCTKSFRNSSSLETHFRIHTGVK-PYKCSYCGKAFTARSGLTIHLRN----HTGEKSYACQECGKAFSTSSGLIAHIRSHKGEKPFECDHCG-KAFASSSYLNVHL-KIHTGE--KPFQCTVCGKTFTCSSYLPVHM 867          

HSP 5 Score: 89.7373 bits (221), Expect = 2.824e-17
Identity = 63/231 (27.27%), Postives = 97/231 (41.99%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGE 1058
            ++C  C +S++N+++   H R    VK Y C  C + +   S L +H R           + G   + C +C    +    +  H R+H G KPF CD CGK FA  + +  H   H   ++ F+C  CGK F        H+RT  H   + FQ          C+ C  +F     L  H R    +   E  + C+ C   F++   L  H++ H G +      CGE
Sbjct:  736 FQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTARSGLTIHLRN----------HTGEKSYACQECGKAFSTSSGLIAHIRSHKGEKPFECDHCGKAFASSSYLNVHLKIHT-GEKPFQCTVCGKTFTCSSYLPVHMRT--HTGEKPFQ----------CIICGKSFLWSSYLRVHMR----IHTGEKPYVCQYCGKAFTEHSGLNKHLRKHTGEKPYEYKECGE 939          

HSP 6 Score: 52.373 bits (124), Expect = 5.801e-6
Identity = 68/267 (25.47%), Postives = 95/267 (35.58%), Query Frame = 3
Query:  633 TGVKPFSCDICGKHFAQKANMKTHKNRH----IHK--------------------------------------------------DRIFRCETCGKAFNSYDIYLAHLR--TRE--HELREHFQ-MIASSKLI-----------LGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNAR 1223
            T  K   C  CG+ F  +  ++TH + H    IHK                                                  ++ + C+ CGKAF      + HLR  TRE  +E +E  +  I  S+L              C  C N F S   L  H R+       E  F C  C   F+    L  H+++H G +   C VCG + F G + L  H+ R H  +  R + C  CE  F S   L  HI   H+ E+  R
Sbjct:  284 TPEKSVECSDCGETFVNQLELQTHSSSHREKNIHKSEECGQASTHPISHGGHVIPTEKKYYECKKCEKFFTHPVYLNIHMQSHTVEKPYDCKECGKAFTERSSLIVHLRQHTREKSYECKECGKTFIQPSRLTEHMRSHTGEKPYQCDQCGNAFASSSYLTTHLRT----HTGEKPFECNICGKAFTRSSYLLGHIRTHTGEKPYECKVCG-KAFSGRSWLTIHL-RKHTGE--RPYPCTECEKAFTSFAQLTEHI-KTHTGEKPFR 541          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Mouse
Match: Zfp648 (zinc finger protein 648 [Source:MGI Symbol;Acc:MGI:2685049])

HSP 1 Score: 110.153 bits (274), Expect = 3.557e-24
Identity = 84/274 (30.66%), Postives = 115/274 (41.97%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGH 1187
            YRCP C ++Y  ++   KH+R     K Y C  C + +   S L  H R  H +         +  F C  C    N   ++  H+R H G KPF C  CG+ F+  + M  H+  H   +R F C TCGK F           T+   L+EH Q + + +    C  C  TF     L +H R    +   E  F C  C   F+   TLK H + H G++   C  CG R F   ++L  HI R H     R + C  C  TF     L  H
Sbjct:  264 YRCPFCDKAYTWSSDHRKHIRTHTGEKPYGCPDCGRAFVRSSDLRKHQRNMHSN---------DKPFPCAQCGLTFNRPLSLLRHQRTHLGAKPFRCSSCGREFSVASRMVEHQRVH-SGERPFPCSTCGKCF-----------TKSSNLQEH-QTLHTGQRPFKCTDCGVTFAQPSRLLRHQR----IHTGERPFPCAECGQAFARSSTLKRHQQIHSGDKDFLCAECG-RAFRIASELAQHI-RMH--NGERPYQCEGCGQTFTRSSHLQRH 507          

HSP 2 Score: 74.7146 bits (182), Expect = 5.780e-13
Identity = 56/226 (24.78%), Postives = 88/226 (38.94%), Query Frame = 3
Query:  345 IDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHE 1022
            + +N   + C  C  ++    +  +H R     K + C  C + +   S++  H +R H          G   F C  C         ++ H+  HTG +PF C  CG  FAQ + +  H+  H   +R F C  CG+AF            R   L+ H Q+ +  K  L C  C   F     L +H R    +   E  + C+ C   F+    L+ H   H+
Sbjct:  314 MHSNDKPFPCAQCGLTFNRPLSLLRHQRTHLGAKPFRCSSCGREFSVASRMVEH-QRVH---------SGERPFPCSTCGKCFTKSSNLQEHQTLHTGQRPFKCTDCGVTFAQPSRLLRHQRIHT-GERPFPCAECGQAF-----------ARSSTLKRHQQIHSGDKDFL-CAECGRAFRIASELAQHIR----MHNGERPYQCEGCGQTFTRSSHLQRHQAKHD 512          

HSP 3 Score: 72.4034 bits (176), Expect = 3.234e-12
Identity = 61/232 (26.29%), Postives = 98/232 (42.24%), Query Frame = 3
Query:  630 HTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHT 1325
            H G KP+ C +CGK ++ ++ ++ H+  H   +R +RC  C KA+     +  H+RT   E               GC  C   F    +L KH R+   +   +  F C  C   F+  ++L  H ++H G +   C  CG R F   +++  H  R H+ +  R   C  C   F    +L  H + +H+ +R            +C  T+C  T      + RH R HT
Sbjct:  230 HHGSKPYVCQLCGKAYSHRSTLQQHRRLHT-GERPYRCPFCDKAYTWSSDHRKHIRTHTGE------------KPYGCPDCGRAFVRSSDLRKHQRN---MHSNDKPFPCAQCGLTFNRPLSLLRHQRTHLGAKPFRCSSCG-REFSVASRMVEH-QRVHSGE--RPFPCSTCGKCFTKSSNLQEHQT-LHTGQRP----------FKC--TDCGVTFAQPSRLLRHQRIHT 428          

HSP 4 Score: 51.6026 bits (122), Expect = 9.441e-6
Identity = 29/133 (21.80%), Postives = 57/133 (42.86%), Query Frame = 3
Query:  318 SGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRH 716
            S N+   QT+      ++C  C  ++   +   +H R     + + C +C Q +   S L  H +           + G+  F C +C         +  H R H G +P+ C+ CG+ F + ++++ H+ +H
Sbjct:  389 SSNLQEHQTLHTGQRPFKCTDCGVTFAQPSRLLRHQRIHTGERPFPCAECGQAFARSSTLKRHQQ----------IHSGDKDFLCAECGRAFRIASELAQHIRMHNGERPYQCEGCGQTFTRSSHLQRHQAKH 511          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Mouse
Match: Zfp668 (zinc finger protein 668 [Source:MGI Symbol;Acc:MGI:2442943])

HSP 1 Score: 110.538 bits (275), Expect = 4.234e-24
Identity = 85/314 (27.07%), Postives = 128/314 (40.76%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMR----EKHF--------------VKV----------YTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNAR 1223
            Y CP CP++Y+ A     H R    EK F              ++V          + C  C + Y TLS+L +H +R H          G   + CPDC     +      HRR H G++P+SC+ CGK +A+  +++ H+  H   +R F C  CGK+F+       H            Q I +++    C  C   F  + +   H R+       E  F C  C   FSD  + + H ++HEG +   C  CG+     F Q             +R   C  C+ TF +  DL  H + +HS +R  R
Sbjct:   84 YACPLCPKAYKTAPELRSHGRSHTGEKPFPCPECGRRFMQPVCLRVHLASHAGELPFRCTHCPKAYGTLSKLKIH-QRGHT---------GERPYACPDCGKSFADPSVFRKHRRTHAGLRPYSCERCGKAYAELKDLRNHERSHT-GERPFLCSECGKSFSRSSSLTCH------------QRIHAAQKPYRCPACGKGFTQLSSYQSHERT----HSGEKPFLCPRCGRMFSDPSSFRRHQRAHEGVKPYRCEKCGK----DFRQPADLAMHRRVHTGDRPFKCLQCDKTFVASWDLKRH-ALVHSGQRPFR 365          

HSP 2 Score: 99.3673 bits (246), Expect = 1.641e-20
Identity = 67/226 (29.65%), Postives = 100/226 (44.25%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAF-NSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIIS 1040
            + C  C +S+  +++ T H R     K Y C  C + +  LS    H  RTH          G   F CP C  M ++  +   H+RAH GVKP+ C+ CGK F Q A++  H+  H   DR F+C  C K F  S+D            L+ H  ++ S +    C  C   F    +L KH+R    +   E  F C +C   F  + +L+ H ++H  N+   
Sbjct:  224 FLCSECGKSFSRSSSLTCHQRIHAAQKPYRCPACGKGFTQLSSYQSH-ERTH---------SGEKPFLCPRCGRMFSDPSSFRRHQRAHEGVKPYRCEKCGKDFRQPADLAMHRRVHT-GDRPFKCLQCDKTFVASWD------------LKRH-ALVHSGQRPFRCEECGRAFAERASLTKHSR----MHSGERPFHCNACGKSFVVLSSLRKHERTHRSNETTG 421          

HSP 3 Score: 99.3673 bits (246), Expect = 1.656e-20
Identity = 64/265 (24.15%), Postives = 114/265 (43.02%), Query Frame = 3
Query:  312 GSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTRE-----------HELREHFQMIASSKLILG-----CMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGE 1058
            G+   + + Q        Y CP C +S+ + + F KH R    ++ Y+C +C + Y  L  L  H  R+H          G   F C +C    +   ++  H+R H   KP+ C  CGK F Q ++ ++H+  H   ++ F C  CG+ F+    +  H R  E            + R+   +    ++  G     C+ C+ TF + ++L +H     ++   +  F C+ C   F++  +L  H + H G +   C  CG+
Sbjct:  150 GTLSKLKIHQRGHTGERPYACPDCGKSFADPSVFRKHRRTHAGLRPYSCERCGKAYAELKDLRNH-ERSHT---------GERPFLCSECGKSFSRSSSLTCHQRIHAAQKPYRCPACGKGFTQLSSYQSHERTH-SGEKPFLCPRCGRMFSDPSSFRRHQRAHEGVKPYRCEKCGKDFRQPADLAMHRRVHTGDRPFKCLQCDKTFVASWDLKRHA----LVHSGQRPFRCEECGRAFAERASLTKHSRMHSGERPFHCNACGK 399          

HSP 4 Score: 81.2629 bits (199), Expect = 7.477e-15
Identity = 85/353 (24.08%), Postives = 126/353 (35.69%), Query Frame = 3
Query:  354 NGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQC-EQFYETLSQLFLHARRTHVDXXXXXXXXGNYK-FHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRH----------------------IHK-----DRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHT 1325
            +G  Y+C  C +++ NA    +H         +T   C E+  E   ++    +       K   +    + + CP C         +  H R+HTG KPF C  CG+ F Q   ++ H   H                      IH+     +R + C  CGK+F    ++  H RT       H  +   S     C  C   +  + +L  H RS       E  F C  C   FS   +L  H + H   +   CP CG+    GF QL+ + +        +  +C  C   F          SD  S  R+ R   G V   RC     DF   + + M  H R HT
Sbjct:   18 SGRRYKCLFCTKTFPNAPRAARH------AATHTPTDCTEEVREAQPKVDTEPKAEEASGDKVSASVAKPRPYACPLCPKAYKTAPELRSHGRSHTGEKPFPCPECGRRFMQPVCLRVHLASHAGELPFRCTHCPKAYGTLSKLKIHQRGHTGERPYACPDCGKSFADPSVFRKHRRT-------HAGLRPYS-----CERCGKAYAELKDLRNHERS----HTGERPFLCSECGKSFSRSSSLTCHQRIHAAQKPYRCPACGK----GFTQLSSYQSHERTHSGEKPFLCPRCGRMF----------SDPSSFRRHQRAHEG-VKPYRCEKCGKDFRQPADLAM--HRRVHT 331          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Mouse
Match: Zfp668 (zinc finger protein 668 [Source:MGI Symbol;Acc:MGI:2442943])

HSP 1 Score: 110.538 bits (275), Expect = 4.234e-24
Identity = 85/314 (27.07%), Postives = 128/314 (40.76%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMR----EKHF--------------VKV----------YTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNAR 1223
            Y CP CP++Y+ A     H R    EK F              ++V          + C  C + Y TLS+L +H +R H          G   + CPDC     +      HRR H G++P+SC+ CGK +A+  +++ H+  H   +R F C  CGK+F+       H            Q I +++    C  C   F  + +   H R+       E  F C  C   FSD  + + H ++HEG +   C  CG+     F Q             +R   C  C+ TF +  DL  H + +HS +R  R
Sbjct:   84 YACPLCPKAYKTAPELRSHGRSHTGEKPFPCPECGRRFMQPVCLRVHLASHAGELPFRCTHCPKAYGTLSKLKIH-QRGHT---------GERPYACPDCGKSFADPSVFRKHRRTHAGLRPYSCERCGKAYAELKDLRNHERSHT-GERPFLCSECGKSFSRSSSLTCH------------QRIHAAQKPYRCPACGKGFTQLSSYQSHERT----HSGEKPFLCPRCGRMFSDPSSFRRHQRAHEGVKPYRCEKCGK----DFRQPADLAMHRRVHTGDRPFKCLQCDKTFVASWDLKRH-ALVHSGQRPFR 365          

HSP 2 Score: 99.3673 bits (246), Expect = 1.641e-20
Identity = 67/226 (29.65%), Postives = 100/226 (44.25%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAF-NSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIIS 1040
            + C  C +S+  +++ T H R     K Y C  C + +  LS    H  RTH          G   F CP C  M ++  +   H+RAH GVKP+ C+ CGK F Q A++  H+  H   DR F+C  C K F  S+D            L+ H  ++ S +    C  C   F    +L KH+R    +   E  F C +C   F  + +L+ H ++H  N+   
Sbjct:  224 FLCSECGKSFSRSSSLTCHQRIHAAQKPYRCPACGKGFTQLSSYQSH-ERTH---------SGEKPFLCPRCGRMFSDPSSFRRHQRAHEGVKPYRCEKCGKDFRQPADLAMHRRVHT-GDRPFKCLQCDKTFVASWD------------LKRH-ALVHSGQRPFRCEECGRAFAERASLTKHSR----MHSGERPFHCNACGKSFVVLSSLRKHERTHRSNETTG 421          

HSP 3 Score: 99.3673 bits (246), Expect = 1.656e-20
Identity = 64/265 (24.15%), Postives = 114/265 (43.02%), Query Frame = 3
Query:  312 GSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTRE-----------HELREHFQMIASSKLILG-----CMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGE 1058
            G+   + + Q        Y CP C +S+ + + F KH R    ++ Y+C +C + Y  L  L  H  R+H          G   F C +C    +   ++  H+R H   KP+ C  CGK F Q ++ ++H+  H   ++ F C  CG+ F+    +  H R  E            + R+   +    ++  G     C+ C+ TF + ++L +H     ++   +  F C+ C   F++  +L  H + H G +   C  CG+
Sbjct:  150 GTLSKLKIHQRGHTGERPYACPDCGKSFADPSVFRKHRRTHAGLRPYSCERCGKAYAELKDLRNH-ERSHT---------GERPFLCSECGKSFSRSSSLTCHQRIHAAQKPYRCPACGKGFTQLSSYQSHERTH-SGEKPFLCPRCGRMFSDPSSFRRHQRAHEGVKPYRCEKCGKDFRQPADLAMHRRVHTGDRPFKCLQCDKTFVASWDLKRHA----LVHSGQRPFRCEECGRAFAERASLTKHSRMHSGERPFHCNACGK 399          

HSP 4 Score: 81.2629 bits (199), Expect = 7.477e-15
Identity = 85/353 (24.08%), Postives = 126/353 (35.69%), Query Frame = 3
Query:  354 NGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQC-EQFYETLSQLFLHARRTHVDXXXXXXXXGNYK-FHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRH----------------------IHK-----DRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHT 1325
            +G  Y+C  C +++ NA    +H         +T   C E+  E   ++    +       K   +    + + CP C         +  H R+HTG KPF C  CG+ F Q   ++ H   H                      IH+     +R + C  CGK+F    ++  H RT       H  +   S     C  C   +  + +L  H RS       E  F C  C   FS   +L  H + H   +   CP CG+    GF QL+ + +        +  +C  C   F          SD  S  R+ R   G V   RC     DF   + + M  H R HT
Sbjct:   18 SGRRYKCLFCTKTFPNAPRAARH------AATHTPTDCTEEVREAQPKVDTEPKAEEASGDKVSASVAKPRPYACPLCPKAYKTAPELRSHGRSHTGEKPFPCPECGRRFMQPVCLRVHLASHAGELPFRCTHCPKAYGTLSKLKIHQRGHTGERPYACPDCGKSFADPSVFRKHRRT-------HAGLRPYS-----CERCGKAYAELKDLRNHERS----HTGERPFLCSECGKSFSRSSSLTCHQRIHAAQKPYRCPACGK----GFTQLSSYQSHERTHSGEKPFLCPRCGRMF----------SDPSSFRRHQRAHEG-VKPYRCEKCGKDFRQPADLAM--HRRVHT 331          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Mouse
Match: Zfp668 (zinc finger protein 668 [Source:MGI Symbol;Acc:MGI:2442943])

HSP 1 Score: 110.538 bits (275), Expect = 4.234e-24
Identity = 85/314 (27.07%), Postives = 128/314 (40.76%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMR----EKHF--------------VKV----------YTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNAR 1223
            Y CP CP++Y+ A     H R    EK F              ++V          + C  C + Y TLS+L +H +R H          G   + CPDC     +      HRR H G++P+SC+ CGK +A+  +++ H+  H   +R F C  CGK+F+       H            Q I +++    C  C   F  + +   H R+       E  F C  C   FSD  + + H ++HEG +   C  CG+     F Q             +R   C  C+ TF +  DL  H + +HS +R  R
Sbjct:   84 YACPLCPKAYKTAPELRSHGRSHTGEKPFPCPECGRRFMQPVCLRVHLASHAGELPFRCTHCPKAYGTLSKLKIH-QRGHT---------GERPYACPDCGKSFADPSVFRKHRRTHAGLRPYSCERCGKAYAELKDLRNHERSHT-GERPFLCSECGKSFSRSSSLTCH------------QRIHAAQKPYRCPACGKGFTQLSSYQSHERT----HSGEKPFLCPRCGRMFSDPSSFRRHQRAHEGVKPYRCEKCGK----DFRQPADLAMHRRVHTGDRPFKCLQCDKTFVASWDLKRH-ALVHSGQRPFR 365          

HSP 2 Score: 99.3673 bits (246), Expect = 1.641e-20
Identity = 67/226 (29.65%), Postives = 100/226 (44.25%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAF-NSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIIS 1040
            + C  C +S+  +++ T H R     K Y C  C + +  LS    H  RTH          G   F CP C  M ++  +   H+RAH GVKP+ C+ CGK F Q A++  H+  H   DR F+C  C K F  S+D            L+ H  ++ S +    C  C   F    +L KH+R    +   E  F C +C   F  + +L+ H ++H  N+   
Sbjct:  224 FLCSECGKSFSRSSSLTCHQRIHAAQKPYRCPACGKGFTQLSSYQSH-ERTH---------SGEKPFLCPRCGRMFSDPSSFRRHQRAHEGVKPYRCEKCGKDFRQPADLAMHRRVHT-GDRPFKCLQCDKTFVASWD------------LKRH-ALVHSGQRPFRCEECGRAFAERASLTKHSR----MHSGERPFHCNACGKSFVVLSSLRKHERTHRSNETTG 421          

HSP 3 Score: 99.3673 bits (246), Expect = 1.656e-20
Identity = 64/265 (24.15%), Postives = 114/265 (43.02%), Query Frame = 3
Query:  312 GSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTRE-----------HELREHFQMIASSKLILG-----CMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGE 1058
            G+   + + Q        Y CP C +S+ + + F KH R    ++ Y+C +C + Y  L  L  H  R+H          G   F C +C    +   ++  H+R H   KP+ C  CGK F Q ++ ++H+  H   ++ F C  CG+ F+    +  H R  E            + R+   +    ++  G     C+ C+ TF + ++L +H     ++   +  F C+ C   F++  +L  H + H G +   C  CG+
Sbjct:  150 GTLSKLKIHQRGHTGERPYACPDCGKSFADPSVFRKHRRTHAGLRPYSCERCGKAYAELKDLRNH-ERSHT---------GERPFLCSECGKSFSRSSSLTCHQRIHAAQKPYRCPACGKGFTQLSSYQSHERTH-SGEKPFLCPRCGRMFSDPSSFRRHQRAHEGVKPYRCEKCGKDFRQPADLAMHRRVHTGDRPFKCLQCDKTFVASWDLKRHA----LVHSGQRPFRCEECGRAFAERASLTKHSRMHSGERPFHCNACGK 399          

HSP 4 Score: 81.2629 bits (199), Expect = 7.477e-15
Identity = 85/353 (24.08%), Postives = 126/353 (35.69%), Query Frame = 3
Query:  354 NGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQC-EQFYETLSQLFLHARRTHVDXXXXXXXXGNYK-FHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRH----------------------IHK-----DRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHT 1325
            +G  Y+C  C +++ NA    +H         +T   C E+  E   ++    +       K   +    + + CP C         +  H R+HTG KPF C  CG+ F Q   ++ H   H                      IH+     +R + C  CGK+F    ++  H RT       H  +   S     C  C   +  + +L  H RS       E  F C  C   FS   +L  H + H   +   CP CG+    GF QL+ + +        +  +C  C   F          SD  S  R+ R   G V   RC     DF   + + M  H R HT
Sbjct:   18 SGRRYKCLFCTKTFPNAPRAARH------AATHTPTDCTEEVREAQPKVDTEPKAEEASGDKVSASVAKPRPYACPLCPKAYKTAPELRSHGRSHTGEKPFPCPECGRRFMQPVCLRVHLASHAGELPFRCTHCPKAYGTLSKLKIHQRGHTGERPYACPDCGKSFADPSVFRKHRRT-------HAGLRPYS-----CERCGKAYAELKDLRNHERS----HTGERPFLCSECGKSFSRSSSLTCHQRIHAAQKPYRCPACGK----GFTQLSSYQSHERTHSGEKPFLCPRCGRMF----------SDPSSFRRHQRAHEG-VKPYRCEKCGKDFRQPADLAM--HRRVHT 331          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|P10076|ZFP26_MOUSE (Zinc finger protein 26 OS=Mus musculus OX=10090 GN=Zfp26 PE=2 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 8.154e-24
Identity = 90/336 (26.79%), Postives = 147/336 (43.75%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRT----REHELREHFQMIASSKLILG------------CMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHT 1325
            Y C  C +++   +  T H+R+    + Y C +CE+ + + +QL  H + TH          G   F C  C     N   ++ H R HTG+KP+ C+ CGK F  ++ +  H   H + ++ + C+ CGKAF++    + H+R     +  E  +  + +A S  ++G            C  C+ TF     L  H R+       E  + CK C   F +   L  H+++H G +   C  CG +GF  F QL  HI + H+    R   C+ C  +F +   L+ H   +H+           V   +C Y    FT+ S + +  H R HT
Sbjct:  386 YECKVCGKAFSGRSWLTIHLRKHTGERPYPCTECEKAFTSFAQLTEHIK-THT---------GEKPFRCKVCARTFRNSSCLKTHFRIHTGIKPYKCNYCGKAFTARSGLTKHVLIH-NGEKPYECKECGKAFSTSSGLVEHIRIHTGEKPFECYQCGKALAHSSSLVGHLRTHTGEKPFECNQCDKTFTRSSYLRIHMRT----HTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYECKECG-KGFISFAQLTVHI-KTHS--SERPFQCKVCTKSFRNSSSLETHF-RIHT----------GVKPYKCSYCGKAFTARSGLTI--HLRNHT 689          

HSP 2 Score: 110.153 bits (274), Expect = 7.401e-23
Identity = 77/275 (28.00%), Postives = 126/275 (45.82%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHI 1190
            Y C  C +++   +  TKH+R     + Y C++C + + + +QL +H + TH   +          F C  C     N  ++E H R HTGVKP+ C  CGK F  ++ +  H   H   ++ + C+ CGKAF++    +AH+R+  H+  + F+          C  C   F S   LN H +    +   E  F C  C   F+    L  H+++H G +   C +CG + F   + L  H+ R H     + +VC+YC   F     L+ H+
Sbjct:  582 YECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIK-THSSER---------PFQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTARSGLTIHLRNHT-GEKSYACQECGKAFSTSSGLIAHIRS--HKGEKPFE----------CDHCGKAFASSSYLNVHLK----IHTGEKPFQCTVCGKTFTCSSYLPVHMRTHTGEKPFQCIICG-KSFLWSSYLRVHM-RIHT--GEKPYVCQYCGKAFTEHSGLNKHL 825          

HSP 3 Score: 100.138 bits (248), Expect = 9.872e-20
Identity = 89/357 (24.93%), Postives = 136/357 (38.10%), Query Frame = 3
Query:  147 LFASGNVQTLSNDDEIIQVSDSGIISDTIV-QLEGESYHVI--------SDENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHI 1190
            +F     Q     ++ ++ SD G   +T V QLE +++           S+E GQ    P +  G          I      Y C  C + + +      HM+     K Y C++C + +   S L +H R+   +            + C +C         +  H R+HTG KP+ CD CG  FA  + + TH   H   ++ F C  CGKAF      L H+RT  H   + ++          C  C   F     L  H R        E  + C  C+  F+    L  H+K+H G +   C VC  R F   + L  H      +K  +   C YC   F ++  L  H+
Sbjct:  175 IFTPDVSQKKCTPEKSVECSDCG---ETFVNQLELQTHSSSHREKNIHKSEECGQASTHPISHGG--------HVIPTEKKYYECKKCEKFFTHPVYLNIHMQSHTVEKPYDCKECGKAFTERSSLIVHLRQHTREKS----------YECKECGKTFIQPSRLTEHMRSHTGEKPYQCDQCGNAFASSSYLTTHLRTHT-GEKPFECNICGKAFTRSSYLLGHIRT--HTGEKPYE----------CKVCGKAFSGRSWLTIHLRK----HTGERPYPCTECEKAFTSFAQLTEHIKTHTGEKPFRCKVCA-RTFRNSSCLKTHFRIHTGIKPYK---CNYCGKAFTARSGLTKHV 489          

HSP 4 Score: 94.3597 bits (233), Expect = 5.655e-18
Identity = 79/299 (26.42%), Postives = 118/299 (39.46%), Query Frame = 3
Query:  345 IDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHE-----------------LREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHI 1190
            I N    Y C  C +++  ++   +H+R     K + C QC +     S L  H  RTH          G   F C  C+        +  H R HTG KP+ C  CGK F +++ +  H   H   +R + C+ CGK F S+     H++T   E                 L  HF++    K    C  C   F +   L  H R+       E  + C+ C   FS    L +H++SH+G +   C  CG + F   + LN H+ + H     +   C  C  TF     L  H+
Sbjct:  491 IHNGEKPYECKECGKAFSTSSGLVEHIRIHTGEKPFECYQCGKALAHSSSLVGHL-RTHT---------GEKPFECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHT-GERPYECKECGKGFISFAQLTVHIKTHSSERPFQCKVCTKSFRNSSSLETHFRIHTGVK-PYKCSYCGKAFTARSGLTIHLRN----HTGEKSYACQECGKAFSTSSGLIAHIRSHKGEKPFECDHCG-KAFASSSYLNVHL-KIHT--GEKPFQCTVCGKTFTCSSYLPVHM 769          

HSP 5 Score: 88.9669 bits (219), Expect = 2.839e-16
Identity = 63/231 (27.27%), Postives = 97/231 (41.99%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGE 1058
            ++C  C +S++N+++   H R    VK Y C  C + +   S L +H R           + G   + C +C    +    +  H R+H G KPF CD CGK FA  + +  H   H   ++ F+C  CGK F        H+RT  H   + FQ          C+ C  +F     L  H R    +   E  + C+ C   F++   L  H++ H G +      CGE
Sbjct:  638 FQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTARSGLTIHLRN----------HTGEKSYACQECGKAFSTSSGLIAHIRSHKGEKPFECDHCGKAFASSSYLNVHLKIHT-GEKPFQCTVCGKTFTCSSYLPVHMRT--HTGEKPFQ----------CIICGKSFLWSSYLRVHMR----IHTGEKPYVCQYCGKAFTEHSGLNKHLRKHTGEKPYEYKECGE 841          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q96JL9|ZN333_HUMAN (Zinc finger protein 333 OS=Homo sapiens OX=9606 GN=ZNF333 PE=2 SV=3)

HSP 1 Score: 112.464 bits (280), Expect = 1.109e-23
Identity = 81/307 (26.38%), Postives = 124/307 (40.39%), Query Frame = 3
Query:  318 SGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHE-----------------LREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGH 1187
            S ++ V + I +   +Y C  C +S++ ++   +H +     K + C++C Q ++  S L  H  RTH          G   F C  C         +  H+R HTG KP+ C  CGK F Q +++++H   H   ++ F C  CGKAF  +     HLRT   E                 L  H ++    KL   C  C      +  L  H R+       E  + C+ C   FS+  +L+ H ++H G +  +C  CG      F Q +H I         R + C  CE  F     L  H
Sbjct:  350 SAHLIVPEKIRSGDKSYACNKCEKSFRYSSDLIRHEKTHTAEKCFDCQECGQAFKYSSNLRRHM-RTHT---------GEKPFECSQCGKTFTRNFNLILHQRNHTGEKPYECKDCGKAFNQPSSLRSHVRTHT-GEKPFECSQCGKAFREHSSLKTHLRTHTREKPYECNQCGKPFRTSTHLNVHKRIHTGEKL-YECATCGQVLSRLSTLKSHMRT----HTGEKPYVCQECGRAFSEPSSLRKHARTHSGKKPYACQECGR----AFGQSSHLIVHVRTHSAGRPYQCNQCEKAFRHSSSLTVH 636          

HSP 2 Score: 65.4698 bits (158), Expect = 3.593e-9
Identity = 42/145 (28.97%), Postives = 61/145 (42.07%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRT 800
            Y C  C + ++ +     H R     K+Y C  C Q    LS L  H R TH          G   + C +C    +   ++  H R H+G KP++C  CG+ F Q +++  H   H    R ++C  C KAF        H RT
Sbjct:  506 YECNQCGKPFRTSTHLNVHKRIHTGEKLYECATCGQVLSRLSTLKSHMR-THT---------GEKPYVCQECGRAFSEPSSLRKHARTHSGKKPYACQECGRAFGQSSHLIVHVRTH-SAGRPYQCNQCEKAFRHSSSLTVHKRT 639          

HSP 3 Score: 56.6102 bits (135), Expect = 2.111e-6
Identity = 39/148 (26.35%), Postives = 62/148 (41.89%), Query Frame = 3
Query:  303 NQTG----SSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRI 734
            NQ G    +S ++ V + I      Y C +C Q     +    HMR     K Y C++C + +   S L  HAR TH          G   + C +C         +  H R H+  +P+ C+ C K F   +++  HK  H+ ++ I
Sbjct:  509 NQCGKPFRTSTHLNVHKRIHTGEKLYECATCGQVLSRLSTLKSHMRTHTGEKPYVCQECGRAFSEPSSLRKHAR-TH---------SGKKPYACQECGRAFGQSSHLIVHVRTHSAGRPYQCNQCEKAFRHSSSLTVHKRTHVGRETI 646          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q90625|ZBT17_CHICK (Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus OX=9031 GN=ZBTB17 PE=2 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 1.401e-23
Identity = 74/275 (26.91%), Postives = 113/275 (41.09%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHI 1190
            + C  C +++ +  A   H +    +K Y C +C + Y  +S L LH +R          + G  K+ C DC  +    G ++ H+  H+G KP+ CD CG+ F+   +   H   H   D+  +C  C K FN      AHL+            I  +   L C  C N F +  NL +H R    +   E  + C  C   F+D   L++HV  H G +   C +CG+     F Q +  I         + +VC  C   F     L  HI
Sbjct:  233 FSCRECNKAFSDPAACKAHEKTHSPLKPYGCEECGKSYRLISLLNLHKKR----------HTGEAKYRCDDCGKLFTTSGNLKRHQLVHSGEKPYQCDYCGRSFSDPTSKMRHLETH-DTDKEHKCPHCDKKFNQVGNLKAHLK------------IHIADGPLKCRECGNEFTTSGNLKRHLR----IHSGEKPYVCVHCQRQFADPGALQAHVPIHTGEKPCQCLICGK----AFTQASSLIAHVRHDTGEKPYVCERCGKRFVQSSQLANHI 476          

HSP 2 Score: 84.3445 bits (207), Expect = 6.160e-15
Identity = 68/256 (26.56%), Postives = 108/256 (42.19%), Query Frame = 3
Query:  315 SSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXX-------XXXXXXGNYKFH-----------CPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKS-HEG 1025
            +SGN+   Q + +    Y+C  C +S+ +  +  +H+      K + C  C++ +  +  L  H +    D               GN K H           C  C     + G ++ H   HTG KP  C ICGK F Q +++  H  RH   ++ + CE CGK F        H+R  ++ +R H            C  CN  F ++ +L+KH     I+   E  F C  C   F+ +  L+SHVK+ H+G
Sbjct:  300 TSGNLKRHQLVHSGEKPYQCDYCGRSFSDPTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECGNEFTTSGNLKRHLRIHSGEKPYVCVHCQRQFADPGALQAHVPIHTGEKPCQCLICGKAFTQASSLIAHV-RHDTGEKPYVCERCGKRFVQSSQLANHIRHHDN-IRPH-----------KCTVCNKAFVNVGDLSKHI----IIHTGEKPFLCDKCGRGFNRVDNLRSHVKTVHQG 538          

HSP 3 Score: 62.7734 bits (151), Expect = 2.958e-8
Identity = 62/226 (27.43%), Postives = 88/226 (38.94%), Query Frame = 3
Query:  654 CDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFD--SMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHT 1325
            C+ CGK F    N K H   H   ++ F C  C KAF+      AH +T             S     GC  C  ++   S+ NL+K  R  G     E K+ C  C   F+    LK H   H G +   C  CG R F        H+        ++ H C +C+  F    +L  H+  +H           A G L+CR    +FT++    + RH R H+
Sbjct:  207 CEDCGKEFTHTGNFKRHIRIHT-GEKPFSCRECNKAFSDPAACKAHEKTH------------SPLKPYGCEECGKSYRLISLLNLHK-KRHTG-----EAKYRCDDCGKLFTTSGNLKRHQLVHSGEKPYQCDYCG-RSFSDPTSKMRHL---ETHDTDKEHKCPHCDKKFNQVGNLKAHLK-IHI----------ADGPLKCRECGNEFTTSGN--LKRHLRIHS 396          

HSP 4 Score: 55.8398 bits (133), Expect = 3.715e-6
Identity = 39/166 (23.49%), Postives = 65/166 (39.16%), Query Frame = 3
Query:  303 NQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRT 800
            N+  +SGN+     I +    Y C  C + + +  A   H+      K   C  C + +   S L  H R           + G   + C  C         + +H R H  ++P  C +C K F    ++  H   H   ++ F C+ CG+ FN  D   +H++T
Sbjct:  380 NEFTTSGNLKRHLRIHSGEKPYVCVHCQRQFADPGALQAHVPIHTGEKPCQCLICGKAFTQASSLIAHVRH----------DTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCTVCNKAFVNVGDLSKHIIIHT-GEKPFLCDKCGRGFNRVDNLRSHVKT 534          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q8K2R5|ZN668_MOUSE (Zinc finger protein 668 OS=Mus musculus OX=10090 GN=Znf668 PE=2 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 2.962e-23
Identity = 85/314 (27.07%), Postives = 128/314 (40.76%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMR----EKHF--------------VKV----------YTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNAR 1223
            Y CP CP++Y+ A     H R    EK F              ++V          + C  C + Y TLS+L +H +R H          G   + CPDC     +      HRR H G++P+SC+ CGK +A+  +++ H+  H   +R F C  CGK+F+       H            Q I +++    C  C   F  + +   H R+       E  F C  C   FSD  + + H ++HEG +   C  CG+     F Q             +R   C  C+ TF +  DL  H + +HS +R  R
Sbjct:   84 YACPLCPKAYKTAPELRSHGRSHTGEKPFPCPECGRRFMQPVCLRVHLASHAGELPFRCTHCPKAYGTLSKLKIH-QRGHT---------GERPYACPDCGKSFADPSVFRKHRRTHAGLRPYSCERCGKAYAELKDLRNHERSHT-GERPFLCSECGKSFSRSSSLTCH------------QRIHAAQKPYRCPACGKGFTQLSSYQSHERT----HSGEKPFLCPRCGRMFSDPSSFRRHQRAHEGVKPYRCEKCGK----DFRQPADLAMHRRVHTGDRPFKCLQCDKTFVASWDLKRH-ALVHSGQRPFR 365          

HSP 2 Score: 99.3673 bits (246), Expect = 1.148e-19
Identity = 67/226 (29.65%), Postives = 100/226 (44.25%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAF-NSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIIS 1040
            + C  C +S+  +++ T H R     K Y C  C + +  LS    H  RTH          G   F CP C  M ++  +   H+RAH GVKP+ C+ CGK F Q A++  H+  H   DR F+C  C K F  S+D            L+ H  ++ S +    C  C   F    +L KH+R    +   E  F C +C   F  + +L+ H ++H  N+   
Sbjct:  224 FLCSECGKSFSRSSSLTCHQRIHAAQKPYRCPACGKGFTQLSSYQSH-ERTH---------SGEKPFLCPRCGRMFSDPSSFRRHQRAHEGVKPYRCEKCGKDFRQPADLAMHRRVHT-GDRPFKCLQCDKTFVASWD------------LKRH-ALVHSGQRPFRCEECGRAFAERASLTKHSR----MHSGERPFHCNACGKSFVVLSSLRKHERTHRSNETTG 421          

HSP 3 Score: 99.3673 bits (246), Expect = 1.158e-19
Identity = 64/265 (24.15%), Postives = 114/265 (43.02%), Query Frame = 3
Query:  312 GSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTRE-----------HELREHFQMIASSKLILG-----CMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGE 1058
            G+   + + Q        Y CP C +S+ + + F KH R    ++ Y+C +C + Y  L  L  H  R+H          G   F C +C    +   ++  H+R H   KP+ C  CGK F Q ++ ++H+  H   ++ F C  CG+ F+    +  H R  E            + R+   +    ++  G     C+ C+ TF + ++L +H     ++   +  F C+ C   F++  +L  H + H G +   C  CG+
Sbjct:  150 GTLSKLKIHQRGHTGERPYACPDCGKSFADPSVFRKHRRTHAGLRPYSCERCGKAYAELKDLRNH-ERSHT---------GERPFLCSECGKSFSRSSSLTCHQRIHAAQKPYRCPACGKGFTQLSSYQSHERTH-SGEKPFLCPRCGRMFSDPSSFRRHQRAHEGVKPYRCEKCGKDFRQPADLAMHRRVHTGDRPFKCLQCDKTFVASWDLKRHA----LVHSGQRPFRCEECGRAFAERASLTKHSRMHSGERPFHCNACGK 399          

HSP 4 Score: 81.2629 bits (199), Expect = 5.230e-14
Identity = 85/353 (24.08%), Postives = 126/353 (35.69%), Query Frame = 3
Query:  354 NGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQC-EQFYETLSQLFLHARRTHVDXXXXXXXXGNYK-FHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRH----------------------IHK-----DRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHT 1325
            +G  Y+C  C +++ NA    +H         +T   C E+  E   ++    +       K   +    + + CP C         +  H R+HTG KPF C  CG+ F Q   ++ H   H                      IH+     +R + C  CGK+F    ++  H RT       H  +   S     C  C   +  + +L  H RS       E  F C  C   FS   +L  H + H   +   CP CG+    GF QL+ + +        +  +C  C   F          SD  S  R+ R   G V   RC     DF   + + M  H R HT
Sbjct:   18 SGRRYKCLFCTKTFPNAPRAARH------AATHTPTDCTEEVREAQPKVDTEPKAEEASGDKVSASVAKPRPYACPLCPKAYKTAPELRSHGRSHTGEKPFPCPECGRRFMQPVCLRVHLASHAGELPFRCTHCPKAYGTLSKLKIHQRGHTGERPYACPDCGKSFADPSVFRKHRRT-------HAGLRPYS-----CERCGKAYAELKDLRNHERS----HTGERPFLCSECGKSFSRSSSLTCHQRIHAAQKPYRCPACGK----GFTQLSSYQSHERTHSGEKPFLCPRCGRMF----------SDPSSFRRHQRAHEG-VKPYRCEKCGKDFRQPADLAM--HRRVHT 331          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q6NX45|ZN774_HUMAN (Zinc finger protein 774 OS=Homo sapiens OX=9606 GN=ZNF774 PE=1 SV=2)

HSP 1 Score: 107.842 bits (268), Expect = 7.931e-23
Identity = 83/349 (23.78%), Postives = 146/349 (41.83%), Query Frame = 3
Query:  144 SLFASGNVQTLSNDDEIIQVSDSGIISDTIVQLEGESY--------HVISDENGQTYLAPTNQTG--SSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTF 1160
            +L   G +++ S + ++ ++ D  +    +    G+S+        H+ +    + Y       G   S ++   +        Y+C  C + + +++   KH R     + Y C +C + +     L +H +RTH          G   + C +C+   +       H+R HTGVKP+ C+ CG+ F+Q +++  H+  H   +R F+C  CGK F     ++AH+ T             S +    C  C+ +F    +L  H R+       E  F C++C   F+D   L  H + H G +   C  CG+     FNQ +H IT       +R + C  C  TF
Sbjct:  123 TLPGEGQLESFSQERDLNKLLDGYVGEKPMCAECGKSFNQSSYLIRHLRTHTGERPYTCIECGKGFKQSSDLVTHRRTHTGEKPYQCKGCEKKFSDSSTLIKHQRTHTGERPYECPECGKTFGRKPHLIMH-QRTHT---------GEKPYACLECHKSFSRSSNFITHQRTHTGVKPYRCNDCGESFSQSSDLIKHQRTHT-GERPFKCPECGKGFRDSSHFVAHMSTH------------SGERPFSCPDCHKSFSQSSHLVTHQRT----HTGERPFKCENCGKGFADSSALIKHQRIHTGERPYKCGECGK----SFNQSSHFITHQRIHLGDRPYRCPECGKTF 440          

HSP 2 Score: 96.6709 bits (239), Expect = 3.974e-19
Identity = 74/281 (26.33%), Postives = 117/281 (41.64%), Query Frame = 3
Query:  372 CPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEER 1214
            C  C +S+  ++   +H+R     + YTC +C + ++  S L  H RRTH          G   + C  C    ++  T+  H+R HTG +P+ C  CGK F +K ++  H+  H   ++ + C  C K+F+    ++ H RT             +      C  C  +F    +L KH R+       E  F C  C   F D     +H+ +H G +  SCP C +     F+Q +H +T        R   C  C   F     L  H   +H+ ER
Sbjct:  153 CAECGKSFNQSSYLIRHLRTHTGERPYTCIECGKGFKQSSDLVTH-RRTHT---------GEKPYQCKGCEKKFSDSSTLIKHQRTHTGERPYECPECGKTFGRKPHLIMHQRTHT-GEKPYACLECHKSFSRSSNFITHQRTH------------TGVKPYRCNDCGESFSQSSDLIKHQRT----HTGERPFKCPECGKGFRDSSHFVAHMSTHSGERPFSCPDCHK----SFSQSSHLVTHQRTHTGERPFKCENCGKGFADSSALIKH-QRIHTGER 401          

HSP 3 Score: 87.4261 bits (215), Expect = 3.313e-16
Identity = 63/247 (25.51%), Postives = 98/247 (39.68%), Query Frame = 3
Query:  312 GSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVC 1052
            G   ++ + Q        Y C  C +S+  ++ F  H R    VK Y C  C + +   S L  H +RTH          G   F CP+C     +      H   H+G +PFSC  C K F+Q +++ TH+  H   +R F+CE CGK F      + H            Q I + +    C  C  +F+   +   H R    +   +  + C  C   F+      +H ++H G +   C  C
Sbjct:  245 GRKPHLIMHQRTHTGEKPYACLECHKSFSRSSNFITHQRTHTGVKPYRCNDCGESFSQSSDLIKH-QRTHT---------GERPFKCPECGKGFRDSSHFVAHMSTHSGERPFSCPDCHKSFSQSSHLVTHQRTHT-GERPFKCENCGKGFADSSALIKH------------QRIHTGERPYKCGECGKSFNQSSHFITHQR----IHLGDRPYRCPECGKTFNQRSHFLTHQRTHTGEKPFHCSKC 464          

HSP 4 Score: 83.5741 bits (205), Expect = 6.122e-15
Identity = 63/240 (26.25%), Postives = 95/240 (39.58%), Query Frame = 3
Query:  318 SGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQII 1037
            S N    Q        YRC  C +S+  ++   KH R     + + C +C + +   S    H   TH          G   F CPDC+   +    +  H+R HTG +PF C+ CGK FA  + +  H+  H   +R ++C  CGK+FN    ++ H            Q I        C  C  TF+   +   H R+       E  F C  C+  F      K+H+  H+   +I
Sbjct:  275 SSNFITHQRTHTGVKPYRCNDCGESFSQSSDLIKHQRTHTGERPFKCPECGKGFRDSSHFVAHMS-TH---------SGERPFSCPDCHKSFSQSSHLVTHQRTHTGERPFKCENCGKGFADSSALIKHQRIHT-GERPYKCGECGKSFNQSSHFITH------------QRIHLGDRPYRCPECGKTFNQRSHFLTHQRT----HTGEKPFHCSKCNKSFRQ----KAHLLCHQNTHLI 483          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. TrEMBL
Match: A0A0R3WKD6 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS1174 PE=4 SV=1)

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 306/468 (65.38%), Postives = 372/468 (79.49%), Query Frame = 3
Query:   27 YNLLMDDHNVFLTINDNQSMHD-EDMVVIS-EETLDMNTLQSLFASGNVQTLSNDD--EIIQVSDSGIISDT-IVQLEGESYHVISDENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHTLQGTNGNYALTLPQSRYSKYNKRRKIREAK 1415
            Y    D   V+L++ND    +D EDMV+I+ ++ LDM TL+SL ASG V T++ +   E +Q++D  ++  T I+++  E            Y AP   +GS G + +A      GITYRCPSCP  Y NANAFTKHMREKHFVKVYTCRQCE+F+ETLSQLFLHARR HVDPKKPK+NP NYKFHC  CNYMTNNGGTMEHH+RAHTG KPF CD+C K FAQKANMKTH+NRHI++D+IFRC+TC KAF+SYDIYLAHLRTREHELREHF M+ASS+L L C+GC+ TFDS++NLNKHTRSC I++ ++TKF C  C++Y SD+ +LK+HVK+HEG+QIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFE KKDLD HI  MH+EERNARQSRGAVGRL+CRY+ C+FT+NS+ML+DRHH QH  Q  +G  +++LP +RY    KRR++R +K
Sbjct:   26 YAATGDTGQVYLSLNDLGIQNDGEDMVLIAADDNLDMATLESLIASGAVTTVTGEGGTEFVQLADQTLVDGTQIIEVSPEQMQFYDPATKTYYGAPGIVSGSGGILTMAGA-QPGGITYRCPSCPAVYSNANAFTKHMREKHFVKVYTCRQCEEFFETLSQLFLHARRCHVDPKKPKRNPANYKFHCDQCNYMTNNGGTMEHHKRAHTGEKPFVCDVCNKRFAQKANMKTHRNRHIYRDKIFRCDTCNKAFSSYDIYLAHLRTREHELREHFAMMASSQLSLECLGCSLTFDSIYNLNKHTRSCRIVRTLQTKFRCLPCNAYVSDVASLKAHVKAHEGSQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFEMKKDLDTHIRSMHAEERNARQSRGAVGRLKCRYSQCEFTTNSIMLLDRHHDQHRRQEEDGEDSVSLPPARYVSSTKRRRLRGSK 492          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. TrEMBL
Match: A0A0R3W5T8 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5506 PE=4 SV=2)

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 305/468 (65.17%), Postives = 369/468 (78.85%), Query Frame = 3
Query:   27 YNLLMDDHNVFLTINDNQSMHD-EDMVVIS-EETLDMNTLQSLFASGNVQTLSNDD--EIIQVSDSGIISDT-IVQLEGESYHVISDENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHTLQGTNGNYALTLPQSRYSKYNKRRKIREAK 1415
            Y    D   V+L++ND    +D EDMV+I+ ++ LDM TL+SL ASG V T++ +   E++Q+ D   +  T I+++  E      D   +TY        SSG I         GITY+CPSCP  Y NANAFTKHMREKHFVKVYTCRQCE+F+ETLSQLFLHARR HVDPKKPK+NP NYKFHC  CNYMTNNGGTMEHH+RAHTG KPF CD+C K FAQKANMKTH+NRHI++D+IFRC+TC KAF+SYDIYLAHLRTREHELREHF M+ASS+L L C+GC+ TFDS++NLNKHTRSC I++ ++TKF C  C++Y SD+ +LK+HVK+HEG+QIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFE KKDLD HI  MH+EERNARQSRGAVGRL+CRY+ C+FT+NS+ML+DRHH QH  Q  +G  +++LP +RY    KRR++R +K
Sbjct:   26 YAATGDSGQVYLSLNDLGIQNDGEDMVLIAADDNLDMATLESLIASGAVTTVTGEGSAELVQLGDQTFVDGTQIIEVSPEQMQFY-DPATKTYYGAPGIVSSSGGILTMAGAQPGGITYKCPSCPAMYSNANAFTKHMREKHFVKVYTCRQCEEFFETLSQLFLHARRCHVDPKKPKRNPANYKFHCDQCNYMTNNGGTMEHHKRAHTGEKPFVCDVCNKRFAQKANMKTHRNRHIYRDKIFRCDTCNKAFSSYDIYLAHLRTREHELREHFAMMASSQLSLECLGCSLTFDSIYNLNKHTRSCRIVRTLQTKFRCLPCNAYVSDVASLKAHVKAHEGSQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFEMKKDLDTHIRSMHAEERNARQSRGAVGRLKCRYSQCEFTTNSIMLLDRHHDQHRRQEEDGEDSVSLPPARYVSSTKRRRLRGSK 492          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. TrEMBL
Match: U6J2H9 (Zinc finger and SCAN domain-containing protein 2 OS=Echinococcus granulosus OX=6210 GN=EGR_06219 PE=4 SV=1)

HSP 1 Score: 634.41 bits (1635), Expect = 0.000e+0
Identity = 304/468 (64.96%), Postives = 370/468 (79.06%), Query Frame = 3
Query:   27 YNLLMDDHNVFLTINDNQSMHD-EDMVVIS-EETLDMNTLQSLFASGNVQTLSNDD--EIIQVSDSGIISDT-IVQLEGESYHVISDENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHTLQGTNGNYALTLPQSRYSKYNKRRKIREAK 1415
            Y    ++  V+L++ND    +D EDMV+I+ ++ LDM TL+SL ASG V T++ +   E +Q+ D  ++  T I+++  E      D   +TY        SSG I         GITY+CPSCP  Y NANAFTKHMREKHFVKVYTCRQCE+F+ETLSQLFLHARR HVDPKKPK+NP NYKFHC  CNYMTNNGGTMEHH+RAHTG KPF CD+C K FAQKANMKTH+NRHI++D+IFRC+TC KAF+SYDIYLAHLRTREHELREHF M+ASS+L L C+GC+ TFDS++NLNKHTRSC I++ ++TKF C  C++Y SD+ +LK+HVK+HEG+QIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFE KKDLD HI  MH+EERNARQSRGAVGRL+CRY+ C+FT+NS+ML+DRHH QH  Q  +G  +++LP +RY    KRR++R +K
Sbjct:   26 YAATGENGQVYLSLNDLGIQNDGEDMVLIAADDNLDMATLESLIASGAVTTVTGEGGTEFVQLGDQTLVDGTQIIEVSPEQMQ-FYDPATKTYYGAPGIVSSSGGILTMAGTQPGGITYKCPSCPAMYSNANAFTKHMREKHFVKVYTCRQCEEFFETLSQLFLHARRCHVDPKKPKRNPANYKFHCDQCNYMTNNGGTMEHHKRAHTGEKPFVCDVCNKRFAQKANMKTHRNRHIYRDKIFRCDTCNKAFSSYDIYLAHLRTREHELREHFAMMASSQLSLECLGCSLTFDSIYNLNKHTRSCRIVRTLQTKFRCLPCNAYVSDVASLKAHVKAHEGSQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFEMKKDLDTHIRSMHAEERNARQSRGAVGRLKCRYSQCEFTTNSIMLLDRHHDQHRRQEEDGEDSVSLPPARYVSSTKRRRLRGSK 492          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. TrEMBL
Match: A0A068Y1F6 (Zinc finger protein 271 OS=Echinococcus multilocularis OX=6211 PE=4 SV=1)

HSP 1 Score: 633.639 bits (1633), Expect = 0.000e+0
Identity = 304/468 (64.96%), Postives = 370/468 (79.06%), Query Frame = 3
Query:   27 YNLLMDDHNVFLTINDNQSMHD-EDMVVIS-EETLDMNTLQSLFASGNVQTLSNDD--EIIQVSDSGIISDT-IVQLEGESYHVISDENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHTLQGTNGNYALTLPQSRYSKYNKRRKIREAK 1415
            Y    ++  V+L++ND    +D EDMV+I+ ++ LDM TL+SL ASG V T++ +   E +Q+ D  ++  T I+++  E      D   +TY        SSG I         GITY+CPSCP  Y NANAFTKHMREKHFVKVYTCRQCE+F+ETLSQLFLHARR HVDPKKPK+NP NYKFHC  CNYMTNNGGTMEHH+RAHTG KPF CD+C K FAQKANMKTH+NRHI++D+IFRC+TC KAF+SYDIYLAHLRTREHELREHF M+ASS+L L C+GC+ TFDS++NLNKHTRSC I++ ++TKF C  C++Y SD+ +LK+HVK+HEG+QIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFE KKDLD HI  MH+EERNARQSRGAVGRL+CRY+ C+FT+NS+ML+DRHH QH  Q  +G  +++LP +RY    KRR++R +K
Sbjct:   26 YAATGENGQVYLSLNDLGIQNDGEDMVLIAADDNLDMATLESLIASGAVTTVTGEGGTEFVQLGDQTLVDGTQIIEVSPEQMQ-FYDPATKTYYGAPGIVSSSGGILTMAGTQPGGITYKCPSCPAMYSNANAFTKHMREKHFVKVYTCRQCEEFFETLSQLFLHARRCHVDPKKPKRNPANYKFHCDQCNYMTNNGGTMEHHKRAHTGEKPFVCDVCNKRFAQKANMKTHRNRHIYRDKIFRCDTCNKAFSSYDIYLAHLRTREHELREHFAMMASSQLSLECLGCSLTFDSIYNLNKHTRSCRIVRTLQTKFRCLPCNAYVSDVASLKAHVKAHEGSQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFEMKKDLDTHIRSMHAEERNARQSRGAVGRLKCRYSQCEFTTNSIMLLDRHHDQHRRQEEDGEDSVSLPPARYVSGTKRRRLRGSK 492          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. TrEMBL
Match: A0A0R3TTN3 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS11076 PE=4 SV=1)

HSP 1 Score: 627.476 bits (1617), Expect = 0.000e+0
Identity = 297/473 (62.79%), Postives = 367/473 (77.59%), Query Frame = 3
Query:   12 FRYI*YNLLMDDHNVFLTIND--NQSMHDEDMVVISEETLDMNTLQSLFASGNVQTLS--NDDEIIQVSDSGIISDT-IVQLEGESYHVISDENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHTLQGTNGNYALTLPQSRYSKYNKRRKIREAK 1415
            +  I Y    D+  V+L++ND   Q+  DE MV+ +++ +D+ TL++L ASG V T++  N  E +Q+ D G+I  T + ++  +            Y  P   +G++G           GITY+CPSCP  Y NANAFTKHMREKHFVKVYTCRQC++F+ETLSQLFLHARR+HVDPKKPK+NP NYKFHC  C+YMTNNGGTMEHH+RAHTG KPF CD+C K FAQKANMKTH+NRHI++D+IFRCETC KAF+SYDIYLAHLRTREHELREHF M+ASS+L L C+GC+ +FDS++NLNKHTR C I++ ++TKF C  C++Y SD+  LK+HVK+HEG+QIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFE KKDLD HI  MH+EERNARQSRGAVGRL+CRY  C+FT+NS+ML+DRHH QH  Q  +G   ++LP +RY+   KRR+ R +K
Sbjct:   21 YTAIPYGATADNGQVYLSLNDLGIQNDGDEIMVIAADDNIDVATLENLIASGAVTTVTGENGTEYVQIGDQGLIDGTQLFEVASDQMQFYDPTTKTYYGVPNMVSGAAGPFVNLSNAQPGGITYKCPSCPALYSNANAFTKHMREKHFVKVYTCRQCDEFFETLSQLFLHARRSHVDPKKPKRNPANYKFHCDQCSYMTNNGGTMEHHKRAHTGEKPFVCDVCNKRFAQKANMKTHRNRHIYRDKIFRCETCNKAFSSYDIYLAHLRTREHELREHFAMMASSQLHLECLGCSLSFDSIYNLNKHTRGCRIVRSLQTKFRCLPCNAYVSDVSALKAHVKAHEGSQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFEQKKDLDAHIRSMHAEERNARQSRGAVGRLKCRYEPCEFTTNSIMLLDRHHDQHRRQEEDGEDGMSLPPARYAPSTKRRRYRGSK 493          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000031188.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001626.1:125101:126261:-1 gene:ENSAMXG00000038280.1 transcript:ENSAMXT00000031188.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 113.235 bits (282), Expect = 5.534e-26
Identity = 92/330 (27.88%), Postives = 138/330 (41.82%), Query Frame = 3
Query:  207 DSGIISDTIVQLE-GESYHVISDENGQTYLAPTNQTGSSGNIAVAQTIDNN--GITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGH 1187
            DS I+S   ++ E  ES++         YL+P +QT           ID    G ++RCP C + +       KH R     K Y C +C + +     L +H R           + G   + C +C    N  G++  H+R HTG KPF C  CGK+F +++++KTH+  H   ++ + C  CG++F S  I      TR H       +I + +    C  C  TF     L KH R    +   E  + C  C   F     LK H  SH   +   CP CG+     F Q++         KV + + C  C S+F  +  L  H
Sbjct:    2 DSTILSSEDIKCENAESFY--------GYLSPQDQT----------QIDKEEEGTSHRCPDCGKIFTKQRDLRKHQRIHTGEKPYQCSECGKCFTQQGDLKIHQR----------IHTGEKPYQCSECGKSFNQNGSLTAHQRIHTGEKPFHCSDCGKNFNRQSSLKTHQRIHT-GEKPYHCSECGQSFRSLGIL-----TRHH-------LIHTGEKPFQCADCGMTFRESGTLKKHER----IHTGERPYQCSECGKGFIQQSALKKHQCSHAEEKPFQCPECGQ----SFRQISKLQKHQQIHKVEKVYQCSECGSSFNQESSLKRH 282          

HSP 2 Score: 96.6709 bits (239), Expect = 1.815e-20
Identity = 72/273 (26.37%), Postives = 114/273 (41.76%), Query Frame = 3
Query:  321 GNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLR-----------------TREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLN 1088
            G++   Q I      + C  C +++   ++   H R     K Y C +C Q + +L  L  H    H+       + G   F C DC       GT++ H R HTG +P+ C  CGK F Q++ +K H+  H  +++ F+C  CG++F        H +                  +E  L+ H Q+I +++    C  C  +F  +  L KH R    +   E  + C  C   F +  T K H + H G +   C  CG+     FNQL 
Sbjct:  109 GSLTAHQRIHTGEKPFHCSDCGKNFNRQSSLKTHQRIHTGEKPYHCSECGQSFRSLGILTRH----HL------IHTGEKPFQCADCGMTFRESGTLKKHERIHTGERPYQCSECGKGFIQQSALKKHQCSHA-EEKPFQCPECGQSFRQISKLQKHQQIHKVEKVYQCSECGSSFNQESSLKRH-QIIHTAEKPYCCSECGMSFRRISKLKKHQR----IHTGEKPYQCTECGMTFRESGTFKKHQRIHTGERPYQCSECGK----SFNQLG 361          

HSP 3 Score: 65.0846 bits (157), Expect = 2.593e-10
Identity = 40/148 (27.03%), Postives = 61/148 (41.22%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREH 809
            ++CP C QS++  +   KH +     KVY C +C   +   S L  H             +     + C +C         ++ H+R HTG KP+ C  CG  F +    K H+  H   +R ++C  CGK+FN       H     H
Sbjct:  236 FQCPECGQSFRQISKLQKHQQIHKVEKVYQCSECGSSFNQESSLKRHQ----------IIHTAEKPYCCSECGMSFRRISKLKKHQRIHTGEKPYQCTECGMTFRESGTFKKHQRIHT-GERPYQCSECGKSFNQLGTLKTHTPAHSH 372          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000043964.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000266.1:90719:94339:-1 gene:ENSAMXG00000034344.1 transcript:ENSAMXT00000043964.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.301 bits (264), Expect = 4.983e-24
Identity = 77/274 (28.10%), Postives = 110/274 (40.15%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGH 1187
            Y C  C + ++  N    H R     K + C  C + +   S L +H +R H          G   + CP+C     + GT++ H R HTG +PF C  CGK F +   +K H+  H   +R + C  CG++F  Y     H RT             + +    C  C  TF+   NL  H R    +   E  + C  C   F D   LK H   H G +   CP+C +     FNQL++  T        R + C  C  +F   K L  H
Sbjct:   48 YCCSECGKCFKQENHLKSHQRTHAVEKTFKCPYCGRIFNRQSNLQVH-QRIHT---------GEKPYPCPECERSFIDKGTLKKHLRGHTGERPFDCTECGKTFKESDALKKHQYTHT-GERFYFCSCCGRSFTRYSNLQLHQRTH------------TGEKPFVCSDCGKTFNQQTNLQVHQR----IHTGEKPYLCSECGKSFCDSSHLKKHQLIHTGEKPYHCPLCEK----SFNQLSNLQTHQRVHTGERPYYCSACGKSFRYSKSLKIH 290          

HSP 2 Score: 80.4925 bits (197), Expect = 2.291e-15
Identity = 61/228 (26.75%), Postives = 97/228 (42.54%), Query Frame = 3
Query:  324 NIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSH 1007
            N+ V Q I      Y CP C +S+ +     KH+R     + + C +C + ++    L  H + TH          G   + C  C         ++ H+R HTG KPF C  CGK F Q+ N++ H+  H   ++ + C  CGK+F       +HL+          Q+I + +    C  C  +F+ + NL  H R    +   E  + C +C   F    +LK H
Sbjct:   90 NLQVHQRIHTGEKPYPCPECERSFIDKGTLKKHLRGHTGERPFDCTECGKTFKESDALKKH-QYTHT---------GERFYFCSCCGRSFTRYSNLQLHQRTHTGEKPFVCSDCGKTFNQQTNLQVHQRIHT-GEKPYLCSECGKSFCDS----SHLKKH--------QLIHTGEKPYHCPLCEKSFNQLSNLQTHQR----VHTGERPYYCSACGKSFRYSKSLKIH 290          

HSP 3 Score: 68.1662 bits (165), Expect = 2.541e-11
Identity = 55/182 (30.22%), Postives = 79/182 (43.41%), Query Frame = 3
Query:  642 KPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGH 1187
            KP+ C  CGK F Q+ ++K+H+  H   ++ F+C  CG+ FN           R+  L+ H Q I + +    C  C  +F     L KH R        E  F C  C   F +   LK H  +H G +   C  CG R F  ++ L  H  R H  +  +  VC  C  TF  + +L  H
Sbjct:   46 KPYCCSECGKCFKQENHLKSHQRTHA-VEKTFKCPYCGRIFN-----------RQSNLQVH-QRIHTGEKPYPCPECERSFIDKGTLKKHLRG----HTGERPFDCTECGKTFKESDALKKHQYTHTGERFYFCSCCG-RSFTRYSNLQLH-QRTHTGE--KPFVCSDCGKTFNQQTNLQVH 206          

HSP 4 Score: 51.9878 bits (123), Expect = 3.275e-6
Identity = 33/128 (25.78%), Postives = 51/128 (39.84%), Query Frame = 3
Query:  324 NIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHK 707
            N+ + Q        + C  C +++        H R     K Y C +C + +   S L  H             + G   +HCP C    N    ++ H+R HTG +P+ C  CGK F    ++K HK
Sbjct:  174 NLQLHQRTHTGEKPFVCSDCGKTFNQQTNLQVHQRIHTGEKPYLCSECGKSFCDSSHLKKH----------QLIHTGEKPYHCPLCEKSFNQLSNLQTHQRVHTGERPYYCSACGKSFRYSKSLKIHK 291          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000032114.1 (zinc finger protein 2-like [Source:NCBI gene;Acc:103032995])

HSP 1 Score: 109.768 bits (273), Expect = 6.554e-24
Identity = 88/296 (29.73%), Postives = 124/296 (41.89%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRT-----------------REHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMH 1202
            Y C  C ++++  ++  +HM     +K Y C +C + +  ++ L  H R TH          G   F C +C    ++ GT+  H+R H+  KPFSC  C K FA  +NMKTH+  H ++DRI +CE CGK F   D+   HLR                  R   L  H Q   + +    C  C  +F    +L KH R        E  + C  CD  F++   L  H +SH G +   C  C +     F    H  T        R H C +C  TF     L  HIS  H
Sbjct:  366 YTCKDCGRAFRELSSLRRHMVIHTGIKPYECPECGKHFARMNHLTTHLR-THT---------GERPFPCSECGMKFSHKGTLLIHQRVHSREKPFSCPDCSKVFATLSNMKTHQLMH-NQDRIHKCEQCGKMFARPDVLKKHLRIHSGERPYLCTVCGKGFKRVQHLTNH-QRTHTGERPYACEECGTSFSQSGDLTKHMRG----HTGEKPYACADCDRRFNNSGDLSKHRRSHTGYRPYRCQECSK----AFLMPQHLKTHMLTHTGERPHSCPHCCRTFIRAHHLTEHISKHH 641          

HSP 2 Score: 97.8265 bits (242), Expect = 3.888e-20
Identity = 75/292 (25.68%), Postives = 114/292 (39.04%), Query Frame = 3
Query:  450 YTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHT 1325
            Y C+ C +   TL  L +H R           + G   + C DC        ++  H   HTG+KP+ C  CGKHFA+  ++ TH   H   +R F C  CG  F+     L H            Q + S +    C  C+  F ++ N+  H     ++   +    C+ C   F+    LK H++ H G +   C VCG+    GF ++ H           R + C  C ++F    DL  H+             RG  G       +CD   N+   + +H R HT
Sbjct:  338 YLCQHCGKNCLTLQSLTIHMR----------SHTGEKPYTCKDCGRAFRELSSLRRHMVIHTGIKPYECPECGKHFARMNHLTTHLRTHT-GERPFPCSECGMKFSHKGTLLIH------------QRVHSREKPFSCPDCSKVFATLSNMKTHQ----LMHNQDRIHKCEQCGKMFARPDVLKKHLRIHSGERPYLCTVCGK----GFKRVQHLTNHQRTHTGERPYACEECGTSFSQSGDLTKHM-------------RGHTGEKPYACADCDRRFNNSGDLSKHRRSHT 585          

HSP 3 Score: 67.781 bits (164), Expect = 7.621e-11
Identity = 59/263 (22.43%), Postives = 104/263 (39.54%), Query Frame = 3
Query:  321 GNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAH 1109
            G + + Q + +    + CP C + +   +    H    +  +++ C QC + +         AR                    PD          ++ H R H+G +P+ C +CGK F +  ++  H+  H   +R + CE CG +F+       H+R              + +    C  C+  F++  +L+KH RS    +       C+ C   F     LK+H+ +H G +  SCP C  R F   + L  HI++ H
Sbjct:  435 GTLLIHQRVHSREKPFSCPDCSKVFATLSNMKTHQLMHNQDRIHKCEQCGKMF---------AR--------------------PD---------VLKKHLRIHSGERPYLCTVCGKGFKRVQHLTNHQRTHT-GERPYACEECGTSFSQSGDLTKHMRGH------------TGEKPYACADCDRRFNNSGDLSKHRRSHTGYRPYR----CQECSKAFLMPQHLKTHMLTHTGERPHSCPHCC-RTFIRAHHLTEHISKHH 641          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000039310.1 (zinc finger protein 2-like [Source:NCBI gene;Acc:103032995])

HSP 1 Score: 109.768 bits (273), Expect = 6.554e-24
Identity = 88/296 (29.73%), Postives = 124/296 (41.89%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRT-----------------REHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMH 1202
            Y C  C ++++  ++  +HM     +K Y C +C + +  ++ L  H R TH          G   F C +C    ++ GT+  H+R H+  KPFSC  C K FA  +NMKTH+  H ++DRI +CE CGK F   D+   HLR                  R   L  H Q   + +    C  C  +F    +L KH R        E  + C  CD  F++   L  H +SH G +   C  C +     F    H  T        R H C +C  TF     L  HIS  H
Sbjct:  366 YTCKDCGRAFRELSSLRRHMVIHTGIKPYECPECGKHFARMNHLTTHLR-THT---------GERPFPCSECGMKFSHKGTLLIHQRVHSREKPFSCPDCSKVFATLSNMKTHQLMH-NQDRIHKCEQCGKMFARPDVLKKHLRIHSGERPYLCTVCGKGFKRVQHLTNH-QRTHTGERPYACEECGTSFSQSGDLTKHMRG----HTGEKPYACADCDRRFNNSGDLSKHRRSHTGYRPYRCQECSK----AFLMPQHLKTHMLTHTGERPHSCPHCCRTFIRAHHLTEHISKHH 641          

HSP 2 Score: 97.8265 bits (242), Expect = 3.888e-20
Identity = 75/292 (25.68%), Postives = 114/292 (39.04%), Query Frame = 3
Query:  450 YTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHT 1325
            Y C+ C +   TL  L +H R           + G   + C DC        ++  H   HTG+KP+ C  CGKHFA+  ++ TH   H   +R F C  CG  F+     L H            Q + S +    C  C+  F ++ N+  H     ++   +    C+ C   F+    LK H++ H G +   C VCG+    GF ++ H           R + C  C ++F    DL  H+             RG  G       +CD   N+   + +H R HT
Sbjct:  338 YLCQHCGKNCLTLQSLTIHMR----------SHTGEKPYTCKDCGRAFRELSSLRRHMVIHTGIKPYECPECGKHFARMNHLTTHLRTHT-GERPFPCSECGMKFSHKGTLLIH------------QRVHSREKPFSCPDCSKVFATLSNMKTHQ----LMHNQDRIHKCEQCGKMFARPDVLKKHLRIHSGERPYLCTVCGK----GFKRVQHLTNHQRTHTGERPYACEECGTSFSQSGDLTKHM-------------RGHTGEKPYACADCDRRFNNSGDLSKHRRSHT 585          

HSP 3 Score: 67.781 bits (164), Expect = 7.621e-11
Identity = 59/263 (22.43%), Postives = 104/263 (39.54%), Query Frame = 3
Query:  321 GNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAH 1109
            G + + Q + +    + CP C + +   +    H    +  +++ C QC + +         AR                    PD          ++ H R H+G +P+ C +CGK F +  ++  H+  H   +R + CE CG +F+       H+R              + +    C  C+  F++  +L+KH RS    +       C+ C   F     LK+H+ +H G +  SCP C  R F   + L  HI++ H
Sbjct:  435 GTLLIHQRVHSREKPFSCPDCSKVFATLSNMKTHQLMHNQDRIHKCEQCGKMF---------AR--------------------PD---------VLKKHLRIHSGERPYLCTVCGKGFKRVQHLTNHQRTHT-GERPYACEECGTSFSQSGDLTKHMRGH------------TGEKPYACADCDRRFNNSGDLSKHRRSHTGYRPYR----CQECSKAFLMPQHLKTHMLTHTGERPHSCPHCC-RTFIRAHHLTEHISKHH 641          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000026869.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000073.1:377521:378681:1 gene:ENSAMXG00000026143.2 transcript:ENSAMXT00000026869.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.605 bits (257), Expect = 9.180e-23
Identity = 74/244 (30.33%), Postives = 102/244 (41.80%), Query Frame = 3
Query:  372 CPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITR 1103
            CP C +S+    A  +H R     K Y C +C + +  LS    H R           + G+    C +C    N    ++ H+R HTG KP+SC  CG  FAQ+ N++ H+  H   ++ F C  CGK+FNS    + H RT              +     C  C  TF    NL KH R    L   +  FCC  C   F     L+ H + H G +   CP CG + F     +N H  R
Sbjct:  168 CPDCGRSFTWKYALERHQRIHTGEKPYECSECGKSFTDLSNFQAHQR----------LHTGDKPHSCLECGKRFNTQNHLQTHQRVHTGEKPYSCSECGISFAQRINLRNHQRIHT-GEKPFSCSDCGKSFNSQSSLIQHRRTH-------------TDGTYICSECGKTFTVHRNLRKHQR----LHTGDKPFCCSECGKSFRQRCQLQKHQQIHTGEKPYLCPECG-KSFTQLKSINQHKCR 382          

HSP 2 Score: 88.9669 bits (219), Expect = 6.093e-18
Identity = 77/310 (24.84%), Postives = 126/310 (40.65%), Query Frame = 3
Query:  339 QTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRH--------------------------IHK-DRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGH 1187
            Q +      +RC  C +S+ + N+F KH R     + Y C +C + +  LS L  H +R H+         G   + C +C    +  G ++ H R HTG KP+ C +CGK F+   ++K H+  H                          IH  ++ + C  CGK+F     + AH            Q + +      C+ C   F++  +L  H R    +   E  + C  C   F+  + L++H + H G +  SC  CG + F   + L  H  R H    +  ++C  C  TF   ++L  H
Sbjct:   45 QILHTGEKPHRCSECGKSFAHRNSFVKHQRIHTGERPYDCSECGKTFRYLSNLQAH-QRLHL---------GEKPYSCLECGKTFSTDGNLQTHLRVHTGEKPYYCTVCGKSFSHHISLKAHQLLHTGEKPHCCPDCGRSFTWKYALERHQRIHTGEKPYECSECGKSFTDLSNFQAH------------QRLHTGDKPHSCLECGKRFNTQNHLQTHQR----VHTGEKPYSCSECGISFAQRINLRNHQRIHTGEKPFSCSDCG-KSFNSQSSLIQH-RRTH---TDGTYICSECGKTFTVHRNLRKH 323          

HSP 3 Score: 75.8702 bits (185), Expect = 1.044e-13
Identity = 68/268 (25.37%), Postives = 110/268 (41.04%), Query Frame = 3
Query:  570 CPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHE-----------LREHFQMIASSKLILG-----CMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHT 1325
            C +C     +  +   H+R HTG +P+ C  CGK F   +N++ H+  H+  ++ + C  CGK F++      HLR    E              H  + A   L  G     C  C  +F   + L +H R    +   E  + C  C   F+D+   ++H + H G++  SC  CG+R    FN  NH  T        + + C  C  +F  + +L  H   +H+ E+    S            +C  + NS   + +H R HT
Sbjct:   56 CSECGKSFAHRNSFVKHQRIHTGERPYDCSECGKTFRYLSNLQAHQRLHL-GEKPYSCLECGKTFSTDGNLQTHLRVHTGEKPYYCTVCGKSFSHHISLKAHQLLHTGEKPHCCPDCGRSFTWKYALERHQR----IHTGEKPYECSECGKSFTDLSNFQAHQRLHTGDKPHSCLECGKR----FNTQNHLQTHQRVHTGEKPYSCSECGISFAQRINLRNH-QRIHTGEKPFSCS------------DCGKSFNSQSSLIQHRRTHT 301          

HSP 4 Score: 65.855 bits (159), Expect = 1.486e-10
Identity = 49/164 (29.88%), Postives = 72/164 (43.90%), Query Frame = 3
Query:  564 FHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCG 1055
            F+C +C     +    + H+  HTG KP  C  CGK FA + +   H+  H   +R + C  CGK F     YL++L+          Q +   +    C+ C  TF +  NL  H R    +   E  + C  C   FS  ++LK+H   H G +   CP CG
Sbjct:   26 FNCLECGRGFKSRVGFKSHQILHTGEKPHRCSECGKSFAHRNSFVKHQRIHT-GERPYDCSECGKTFR----YLSNLQAH--------QRLHLGEKPYSCLECGKTFSTDGNLQTHLR----VHTGEKPYYCTVCGKSFSHHISLKAHQLLHTGEKPHCCPDCG 172          

HSP 5 Score: 65.855 bits (159), Expect = 1.903e-10
Identity = 54/188 (28.72%), Postives = 81/188 (43.09%), Query Frame = 3
Query:  633 TGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHIT-RAHAL--KVNRRHVCRYCESTFESKKDLDGH 1187
            T  K F+C  CG+ F  +   K+H+  H   ++  RC  CGK+F   + ++ H            Q I + +    C  C  TF  + NL  H R    L   E  + C  C   FS    L++H++ H G +   C VCG+         +HHI+ +AH L     + H C  C  +F  K  L+ H
Sbjct:   21 TEKKLFNCLECGRGFKSRVGFKSHQILHT-GEKPHRCSECGKSFAHRNSFVKH------------QRIHTGERPYDCSECGKTFRYLSNLQAHQR----LHLGEKPYSCLECGKTFSTDGNLQTHLRVHTGEKPYYCTVCGK-------SFSHHISLKAHQLLHTGEKPHCCPDCGRSFTWKYALERH 184          

HSP 6 Score: 61.6178 bits (148), Expect = 4.019e-9
Identity = 43/147 (29.25%), Postives = 63/147 (42.86%), Query Frame = 3
Query:  324 NIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAF 764
            ++   Q +      Y C  C  S+        H R     K ++C  C + + + S L  H RRTH D        G Y   C +C         +  H+R HTG KPF C  CGK F Q+  ++ H+  H   ++ + C  CGK+F
Sbjct:  236 HLQTHQRVHTGEKPYSCSECGISFAQRINLRNHQRIHTGEKPFSCSDCGKSFNSQSSLIQH-RRTHTD--------GTYI--CSECGKTFTVHRNLRKHQRLHTGDKPFCCSECGKSFRQRCQLQKHQQIHT-GEKPYLCPECGKSF 370          

HSP 7 Score: 56.6102 bits (135), Expect = 1.412e-7
Identity = 50/196 (25.51%), Postives = 77/196 (39.29%), Query Frame = 3
Query:  324 NIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKH 911
            N    Q +      + C  C + +   N    H R     K Y+C +C   +     L  H R           + G   F C DC    N+  ++  HRR HT    + C  CGK F    N++ H+  H   D+ F C  CGK+F            +  +L++H Q+    K  L C  C  +F  + ++N+H
Sbjct:  208 NFQAHQRLHTGDKPHSCLECGKRFNTQNHLQTHQRVHTGEKPYSCSECGISFAQRINLRNHQR----------IHTGEKPFSCSDCGKSFNSQSSLIQHRRTHTD-GTYICSECGKTFTVHRNLRKHQRLHT-GDKPFCCSECGKSFR-----------QRCQLQKHQQIHTGEKPYL-CPECGKSFTQLKSINQH 379          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Sea Lamprey
Match: ZNF436 (zinc finger protein 436 [Source:HGNC Symbol;Acc:HGNC:20814])

HSP 1 Score: 97.8265 bits (242), Expect = 4.363e-22
Identity = 79/259 (30.50%), Postives = 119/259 (45.95%), Query Frame = 3
Query:  444 KVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIAS--SKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEER 1214
            K + C QC + +   S L  HAR TH          G   + C  C    +   ++  HRR HTG +P++C  CG+ F+Q  +++ H+ RH   ++   C TCGKAF S+  +L     R+HE + H + +A    +    C  C  TF    +  +H          E  F C+ C   FS   TL+ H  +H G++   C +CG + FP    L  H+ R H    N+ H C  C   F S ++L  H +  H+ ER
Sbjct:    2 KRHACPQCGRCFALRSSLTKHAR-THT---------GERPYACAACGRSFSVASSLVKHRRVHTGERPYACAACGRAFSQLTSLQKHQGRHS-AEKPHACATCGKAF-SHRAFL-----RKHE-KTHAERVAGLVKERRFACERCCATFFDNQSRQRHQ----TTHTGERPFVCELCGKAFSHHSTLRKHQSTHSGDRPHVCELCG-KAFPHATNLKQHLKR-HTEDKNKPHACSECGRRFLSVRELAQH-ARTHTGER 235          

HSP 2 Score: 93.5893 bits (231), Expect = 1.408e-20
Identity = 81/303 (26.73%), Postives = 119/303 (39.27%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNY-------------------------KFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHL-RTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISD 1196
            Y C +C +S+  A++  KH R     + Y C  C + +  L+ L  H  R   +        G                           +F C  C     +  + + H+  HTG +PF C++CGK F+  + ++ H++ H   DR   CE CGKAF        HL R  E + + H            C  C   F S+  L +H R+       E    C  C   F+ + TL+ H ++H G +   CP CG R F   + L  H  RAHA +   +H C  C   F     L  H S 
Sbjct:   32 YACAACGRSFSVASSLVKHRRVHTGERPYACAACGRAFSQLTSLQKHQGRHSAEKPHACATCGKAFSHRAFLRKHEKTHAERVAGLVKERRFACERCCATFFDNQSRQRHQTTHTGERPFVCELCGKAFSHHSTLRKHQSTHS-GDRPHVCELCGKAFPHATNLKQHLKRHTEDKNKPH-----------ACSECGRRFLSVRELAQHART----HTGERPHVCAECGRAFAAVSTLRKHARTHTGERPHVCPQCG-RAFTSSSNLRAHA-RAHAGQRRPQHACTQCGCRFARAGALRKHQSS 316          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000467.1 (pep scaffold:Pmarinus_7.0:GL480927:176958:178556:1 gene:ENSPMAG00000000421.1 transcript:ENSPMAT00000000467.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.2117 bits (243), Expect = 9.513e-22
Identity = 76/285 (26.67%), Postives = 126/285 (44.21%), Query Frame = 3
Query:  339 QTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTR-SCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHI 1190
            +T D+   +  C +C + + + +   +H R   F     C +C + + ++S+L +H +RTH D            F  P  + + +N   +  H+R H+G KP++C+ CGK F+  + +K H+  H   +R + C  CG+ F        H   R   L+ H Q   + +    C  C   F  + NL  H R       +M   F CK C   F+ + TLK+H + H G +   C  CG R F   + L +H  + H  K    +VC  C   F     ++ H+
Sbjct:  103 ETADDVAKSRPCKACGKKFASKSLLKRHRRRHAFEMPRVCTECGRGFASISRLLVH-QRTHSDEMPYACGECEAAF--PLKSMLMSN---LRRHQRTHSGEKPYACEDCGKTFSLTSTLKNHQRIHT-GERPYICSHCGRGFAQISSLTVH---RISNLKNH-QRTHTGEKPYSCEKCGKRFSDVSNLKAHQRIHADPFSKMAYMFVCKDCGKRFAKVTTLKNHRRIHTGERPYVCLECG-RAFAQNSTLKNH-QKTHGEKS---YVCSECGERFTKISVMNKHM 371          

HSP 2 Score: 69.707 bits (169), Expect = 1.843e-12
Identity = 46/162 (28.40%), Postives = 72/162 (44.44%), Query Frame = 3
Query:  339 QTIDNNGITYRCPSCPQSYQNANAFT--------KHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRT 800
            Q I      Y C  C + +   ++ T         H R     K Y+C +C + +  +S L  H +R H DP         Y F C DC        T+++HRR HTG +P+ C  CG+ FAQ + +K H+    H ++ + C  CG+ F    +   H++ 
Sbjct:  219 QRIHTGERPYICSHCGRGFAQISSLTVHRISNLKNHQRTHTGEKPYSCEKCGKRFSDVSNLKAH-QRIHADPFSKMA----YMFVCKDCGKRFAKVTTLKNHRRIHTGERPYVCLECGRAFAQNSTLKNHQK--THGEKSYVCSECGERFTKISVMNKHMKA 373          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002487.1 (pep scaffold:Pmarinus_7.0:GL476414:876407:883640:1 gene:ENSPMAG00000002270.1 transcript:ENSPMAT00000002487.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.5893 bits (231), Expect = 1.045e-19
Identity = 84/324 (25.93%), Postives = 130/324 (40.12%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRT-----------------REHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKH-----------TRSCG-------------ILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEER 1214
            + C  C + +  A+   +H +     + Y C++C + +   S + +H ++TH          G   F C DC         ++ H+R HTG KP++C+ICGK F+   N+K H+  H+ K+R + CE CGK F+     + H+RT                 +   L+ H ++    +  + C  C   F     L  H            + CG             I+   E  F CK C   FS   +LK+H  +H+G Q   C  CG R    F+Q +   T        +  +C  C   F     L  H   MHS ER
Sbjct:  130 FICTDCGKRFLQASTLKEHHKIHTGERPYVCKECGKSFSYSSAMTVH-QKTHT---------GEKPFICKDCGRGFAQKPHLKTHQRIHTGEKPYACNICGKSFSLNYNLKAHQKTHL-KERPYMCELCGKRFSDKRTLVVHMRTHTGVKPYICTHCGNKFSQGQHLKAHKRIHTGERPFI-CKICGKGFALKSTLKTHEFTHSVEKPFICKHCGKGYSLKSTLKNHEIVHSGEKPFLCKECGKGFSQGSSLKNHKLTHDGEQPFICQECGRR----FSQTSSLKTHQLLHTGEKTFLCPDCGKRFSFPSSLKQH-QQMHSSER 436          

HSP 2 Score: 86.2705 bits (212), Expect = 1.961e-17
Identity = 83/293 (28.33%), Postives = 128/293 (43.69%), Query Frame = 3
Query:  324 NIAVAQTIDNNGITYRCPSCPQSYQ---NANAFTK-HMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGER-GFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGH 1187
            ++   Q I      Y C  C +S+    N  A  K H++E+     Y C  C + +     L +H R TH          G   + C  C    + G  ++ H+R HTG +PF C ICGK FA K+ +KTH+  H   ++ F C+ CGK ++        L++    L+ H +++ S +    C  C   F    +L  H     +    E  F C+ C   FS   +LK+H   H G +   CP CG+R  FP  + L  H  + H+    R  +C+ C  +F    +L  H
Sbjct:  200 HLKTHQRIHTGEKPYACNICGKSFSLNYNLKAHQKTHLKER----PYMCELCGKRFSDKRTLVVHMR-THT---------GVKPYICTHCGNKFSQGQHLKAHKRIHTGERPFICKICGKGFALKSTLKTHEFTHS-VEKPFICKHCGKGYS--------LKS---TLKNH-EIVHSGEKPFLCKECGKGFSQGSSLKNHK----LTHDGEQPFICQECGRRFSQTSSLKTHQLLHTGEKTFLCPDCGKRFSFP--SSLKQH-QQMHS--SERPFICKECGKSFSYYSNLKVH 456          

HSP 3 Score: 82.0333 bits (201), Expect = 4.634e-16
Identity = 74/292 (25.34%), Postives = 122/292 (41.78%), Query Frame = 3
Query:  327 IAVAQTIDNNGITYRCPSCPQSYQNANAFTKHM----REKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHI 1190
            I   Q+  N    Y C  C +++ +     +H+    R     K + C+ C + +   S L  H+    ++            F C DC    +    M+ HR  HTG +P++C  CG+ F+Q +++KTH+  H   +R F C  CGK F            +   L+EH ++    +  + C  C  +F     +  H ++       E  F CK C   F+    LK+H + H G +  +C +CG+     +N   H  T    LK  R ++C  C   F  K+ L  H+
Sbjct:    1 ILKNQSATNAEKMYMCEQCGKTFSSRRTLGQHLKAHLRTHTGEKPFICQDCGKRFSLKSTLKTHSLTHSLEK----------PFVCNDCGKGFSKASYMKVHRLTHTGERPYACQDCGQRFSQPSSLKTHQFTHT-GERPFICTDCGKRF-----------LQASTLKEHHKIHTGERPYV-CKECGKSFSYSSAMTVHQKT----HTGEKPFICKDCGRGFAQKPHLKTHQRIHTGEKPYACNICGKSFSLNYNLKAHQKTH---LK-ERPYMCELCGKRFSDKRTLVVHM 261          

HSP 4 Score: 77.0258 bits (188), Expect = 1.614e-14
Identity = 62/252 (24.60%), Postives = 104/252 (41.27%), Query Frame = 3
Query:  303 NQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGE 1058
            N+     ++   + I      + C  C + +   +    H       K + C+ C + Y   S L  H             + G   F C +C    + G ++++H+  H G +PF C  CG+ F+Q +++KTH+  H   ++ F C  CGK F+               L++H QM +S +  + C  C  +F    NL  H ++       +  F C  C   FS    LKSH ++H G +   C  CG+
Sbjct:  277 NKFSQGQHLKAHKRIHTGERPFICKICGKGFALKSTLKTHEFTHSVEKPFICKHCGKGYSLKSTLKNHE----------IVHSGEKPFLCKECGKGFSQGSSLKNHKLTHDGEQPFICQECGRRFSQTSSLKTHQLLHT-GEKTFLCPDCGKRFSFPS-----------SLKQHQQMHSSERPFI-CKECGKSFSYYSNLKVHQKT----HTGDKPFTCTLCGRGFSQKPHLKSHQRTHTGEKPYECQDCGK 501          

HSP 5 Score: 59.6918 bits (143), Expect = 3.995e-9
Identity = 34/133 (25.56%), Postives = 63/133 (47.37%), Query Frame = 3
Query:  318 SGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRH 716
            + ++   Q +     T+ CP C + +   ++  +H +     + + C++C + +   S L +H ++TH          G+  F C  C    +    ++ H+R HTG KP+ C  CGK+F+   N+K HK  H
Sbjct:  394 TSSLKTHQLLHTGEKTFLCPDCGKRFSFPSSLKQHQQMHSSERPFICKECGKSFSYYSNLKVH-QKTHT---------GDKPFTCTLCGRGFSQKPHLKSHQRTHTGEKPYECQDCGKYFSLNCNLKVHKKTH 516          

HSP 6 Score: 54.6842 bits (130), Expect = 1.717e-7
Identity = 24/68 (35.29%), Postives = 43/68 (63.24%), Query Frame = 3
Query:  564 FHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFN 767
            F C +C    +    ++ H++ HTG KPF+C +CG+ F+QK ++K+H+  H   ++ + C+ CGK F+
Sbjct:  438 FICKECGKSFSYYSNLKVHQKTHTGDKPFTCTLCGRGFSQKPHLKSHQRTHT-GEKPYECQDCGKYFS 504          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007433.1 (pep scaffold:Pmarinus_7.0:GL498585:318:1981:-1 gene:ENSPMAG00000006708.1 transcript:ENSPMAT00000007433.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 1.642e-19
Identity = 45/177 (25.42%), Postives = 86/177 (48.59%), Query Frame = 3
Query:  564 FHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHH 1094
            + CP C  +  +  +++ HR  H G KPF CD CGK F    ++++H+  H+ K + ++C+ C +++           TR   LR H +     +  L C+ C + F  + +L +H R+     + +    C  C   F+++ +L+ H ++H+  + + C  CG + F   + L  H
Sbjct:   17 YKCPVCTKVFASPESVQSHRAVHNGKKPFECDACGKAFTHAKDLRSHQRVHLRKKKGYKCKRCERSY-----------TRLGALRTHHERSHEEQKPLLCLECGDAFTELDSLRRHERT----HKEQKPLLCSECGEAFTELDSLRRHERTHKEQKPLLCSECG-KAFTELDSLRQH 177          

HSP 2 Score: 65.0846 bits (157), Expect = 6.643e-12
Identity = 47/185 (25.41%), Postives = 76/185 (41.08%), Query Frame = 3
Query:  258 HVISDENGQTYLAP--TNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKV--YTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRT 800
            H  S  + +TY  P  T    S  ++   + + N    + C +C +++ +A     H R  H  K   Y C++CE+ Y  L  L  H  R+H +              C +C        ++  H R H   KP  C  CG+ F +  +++ H+  H  +  +  C  CGKAF   D    H R+
Sbjct:    7 HEKSHTSEKTYKCPVCTKVFASPESVQSHRAVHNGKKPFECDACGKAFTHAKDLRSHQR-VHLRKKKGYKCKRCERSYTRLGALRTHHERSHEE---------QKPLLCLECGDAFTELDSLRRHERTHKEQKPLLCSECGEAFTELDSLRRHERTHKEQKPLL-CSECGKAFTELDSLRQHERS 180          

HSP 3 Score: 60.8474 bits (146), Expect = 1.501e-10
Identity = 50/202 (24.75%), Postives = 78/202 (38.61%), Query Frame = 3
Query:  318 SGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNY-MTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRS 920
            SG +   +    +  TY+CP C + + +  +   H    +  K + C  C        + F HA+      +   +    YK  C  C    T  G    HH R+H   KP  C  CG  F +  +++ H+  H  +  +  C  CG+AF   D            LR H +     K +L C  C   F  + +L +H RS
Sbjct:    1 SGTLKTHEKSHTSEKTYKCPVCTKVFASPESVQSHRAVHNGKKPFECDAC-------GKAFTHAKDLRSHQRVHLRKKKGYK--CKRCERSYTRLGALRTHHERSHEEQKPLLCLECGDAFTELDSLRRHERTHKEQKPLL-CSECGEAFTELD-----------SLRRHERTHKEQKPLL-CSECGKAFTELDSLRQHERS 180          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Sea Lamprey
Match: ZNF436 (zinc finger protein 436 [Source:HGNC Symbol;Acc:HGNC:20814])

HSP 1 Score: 89.3521 bits (220), Expect = 4.959e-19
Identity = 80/319 (25.08%), Postives = 122/319 (38.24%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNY-------------------------KFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLR--TREHELREHFQMIASSKLIL---------------GCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISD 1196
            Y C +C +S+  A++  KH R     + Y C  C + +  L+ L  H  R   +        G                           +F C  C     +  + + H+  HTG +PF C++CGK F+  + ++ H++ H   DR   CE CGKAF        HL+  T E        + ++   ++                C  C   F S+  L +H R+       E    C  C   F+ + TL+ H ++H G +   CP CG R F   + L  H  RAHA +   +H C  C   F     L  H S 
Sbjct:   31 YACAACGRSFSVASSLVKHRRVHTGERPYACAACGRAFSQLTSLQKHQGRHSAEKPHACATCGKAFSHRAFLRKHEKTHAERVAGLVKERRFACERCCATFFDNQSRQRHQTTHTGERPFVCELCGKAFSHHSTLRKHQSTHS-GDRPHVCELCGKAFPHATNLKQHLKRHTGERSAAAACCLFSACCNVIKHLRADTAKDKNKPHACSECGRRFLSVRELAQHART----HTGERPHVCAECGRAFAAVSTLRKHARTHTGERPHVCPQCG-RAFTSSSNLRAHA-RAHAGQRRPQHACTQCGCRFARAGALRKHQSS 342          

HSP 2 Score: 82.0333 bits (201), Expect = 1.238e-16
Identity = 66/222 (29.73%), Postives = 101/222 (45.50%), Query Frame = 3
Query:  450 YTCRQCEQFYETLSQLFL--HARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIAS--SKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITR 1103
            + C QC + +     L L  HAR TH          G   + C  C    +   ++  HRR HTG +P++C  CG+ F+Q  +++ H+ RH   ++   C TCGKAF S+  +L     R+HE + H + +A    +    C  C  TF    +  +H          E  F C+ C   FS   TL+ H  +H G++   C +CG + FP    L  H+ R
Sbjct:    1 HACPQCGRCFAESRDLRLTKHAR-THT---------GERPYACAACGRSFSVASSLVKHRRVHTGERPYACAACGRAFSQLTSLQKHQGRHS-AEKPHACATCGKAF-SHRAFL-----RKHE-KTHAERVAGLVKERRFACERCCATFFDNQSRQRHQ----TTHTGERPFVCELCGKAFSHHSTLRKHQSTHSGDRPHVCELCG-KAFPHATNLKQHLKR 199          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 66.6254 bits (161), Expect = 2.564e-11
Identity = 39/117 (33.33%), Postives = 57/117 (48.72%), Query Frame = 3
Query:  561 KFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKH 911
            K  CP C+ + +    +E H R+H G KPF CD CGK F Q  N++TH+  H   ++ + C+ C K F+      AHL T  H+  + F        +     CN TF  + N+  H
Sbjct:  592 KHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHT-GEKPYSCDICDKKFSRKGNLAAHLVT--HQKLKPF--------VCKLENCNKTFTQLGNMKAH 697          

HSP 2 Score: 63.929 bits (154), Expect = 1.863e-10
Identity = 41/119 (34.45%), Postives = 54/119 (45.38%), Query Frame = 3
Query:  441 VKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRC--ETCGKAFNSYDIYLAH 791
            VK + C  C + +   + L +H R +H+         G   F C  C      GG +  H R HTG KP+SCDIC K F++K N+  H   H  K + F C  E C K F       AH
Sbjct:  590 VKKHECPYCHRLFSQATHLEVHVR-SHI---------GYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTH-QKLKPFVCKLENCNKTFTQLGNMKAH 697          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 59.3066 bits (142), Expect = 5.086e-9
Identity = 36/129 (27.91%), Postives = 58/129 (44.96%), Query Frame = 3
Query:  381 CPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFN 767
            C +++       +H++     K Y C+ C++ + +   L  H R TH          G   + C  CN       +++ H R HTG KP  C ICGK F + +N+  H   H  K   ++C  C K+F+
Sbjct:  745 CHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTR-TH---------SGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQKK---YKCSDCSKSFD 860          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Yeast
Match: PZF1 (Transcription factor IIIA (TFIIIA); essential DNA binding protein required for transcription of 5S rRNA by RNA polymerase III; not involved in transcription of other RNAP III genes; nine conserved zinc fingers; may also bind 5S rRNA [Source:SGD;Acc:S000006390])

HSP 1 Score: 58.5362 bits (140), Expect = 5.926e-9
Identity = 60/223 (26.91%), Postives = 85/223 (38.12%), Query Frame = 3
Query:  552 GNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCC--KSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYC-ESTFESKKDLDGHISDMHSEE 1211
            G   F C  C         +E H   H+  KPF C  CGK    +  +K H+  H    + F C   G     Y     H + R H L  H          L C  CN +F   + L  H  S     ++E  + C    C   F     L+SH+K+   +  + CP+C  +   G N L  H+       V +   C  C + +F  K DL  H   +H+EE
Sbjct:   76 GLRAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSYCGKGVTTRQQLKRHEVTHT---KSFICPEEGCNLRFY----KHPQLRAHILSVHLHK-------LTCPHCNKSFQRPYRLRNHI-SKHHDPEVENPYQCTFAGCCKEFRIWSQLQSHIKN--DHPKLKCPICS-KPCVGENGLQMHMIIHDDSLVTKNWKCHICPDMSFSRKHDLLTHYGSIHTEE 280          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO48956 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI19])

HSP 1 Score: 89.3521 bits (220), Expect = 7.415e-20
Identity = 66/235 (28.09%), Postives = 106/235 (45.11%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQK----ANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGE 1058
            ++CP+C +++        HM     VK + C  C + +  L     H +R H+       + G   + C  C    +  G+++ H R HTG+KP+ C ICG+ FA +    ++MKTH N     ++ F+CETCGKAF   +    H            Q+I S      C  C  TF    +L +H+R    ++  +    C  C   F+   TL  H+++H G +   C  CG+
Sbjct:    3 FKCPTCDKAFIRNYTLQCHMLIHKNVKEHKCETCGKEFTLLK----HLQRHHL------VHTGEKPYKCHLCGRAFSQQGSLQAHSRTHTGIKPYKCQICGRAFALQSPLMSHMKTHSN-----EKNFKCETCGKAFTHRNTLARH------------QLIHSGTRPYKCEECGKTFTQTNDLKRHSRIHTGIRPYK----CHVCSKSFTVEFTLVCHLRTHTGERPYVCDHCGK 206          

HSP 2 Score: 56.9954 bits (136), Expect = 7.997e-9
Identity = 61/218 (27.98%), Postives = 87/218 (39.91%), Query Frame = 3
Query:  561 KFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEER 1214
            KF CP C+       T++ H   H  VK   C+ CGK F    +++ H   H   ++ ++C  CG+AF+      AH RT           I   K    C  C   F     L  H ++       E  F C++C   F+   TL  H   H G +   C  CG + F   N L  H +R H     R + C  C  +F  +  L  H+   H+ ER
Sbjct:    2 KFKCPTCDKAFIRNYTLQCHMLIHKNVKEHKCETCGKEFTLLKHLQRHHLVHT-GEKPYKCHLCGRAFSQQGSLQAHSRTHT--------GIKPYK----CQICGRAFALQSPLMSHMKT----HSNEKNFKCETCGKAFTHRNTLARHQLIHSGTRPYKCEECG-KTFTQTNDLKRH-SRIHT--GIRPYKCHVCSKSFTVEFTLVCHLRT-HTGER 197          

HSP 3 Score: 49.6766 bits (117), Expect = 2.901e-6
Identity = 56/196 (28.57%), Postives = 82/196 (41.84%), Query Frame = 3
Query:  642 KPFSCDICGKHFAQKANMKTHKNRHIHKD-RIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGE----RGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEER 1214
            K F C  C K F +   ++ H    IHK+ +  +CETCGK F      L HL+ R H       ++ + +    C  C   F    +L  H+R+   +K  +    C+ C   F+    L SH+K+H   +   C  CG+    R     +QL H  TR +         C  C  TF    DL  H S +H+  R
Sbjct:    1 KKFKCPTCDKAFIRNYTLQCHML--IHKNVKEHKCETCGKEFT----LLKHLQ-RHH-------LVHTGEKPYKCHLCGRAFSQQGSLQAHSRTHTGIKPYK----CQICGRAFALQSPLMSHMKTHSNEKNFKCETCGKAFTHRNTLARHQLIHSGTRPYK--------CEECGKTFTQTNDLKRH-SRIHTGIR 169          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO31838 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWT3])

HSP 1 Score: 94.3597 bits (233), Expect = 7.964e-20
Identity = 84/330 (25.45%), Postives = 126/330 (38.18%), Query Frame = 3
Query:  201 VSDSGIISDTIVQLEGESYHVISDENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHI 1190
             S+SG +   ++   GE  H   D+ G+ +         SG++     I      Y C  C + +  +     H+R     K Y C +C + +     L     +TH+       + G   + C +C       G ++ H R HTG KP+ CD CGK F    NMK H   H  K + ++C+ CGK+F  +     HL            +I S K    C  C   F  +  L  H     ++   E  + C  C   F+    LK H+  H G +   C VCG + F     L  H+      K  + H C  C   F     L  H+
Sbjct:   72 FSESGKLKRHLMIHTGEKPHKC-DDCGKRFT-------RSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKTHLRIHSGKKPYKCDECGKCFTESGNL-----KTHL-----MIHSGEKPYKCDECGKCFTQSGDLKRHLRIHTGEKPYECDDCGKRFTLSGNMKKHLKIHSGK-KPYKCDECGKSFTEHAYLKTHL------------IIHSGKKPYKCDECGKCFTELETLKTHL----MIHSGEKPYKCDECGKCFTQSGNLKRHLMIHSGQKPYKCDVCG-KCFTRSGALTTHLMIHSGQKPYKPHKCDECGKCFNQSGHLKRHL 365          

HSP 2 Score: 83.1889 bits (204), Expect = 3.056e-16
Identity = 75/299 (25.08%), Postives = 115/299 (38.46%), Query Frame = 3
Query:  318 SGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEER 1214
            SGN+     I +    Y+C  C + +  +     H+      K Y C +C + +     L  H R           + G   + C DC       G M+ H + H+G KP+ CD CGK F + A +KTH   H  K + ++C+ CGK F   +    HL            MI S +    C  C   F    NL +H     ++   +  + C  C   F+    L +H+  H G +      C E G   FNQ  H           + + C  C   F   + L  H+  +HS ++
Sbjct:  131 SGNMKTHLRIHSGKKPYKCDECGKCFTESGNLKTHLMIHSGEKPYKCDECGKCFTQSGDLKRHLR----------IHTGEKPYECDDCGKRFTLSGNMKKHLKIHSGKKPYKCDECGKSFTEHAYLKTHLIIHSGK-KPYKCDECGKCFTELETLKTHL------------MIHSGEKPYKCDECGKCFTQSGNLKRHL----MIHSGQKPYKCDVCGKCFTRSGALTTHLMIHSGQKPYKPHKCDECG-KCFNQSGHLKRHLKIHTGQKPYECGECSKCFTRSERLKTHLR-IHSGQK 400          

HSP 3 Score: 82.8037 bits (203), Expect = 4.231e-16
Identity = 81/292 (27.74%), Postives = 117/292 (40.07%), Query Frame = 3
Query:  342 TIDNNGITYRCPSCPQSY-QNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEER 1214
             I +    Y+C  C + + Q+AN    H+R     K Y C +C + +    +L  H             + G     C DC       G ++ H R HTG KP+ CD CGK F    NMKTH   H  K + ++C+ CGK F        HL            MI S +    C  C   F    +L +H R    +   E  + C  C   F+    +K H+K H G +   C  CG + F     L  H+   H+ K  + + C  C   F   + L  H+  +HS E+
Sbjct:   29 VIHSGKKPYKCDECGKCFTQHANT---HLRIHSGKKPYKCDECGKCFSESGKLKRHL----------MIHTGEKPHKCDDCGKRFTRSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKTHLRIHSGK-KPYKCDECGKCFTESGNLKTHL------------MIHSGEKPYKCDECGKCFTQSGDLKRHLR----IHTGEKPYECDDCGKRFTLSGNMKKHLKIHSGKKPYKCDECG-KSFTEHAYLKTHLI-IHSGK--KPYKCDECGKCFTELETLKTHLM-IHSGEK 285          

HSP 4 Score: 80.4925 bits (197), Expect = 2.536e-15
Identity = 70/280 (25.00%), Postives = 111/280 (39.64%), Query Frame = 3
Query:  318 SGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKD--RIFRCETCGKAFNSYDIYLAHLR-----------------TREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHIT 1100
            SGN+     I +    Y+C  C +S+        H+      K Y C +C + +  L  L     +TH+       + G   + C +C       G ++ H   H+G KP+ CD+CGK F +   + TH   H  +   +  +C+ CGK FN       HL+                 TR   L+ H + I S +    C  C   F    NL +H     ++   +  + C  C   FS+   LK H+  H G +   C  CG + F  +  L  H++
Sbjct:  215 SGNMKKHLKIHSGKKPYKCDECGKSFTEHAYLKTHLIIHSGKKPYKCDECGKCFTELETL-----KTHL-----MIHSGEKPYKCDECGKCFTQSGNLKRHLMIHSGQKPYKCDVCGKCFTRSGALTTHLMIHSGQKPYKPHKCDECGKCFNQSGHLKRHLKIHTGQKPYECGECSKCFTRSERLKTHLR-IHSGQKPYKCDVCGKCFSESRNLKRHL----MIHSGQKPYKCDVCGKCFSESGNLKKHLMIHSGQKPYKCDECG-KCFILYRNLKTHLS 478          

HSP 5 Score: 72.4034 bits (176), Expect = 7.416e-13
Identity = 79/328 (24.09%), Postives = 126/328 (38.41%), Query Frame = 3
Query:  270 DENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLS-----QLFLHARRTHVDXXXXXXX--------------XGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILG--CMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHI 1190
            DE G+ +         SGN+     I +    Y+C  C + +  +    +H+R     K Y C  C + + TLS      L +H+ +      +  K+               G   + C +C        T++ H   H+G KP+ CD CGK F Q  N+K H   H    + ++C+ CGK F           TR   L  H  + +  K      C  C   F+   +L +H +    +   +  + C  C   F+    LK+H++ H G +   C VCG + F     L  H+      K  +  VC  C   F    +L  H+
Sbjct:  150 DECGKCFT-------ESGNLKTHLMIHSGEKPYKCDECGKCFTQSGDLKRHLRIHTGEKPYECDDCGKRF-TLSGNMKKHLKIHSGKKPYKCDECGKSFTEHAYLKTHLIIHSGKKPYKCDECGKCFTELETLKTHLMIHSGEKPYKCDECGKCFTQSGNLKRHLMIHS-GQKPYKCDVCGKCF-----------TRSGALTTHLMIHSGQKPYKPHKCDECGKCFNQSGHLKRHLK----IHTGQKPYECGECSKCFTRSERLKTHLRIHSGQKPYKCDVCG-KCFSESRNLKRHLMIHSGQKPYKCDVCGKC---FSESGNLKKHL 449          

HSP 6 Score: 62.3882 bits (150), Expect = 1.016e-9
Identity = 59/221 (26.70%), Postives = 90/221 (40.72%), Query Frame = 3
Query:  552 GNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEER 1214
            G  +++C +C         ++ H   H+G KP+ CD CGK F Q AN  TH   H  K + ++C+ CGK F+       HL            MI + +    C  C   F    +L  H R    +   E  + C  C   F+    +K+H++ H G +   C  CG + F     L  H+      K  +   C  C   F    DL  H+  +H+ E+
Sbjct:    5 GQKRYNCDECGKCFTRHAQLKEHLVIHSGKKPYKCDECGKCFTQHAN--THLRIHSGK-KPYKCDECGKCFSESGKLKRHL------------MIHTGEKPHKCDDCGKRFTRSGDLKTHLR----IHTGEKPYECDDCGKRFTLSGNMKTHLRIHSGKKPYKCDECG-KCFTESGNLKTHLMIHSGEKPYK---CDECGKCFTQSGDLKRHLR-IHTGEK 201          

HSP 7 Score: 55.8398 bits (133), Expect = 1.117e-7
Identity = 56/195 (28.72%), Postives = 82/195 (42.05%), Query Frame = 3
Query:  630 HTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEER 1214
            H+G K ++CD CGK F + A +K H   H  K + ++C+ CGK F  +     HLR            I S K    C  C   F     L +H     ++   E    C  C   F+    LK+H++ H G +   C  CG+R     N   H   R H+ K  + + C  C   F    +L  H+  +HS E+
Sbjct:    3 HSGQKRYNCDECGKCFTRHAQLKEHLVIHSGK-KPYKCDECGKCFTQHAN--THLR------------IHSGKKPYKCDECGKCFSESGKLKRHL----MIHTGEKPHKCDDCGKRFTRSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKTH--LRIHSGK--KPYKCDECGKCFTESGNLKTHLM-IHSGEK 173          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO38419 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCX8])

HSP 1 Score: 93.2041 bits (230), Expect = 2.757e-19
Identity = 80/284 (28.17%), Postives = 118/284 (41.55%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERN 1217
            Y+C  C +++ +A++ T+HMR     K + C QC + +   S L  H  RTH          G     C  C  +  + G +  H R H+G KP  C  CGK FAQ   + TH   H   ++  +C  CGKAF        H+RT   E + H            C  C   F    NL  H R+       E    C  C   F+    L +H+++H G +   C  CG + F   + L  H+ R H+ +  + + C  C   F     L  H+   HS E++
Sbjct:  289 YKCTQCGKAFAHASSLTEHMRTHSGEKPHKCTQCGKAFARASVLTRHM-RTH---------SGEKPHKCTQCGKVFAHAGNLTTHMRTHSGEKPHKCTQCGKVFAQAGILTTHMRTHS-GEKPHKCTQCGKAFAQASNLTTHMRTHSGE-KPH-----------KCTQCGKVFAHAGNLTTHMRT----HSGEKPHKCTQCGKVFAQAGNLTTHMRTHSGEKPHKCTQCG-KAFAHASNLTKHM-RIHSGE--KPYKCTQCGKVFAHTSHLTKHMR-THSREKH 540          

HSP 2 Score: 84.7297 bits (208), Expect = 1.280e-16
Identity = 77/281 (27.40%), Postives = 107/281 (38.08%), Query Frame = 3
Query:  372 CPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEER 1214
            CP C + + +      H+      K Y C QC + +   S L  H R TH          G     C  C         +  H R H+G KP  C  CGK FA   N+ TH   H   ++  +C  CGK F    I   H+RT   E + H            C  C   F    NL  H R+       E    C  C   F+    L +H+++H G +   C  CG + F     L  H+ R H+ +  + H C  C   F    +L  H+  +HS E+
Sbjct:  263 CPICEKDFCDYRYMIMHILTHTKYKPYKCTQCGKAFAHASSLTEHMR-TH---------SGEKPHKCTQCGKAFARASVLTRHMRTHSGEKPHKCTQCGKVFAHAGNLTTHMRTHS-GEKPHKCTQCGKVFAQAGILTTHMRTHSGE-KPH-----------KCTQCGKAFAQASNLTTHMRT----HSGEKPHKCTQCGKVFAHAGNLTTHMRTHSGEKPHKCTQCG-KVFAQAGNLTTHM-RTHSGE--KPHKCTQCGKAFAHASNLTKHMR-IHSGEK 511          

HSP 3 Score: 77.7962 bits (190), Expect = 2.164e-14
Identity = 57/201 (28.36%), Postives = 79/201 (39.30%), Query Frame = 3
Query:  318 SGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRS 920
            +GN+       +    ++C  C + +  A   T HMR     K + C QC + +   S L  H  RTH          G     C  C  +  + G +  H R H+G KP  C  CGK FAQ  N+ TH   H   ++  +C  CGKAF        H+R            I S +    C  C   F    +L KH R+
Sbjct:  357 AGNLTTHMRTHSGEKPHKCTQCGKVFAQAGILTTHMRTHSGEKPHKCTQCGKAFAQASNLTTHM-RTH---------SGEKPHKCTQCGKVFAHAGNLTTHMRTHSGEKPHKCTQCGKVFAQAGNLTTHMRTHS-GEKPHKCTQCGKAFAHASNLTKHMR------------IHSGEKPYKCTQCGKVFAHTSHLTKHMRT 534          

HSP 4 Score: 70.8626 bits (172), Expect = 2.507e-12
Identity = 70/281 (24.91%), Postives = 109/281 (38.79%), Query Frame = 3
Query:  438 FVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXG----------------------NYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEER 1214
            + K YTC++C + + + + L  H +R +++P   +                          N    CP C     +   M  H   HT  KP+ C  CGK FA  +++  H   H   ++  +C  CGKAF    +   H+RT   E + H            C  C   F    NL  H R+       E    C  C   F+    L +H+++H G +   C  CG + F   + L  H+ R H+ +  + H C  C   F    +L  H+   HS E+
Sbjct:  197 YTKDYTCKKCSRCFTSSNALLWHRKRCYIEPTGDELKCKLCQQQCATPKTLTGHIVSEHCENSSRVCPICEKDFCDYRYMIMHILTHTKYKPYKCTQCGKAFAHASSLTEHMRTHS-GEKPHKCTQCGKAFARASVLTRHMRTHSGE-KPH-----------KCTQCGKVFAHAGNLTTHMRT----HSGEKPHKCTQCGKVFAQAGILTTHMRTHSGEKPHKCTQCG-KAFAQASNLTTHM-RTHSGE--KPHKCTQCGKVFAHAGNLTTHMR-THSGEK 455          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO48839 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIQ4])

HSP 1 Score: 88.9669 bits (219), Expect = 6.099e-18
Identity = 90/348 (25.86%), Postives = 136/348 (39.08%), Query Frame = 3
Query:  312 GSSGNIAVAQTIDNNGITYRCPSCPQSYQN----------------------ANAFT------KHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKF-------------------HCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEER 1214
            G S ++ + Q I  N   Y+C  CP+++ +                        AF+      +HMR    +K Y+C QCE  + T S L  H  +TH   K  +    +  F                    C  C+      G +  H R HTG +PF C  C K F+ K N+  H  RH + +R + C TCGK+F      + H R+   E                C  C   F     L+ H +    +   E    C  C+  F     L  H ++H G +   C +C E+ F   + LN H+ R H    ++RH C YC   F +K +L  H+  +H+ E+
Sbjct:  143 GESSSLIMHQRIHTNEKPYKCKLCPKAFTSHSSLVMHNRHHSGDKPYKCEICGRAFSVSSNRARHMRSHKNIKPYSCSQCEWSFTTSSDLKRHL-KTHTGEKPYRCEECDKAFSSSCGLSTHKKIHFNIKPHSCTVCHKRFATTGQVTSHMRTHTGEQPFKCTYCDKAFSIKGNLTVHIRRHTN-ERPYVCTTCGKSFTVISQLVMHNRSHTDE------------RPYKCDICGKKFRQQGGLSIHKK----IHTEEKPHECTQCEKAFITKAKLDRHFRTHSGEKPYRCEIC-EKSFRDKDSLNIHM-RIH--NNDKRHSCSYCPKLFYTKTELRQHVR-IHTGEK 467          

HSP 2 Score: 83.5741 bits (205), Expect = 2.933e-16
Identity = 75/278 (26.98%), Postives = 122/278 (43.88%), Query Frame = 3
Query:  444 KVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLR---------------------TREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEER 1214
            + + C  C + ++T +++  H RRTH+  K          F C  CN    +   ++ H R HTG KP+SC  CG+ F + +++  H+  H + ++ ++C+ C KAF S+   + H R                      R   +R H  +   S     C  C  +F +  +L +H ++       E  + C+ CD  FS    L +H K H   +  SC VC +R F    Q+  H+ R H  +   +  C YC+  F  K +L  HI   H+ ER
Sbjct:   74 RPWGCVYCSKKFKTKAKVAEHTRRTHLKVK---------PFSCTYCNKKCASKSDLDKHERTHTGEKPYSCKYCGRMFGESSSLIMHQRIHTN-EKPYKCKLCPKAFTSHSSLVMHNRHHSGDKPYKCEICGRAFSVSSNRARHMRSHKNIKPYS-----CSQCEWSFTTSSDLKRHLKT----HTGEKPYRCEECDKAFSSSCGLSTHKKIHFNIKPHSCTVCHKR-FATTGQVTSHM-RTHTGEQPFK--CTYCDKAFSIKGNLTVHIR-RHTNER 327          

HSP 3 Score: 77.0258 bits (188), Expect = 3.753e-14
Identity = 81/344 (23.55%), Postives = 126/344 (36.63%), Query Frame = 3
Query:  315 SSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHTLQGTNGN 1346
            SS  ++  + I  N   + C  C + +      T HMR     + + C  C++ +     L +H RR          +     + C  C         +  H R+HT  +P+ CDICGK F Q+  +  HK  H  +++   C  C KAF +      H RT             S +    C  C  +F    +LN H R    +   + +  C  C   F     L+ HV+ H G +   CP C ++ F        H  R H  +  R + C  C   F  +  L  H+           ++ G V    C      F       + +H + H  QG +GN
Sbjct:  256 SSCGLSTHKKIHFNIKPHSCTVCHKRFATTGQVTSHMRTHTGEQPFKCTYCDKAFSIKGNLTVHIRR----------HTNERPYVCTTCGKSFTVISQLVMHNRSHTDERPYKCDICGKKFRQQGGLSIHKKIHT-EEKPHECTQCEKAFITKAKLDRHFRTH------------SGEKPYRCEICEKSFRDKDSLNIHMR----IHNNDKRHSCSYCPKLFYTKTELRQHVRIHTGEKPYKCPYC-DKAFAVKGNCTVH-ARTHTKE--RPYKCTNCGRAFSCRSGLREHM-----------RTHGGVKEFICSICEKAFLRRGC--LKKHEKLHVKQGNHGN 555          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO41082 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5G4])

HSP 1 Score: 88.1965 bits (217), Expect = 7.056e-18
Identity = 77/292 (26.37%), Postives = 114/292 (39.04%), Query Frame = 3
Query:  372 CPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXX-------------------XXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHI 1190
            C  C +S+  A+   +HM      K Y C +C + +   + L  H R  H   K                     + + G   F C  C+ M +  G +  H R+HTG +P+ C+ C   F+    +K+H   H   +R ++CE C K F       +HL            +  S K    C+ C  TF S  NL  H R      + E  F C++C   F     L  H+  H G +   C VC ERGF   + L  H  R   +K  +   C  C+  F S  +   H+
Sbjct:   85 CDICSKSFSRASTLVRHMISHTDDKPYVCTKCNKAFAYSASLVKHDRVYHRGVKPYECDICGRAFSDRSGLVKHERTHTGERPFECSFCHMMFSLKGLLTRHMRSHTGQRPYKCEYCSAAFSVSDTLKSHLRLHT-GERPYKCEICNKGFVQSSALSSHL------------LTHSGKRPYECLTCGQTFRSRSNLLYHERR----HRGEAPFECQTCGKVFVRSDNLSKHMLCHTGEKPYKCQVC-ERGFACTSALKSHQRRHDGIKPYK---CERCDKRFTSSNERTRHM 355          

HSP 2 Score: 78.1814 bits (191), Expect = 9.980e-15
Identity = 64/241 (26.56%), Postives = 100/241 (41.49%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRI--FRCETCGKAFNSYDIYLAHLRTREHE-------LREHFQM---IASSKLI------LGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQI 1034
            Y+C  C + +  ++A + H+      + Y C  C Q + + S L  H RR          + G   F C  C  +      +  H   HTG KP+ C +C + FA  + +K+H+ RH   D I  ++CE C K F S +    H+RT   +        +E+F     +A  KLI        C  C   F S   L +H +    L  ++  F C +C   F     L  H  +H G+ +
Sbjct:  224 YKCEICNKGFVQSSALSSHLLTHSGKRPYECLTCGQTFRSRSNLLYHERR----------HRGEAPFECQTCGKVFVRSDNLSKHMLCHTGEKPYKCQVCERGFACTSALKSHQRRH---DGIKPYKCERCDKRFTSSNERTRHMRTHTGDKPYTCDICKENFMYTTSLARHKLIHSGAKPFKCDTCEKAFRSSSELTRHVK----LVHVKKPFPCDTCKQAFRSEDALARHKNTHAGDLL 447          

HSP 3 Score: 75.8702 bits (185), Expect = 5.321e-14
Identity = 73/274 (26.64%), Postives = 117/274 (42.70%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGH 1187
            Y C +C + +   +A T H+R     + Y CR C++ +   S    H  +          + G     C  C+   +   T+  H  +HT  KP+ C  C K FA  A++  H   +    + + C+ CG+AF+     + H RT  H     F+          C  C+  F     L +H RS       +  + C+ C + FS   TLKSH++ H G +   C +C  +GF   + L+ H+   H+ K  R + C  C  TF S+ +L  H
Sbjct:   27 YSCRTCDKEFTRRDALTCHIRIHTGERPYECRYCDKRFSQPSHRVQHEFK----------HSGERSHMCDICSKSFSRASTLVRHMISHTDDKPYVCTKCNKAFAYSASLVKHDRVYHRGVKPYECDICGRAFSDRSGLVKHERT--HTGERPFE----------CSFCHMMFSLKGLLTRHMRS----HTGQRPYKCEYCSAAFSVSDTLKSHLRLHTGERPYKCEICN-KGFVQSSALSSHLL-THSGK--RPYECLTCGQTFRSRSNLLYH 270          

HSP 4 Score: 75.485 bits (184), Expect = 8.259e-14
Identity = 64/279 (22.94%), Postives = 103/279 (36.92%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMH 1202
            + C  C   +      T+HMR     + Y C  C   +     L  H R           + G   + C  CN        +  H   H+G +P+ C  CG+ F  ++N+  H+ RH   +  F C+TCGK F   D    H+            +  + +    C  C   F     L  H R    +K  +    C+ CD  F+       H+++H G++  +C +C E      +   H +  + A        C  CE  F S  +L  H+  +H
Sbjct:  168 FECSFCHMMFSLKGLLTRHMRSHTGQRPYKCEYCSAAFSVSDTLKSHLR----------LHTGERPYKCEICNKGFVQSSALSSHLLTHSGKRPYECLTCGQTFRSRSNLLYHERRH-RGEAPFECQTCGKVFVRSDNLSKHM------------LCHTGEKPYKCQVCERGFACTSALKSHQRRHDGIKPYK----CERCDKRFTSSNERTRHMRTHTGDKPYTCDICKENFMYTTSLARHKLIHSGAKPFK----CDTCEKAFRSSSELTRHVKLVH 415          

HSP 5 Score: 62.7734 bits (151), Expect = 7.550e-10
Identity = 45/168 (26.79%), Postives = 74/168 (44.05%), Query Frame = 3
Query:  318 SGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDC--NYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHEL 815
            S N++           Y+C  C + +   +A   H R    +K Y C +C++ + + ++   H R TH          G+  + C  C  N+M     ++  H+  H+G KPF CD C K F   + +  H  + +H  + F C+TC +AF S D    H  T   +L
Sbjct:  292 SDNLSKHMLCHTGEKPYKCQVCERGFACTSALKSHQRRHDGIKPYKCERCDKRFTSSNERTRHMR-THT---------GDKPYTCDICKENFMYTT--SLARHKLIHSGAKPFKCDTCEKAFRSSSELTRH-VKLVHVKKPFPCDTCKQAFRSEDALARHKNTHAGDL 446          

HSP 6 Score: 57.7658 bits (138), Expect = 2.550e-8
Identity = 60/232 (25.86%), Postives = 86/232 (37.07%), Query Frame = 3
Query:  570 CPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILG-----------------CMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEER 1214
            C +C+    N   +  H+R H   KP+SC  C K F ++  +  H   H   +R + C  C K F+     + H      E R H   I S                       C  CN  F    +L KH R   +  +    + C  C   FSD   L  H ++H G +   C  C    F     L  H+ R+H     R + C YC + F     L  H+  +H+ ER
Sbjct:    1 CSECSRAFKNKSDLVKHKRVHCDDKPYSCRTCDKEFTRRDALTCHIRIHT-GERPYECRYCDKRFSQPSHRVQHEFKHSGE-RSHMCDICSKSFSRASTLVRHMISHTDDKPYVCTKCNKAFAYSASLVKHDR---VYHRGVKPYECDICGRAFSDRSGLVKHERTHTGERPFECSFC-HMMFSLKGLLTRHM-RSHT--GQRPYKCEYCSAAFSVSDTLKSHLR-LHTGER 222          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000046977.1 (zinc finger protein 782-like [Source:NCBI gene;Acc:105355363])

HSP 1 Score: 122.865 bits (307), Expect = 2.066e-29
Identity = 84/264 (31.82%), Postives = 124/264 (46.97%), Query Frame = 3
Query:  399 NANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHI 1190
            NA +   HM  +   + Y C +C + +  +S L  H   TH          G   F C  C+   +   +++ H R HTG KPFSC +C   F+  +N+KTH   H   D+ F C+ CG  F+      AH+RT   E                C  C+ +F    +L +H R+       E  F CK CD+ FS +  LK+H+++H G++  SC VCG  GF   + LN HI R H  +  R   C+ C+++F  K  LD H+
Sbjct:  100 NAPSVLVHMGTESDKRPYVCEECGKGFTCISNLKRHMT-THT---------GEKPFSCKICDTSFSIKSSLKRHIRTHTGEKPFSCKVCDTSFSCVSNLKTHMRTHT-GDKPFSCKVCGTGFSQMSSLNAHIRTHTGERP------------FSCKICDTSFSIKSSLKRHIRT----HTGEKPFSCKVCDTSFSCVSNLKTHMRTHTGDKPFSCKVCGT-GFSQMSSLNAHI-RTHTGE--RPFSCKICDTSFSQKSILDSHM 332          

HSP 2 Score: 89.7373 bits (221), Expect = 2.840e-18
Identity = 63/223 (28.25%), Postives = 94/223 (42.15%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQI 1034
            + C  C  S+   +    HMR     K ++C+ C   +  +S L  H R TH          G   F C  C+   +   +++ H R HTG KPFSC +C   F+  +N+KTH   H   D+ F C+ CG  F+      AH+RT   E                C  C+ +F     L+ H R+       +  F CK C   FS   +L +H ++H G  +
Sbjct:  173 FSCKVCDTSFSCVSNLKTHMRTHTGDKPFSCKVCGTGFSQMSSLNAHIR-THT---------GERPFSCKICDTSFSIKSSLKRHIRTHTGEKPFSCKVCDTSFSCVSNLKTHMRTHT-GDKPFSCKVCGTGFSQMSSLNAHIRTHTGERP------------FSCKICDTSFSQKSILDSHMRT----HTGDRPFSCKVCKKSFSQKSSLNAHRRTHTGESL 368          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000008836.2 (pep primary_assembly:ASM223467v1:17:11395122:11396276:-1 gene:ENSORLG00000007032.2 transcript:ENSORLT00000008836.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.398 bits (298), Expect = 3.938e-28
Identity = 99/334 (29.64%), Postives = 139/334 (41.62%), Query Frame = 3
Query:  219 ISDTIVQLEGESYHVI--SDENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEER 1214
            I    VQL+  S+      D  G+ Y           N+     I      Y C  C +S+  + A   HMR     + +TC+ CE+ + T S L +H R TH          G   F C  C         ++ H R HTG KP+SC +CGK F+Q   +KTH   H   +R + CE CGK F S      H+RT             + +    C  C   F +  +L  HTR+       E  F C+ C   F    +L  H+++H G +   C VC +R F     LN H+ R H  +  R   C  C+ +F S  DL  H+   H+ ER
Sbjct:   31 IDAVTVQLDSPSHGTSHSCDTCGKVYTR-------RSNLKTHMRIHTGERPYSCKVCEKSFVQSTALNVHMRTHTGERPFTCKVCEKSFITNSDLKVHLR-THT---------GERPFTCEVCGKSFTQSSDLKVHMRTHTGEKPYSCKVCGKSFSQSCKLKTHMRTHT-GERPYSCEVCGKGFPSISELKIHMRTH------------TGEKPFTCKICEKLFSTSSDLKIHTRT----HTGEKPFSCEICKKAFIQARSLTDHMRTHTGEKPFICRVCQKR-FMHRAALNVHL-RTHTGE--RPFTCEVCQKSFISTSDLKSHMR-THTGER 325          

HSP 2 Score: 97.0561 bits (240), Expect = 1.218e-20
Identity = 74/265 (27.92%), Postives = 110/265 (41.51%), Query Frame = 3
Query:  318 SGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHA 1112
            S ++ V          Y C  C +S+  +     HMR     + Y+C  C + + ++S+L +H R TH          G   F C  C  + +    ++ H R HTG KPFSC+IC K F Q  ++  H   H   ++ F C  C K F        HLRT             + +    C  C  +F S  +L  H R+       E  F C  C+  F     LK H+++H G +   C VC  + FP  ++L  H+ R H 
Sbjct:  143 SSDLKVHMRTHTGEKPYSCKVCGKSFSQSCKLKTHMRTHTGERPYSCEVCGKGFPSISELKIHMR-THT---------GEKPFTCKICEKLFSTSSDLKIHTRTHTGEKPFSCEICKKAFIQARSLTDHMRTHT-GEKPFICRVCQKRFMHRAALNVHLRTH------------TGERPFTCEVCQKSFISTSDLKSHMRT----HTGERPFLCTVCEKTFIKSSHLKVHIRTHTGERPFCCEVC-VKSFPTRSELKVHM-RTHT 378          

HSP 3 Score: 93.9745 bits (232), Expect = 1.049e-19
Identity = 66/225 (29.33%), Postives = 95/225 (42.22%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIIS 1040
            Y C  C + + + +    HMR     K +TC+ CE+ + T S L +H R TH          G   F C  C        ++  H R HTG KPF C +C K F  +A +  H   H   +R F CE C K+F S     +H+RT             + +    C  C  TF    +L  H R+       E  FCC+ C   F     LK H+++H G ++ +
Sbjct:  187 YSCEVCGKGFPSISELKIHMRTHTGEKPFTCKICEKLFSTSSDLKIHTR-THT---------GEKPFSCEICKKAFIQARSLTDHMRTHTGEKPFICRVCQKRFMHRAALNVHLRTHT-GERPFTCEVCQKSFISTSDLKSHMRTH------------TGERPFLCTVCEKTFIKSSHLKVHIRT----HTGERPFCCEVCVKSFPTRSELKVHMRTHTGEKLFT 384          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000027779.1 (pep primary_assembly:ASM223467v1:2:7000025:7001683:-1 gene:ENSORLG00000026811.1 transcript:ENSORLT00000027779.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.627 bits (296), Expect = 6.404e-27
Identity = 99/339 (29.20%), Postives = 152/339 (44.84%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYL--AHLRTREHE-----------------LREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHT 1325
            Y C  C +S++  ++   HMR     K Y+C++CE+ +   S L  H  RTH          G   F C +C+    +  +++ H R HTG KPF+C  C K F   +N+KTH   H   ++ F C+ C  +F  Y I+   +H+RT   E                 L+ H +   + ++   C  C  +F+S+ NL KHTR+       E  F CK C   FS    LK H+++H G +  +C  C E+ F   + L  H+ R H  +      C+ CES+F    DL  H+   H+ ER             C+  +  F+  S ++   H R HT
Sbjct:  190 YICKECEKSFRYRSSIKTHMRTHTGEKPYSCKECEKSFNHSSHLKRHM-RTHT---------GEKPFSCEECDTSFRHRSSLKTHMRTHTGEKPFTCKECEKTFTSVSNLKTHMITHT-GEKPFSCKECESSF--YQIFALKSHMRTHTGERPFSCKECESSFSHRSSLKTHMR-THTEEMPFSCKECEKSFNSVSNLKKHTRT----HTGEKPFSCKECKKSFSYSSNLKRHMRTHTGEKPFTCKEC-EKSFSSVSNLKTHM-RTHGGETP--FSCKECESSFNQILDLKTHMR-THAGERP----------FSCKECDSGFSHRSSLIT--HMRTHT 493          

HSP 2 Score: 118.627 bits (296), Expect = 6.579e-27
Identity = 85/292 (29.11%), Postives = 131/292 (44.86%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHE-----------------LREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHI 1190
            + C  C  S+++ ++   HMR     K +TC++CE+ + ++S L  H   TH          G   F C +C         ++ H R HTG +PFSC  C   F+ ++++KTH   H  ++  F C+ C K+FNS      H RT   E                 L+ H +     K    C  C  +F S+ NL  H R+ G     ET F CK C+S F+ I+ LK+H+++H G +  SC  C      GF+  +  IT        +   C+ C+  F S  +L  H+
Sbjct:  246 FSCEECDTSFRHRSSLKTHMRTHTGEKPFTCKECEKTFTSVSNLKTHMI-THT---------GEKPFSCKECESSFYQIFALKSHMRTHTGERPFSCKECESSFSHRSSLKTHMRTHT-EEMPFSCKECEKSFNSVSNLKKHTRTHTGEKPFSCKECKKSFSYSSNLKRHMRTHTGEKPFT-CKECEKSFSSVSNLKTHMRTHG----GETPFSCKECESSFNQILDLKTHMRTHAGERPFSCKECD----SGFSHRSSLITHMRTHTGEKPFSCKECDKRFISVSNLKKHM 517          

HSP 3 Score: 102.834 bits (255), Expect = 6.276e-22
Identity = 74/268 (27.61%), Postives = 112/268 (41.79%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTR--------SC-----------GILKQM-----ETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHI 1097
            + C  C  S+    A   HMR     + ++C++CE  +   S L  H R TH +            F C +C    N+   ++ H R HTG KPFSC  C K F+  +N+K H   H   ++ F C+ C K+F+S      H+RT               +    C  C ++F+ + +L  H R        SC            ++  M     E  F CK CD  F  +  LK H+++H G +  SC  C +R F   + L  H+
Sbjct:  302 FSCKECESSFYQIFALKSHMRTHTGERPFSCKECESSFSHRSSLKTHMR-THTE---------EMPFSCKECEKSFNSVSNLKKHTRTHTGEKPFSCKECKKSFSYSSNLKRHMRTHT-GEKPFTCKECEKSFSSVSNLKTHMRTH------------GGETPFSCKECESSFNQILDLKTHMRTHAGERPFSCKECDSGFSHRSSLITHMRTHTGEKPFSCKECDKRFISVSNLKKHMRTHTGEKPFSCNEC-KRSFSYSSHLKRHM 545          

HSP 4 Score: 91.2781 bits (225), Expect = 3.628e-18
Identity = 69/239 (28.87%), Postives = 102/239 (42.68%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHE-----------------LREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQ 1031
            + C  C  S+ + ++   HMR       ++C++CE+ + ++S L  H R TH          G   F C +C    +    ++ H R HTG KPF+C  C K F+  +N+KTH   H   +  F C+ C  +FN       H+RT   E                 L  H +     K    C  C+  F S+ NL KH R+       E  F C  C   FS    LK H+K+H G++
Sbjct:  330 FSCKECESSFSHRSSLKTHMRTHTEEMPFSCKECEKSFNSVSNLKKHTR-THT---------GEKPFSCKECKKSFSYSSNLKRHMRTHTGEKPFTCKECEKSFSSVSNLKTHMRTHG-GETPFSCKECESSFNQILDLKTHMRTHAGERPFSCKECDSGFSHRSSLITHMRTHTGEK-PFSCKECDKRFISVSNLKKHMRT----HTGEKPFSCNECKRSFSYSSHLKRHMKTHTGDK 552          

HSP 5 Score: 57.7658 bits (138), Expect = 8.141e-8
Identity = 58/220 (26.36%), Postives = 88/220 (40.00%), Query Frame = 3
Query:  717 IHKDRIFRCETCGKAFNSYDIYLAHLRTREHE-----------------LREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHT 1325
            +  +R + C+ C K+F        H+RT   E                 L+ H +     K    C  C+ +F    +L  H R+       E  F CK C+  F+ +  LK+H+ +H G +  SC  C E  F     L  H+ R H     R   C+ CES+F  +  L  H+   H+EE              C+   C+ + NSV  + +H R HT
Sbjct:  184 VSDERCYICKECEKSFRYRSSIKTHMRTHTGEKPYSCKECEKSFNHSSHLKRHMRTHTGEK-PFSCEECDTSFRHRSSLKTHMRT----HTGEKPFTCKECEKTFTSVSNLKTHMITHTGEKPFSCKEC-ESSFYQIFALKSHM-RTHT--GERPFSCKECESSFSHRSSLKTHMR-THTEEMP----------FSCK--ECEKSFNSVSNLKKHTRTHT 381          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000000405.2 (pep primary_assembly:ASM223467v1:2:7440720:7481203:1 gene:ENSORLG00000024652.1 transcript:ENSORLT00000000405.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.316 bits (290), Expect = 7.722e-27
Identity = 96/385 (24.94%), Postives = 160/385 (41.56%), Query Frame = 3
Query:   78 QSMHDEDMVVISEETLDMNTLQSLFASGNVQTLSNDDEIIQVSDSGIISDTIVQLEGESYHVISD-------ENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEE 1211
            + + D   ++      D+N  QS     N  T + D+E    S +   +D   + + +S+  +S           +   +      S         I      + C  C +S+   +    HMR     K ++C++CE+ +  +  L  H  RTH          G   F C +C+   N   +++ H R HTG KPFSC  C K F+Q +++ +H   H   ++ F C+ C K F   +    H+R            I + +    C  CN +F   F+L  H R+       E  F CK CDS F+ + +LK+H+++H G +  SC  C  +GF   + L  H++    +K      C+ C+  F     L  H+   H+EE
Sbjct:    2 KKLKDPKPLLTKNSEADLNNQQSF----NESTSTTDEETESTSTTDEETDPQNREQKKSFSYLSPIKTHMRTHTREKPFSCKECDKSFSQFKFHMRIHKKVKPFACKECTKSFSKLSYLKSHMRTHTEEKPFSCKECEKSFSNICNLKTHM-RTHT---------GEKPFSCKECDKSFNLISSLKKHMRTHTGEKPFSCKDCDKSFSQISHLYSHMRTHT-GEKPFSCKECDKRFRQINNLKRHMR------------IHTGEKPFFCQECNKSFRQTFDLKIHMRT----HTGEKPFSCKECDSSFNQVSSLKTHMRTHTGERPFSCKECN-KGFSQISHLKAHMSTHSGVKP---FSCKRCDKGFSRIYHLKRHMR-THTEE 350          

HSP 2 Score: 106.686 bits (265), Expect = 1.231e-23
Identity = 82/276 (29.71%), Postives = 125/276 (45.29%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAF-NSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHI 1190
            + C  C +S+ N      HMR     K ++C++C++ +  +S L  H R TH          G   F C DC+   +    +  H R HTG KPFSC  C K F Q  N+K H   H   ++ F C+ C K+F  ++D+ + H+RT   E                C  C+++F+ + +L  H R+       E  F CK C+  FS I  LK+H+ +H G +  SC  C ++GF     L  H+ R H  +      C  CE  +   + L  H+
Sbjct:  129 FSCKECEKSFSNICNLKTHMRTHTGEKPFSCKECDKSFNLISSLKKHMR-THT---------GEKPFSCKDCDKSFSQISHLYSHMRTHTGEKPFSCKECDKRFRQINNLKRHMRIHT-GEKPFFCQECNKSFRQTFDLKI-HMRTHTGE------------KPFSCKECDSSFNQVSSLKTHMRT----HTGERPFSCKECNKGFSQISHLKAHMSTHSGVKPFSCKRC-DKGFSRIYHLKRHM-RTHTEETP--FSCTGCEKNYTKLRSLKTHM 372          

HSP 3 Score: 91.2781 bits (225), Expect = 1.376e-18
Identity = 88/351 (25.07%), Postives = 135/351 (38.46%), Query Frame = 3
Query:  384 PQSYQNANAFT------KHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHE-------LREHFQMIA---------SSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHTLQ------GTNGNYA 1352
            PQ+ +   +F+       HMR     K ++C++C++   + SQ   H R           +     F C +C    +    ++ H R HT  KPFSC  C K F+   N+KTH   H   ++ F C+ C K+FN       H+RT   E         + F  I+         + +    C  C+  F  + NL +H R    +   E  F C+ C+  F     LK H+++H G +  SC  C       FNQ++   T        R   C+ C   F     L  H+S           +   V    C+   CD   + +  + RH R HT +      G   NY 
Sbjct:   48 PQNREQKKSFSYLSPIKTHMRTHTREKPFSCKECDK---SFSQFKFHMR----------IHKKVKPFACKECTKSFSKLSYLKSHMRTHTEEKPFSCKECEKSFSNICNLKTHMRTHT-GEKPFSCKECDKSFNLISSLKKHMRTHTGEKPFSCKDCDKSFSQISHLYSHMRTHTGEKPFSCKECDKRFRQINNLKRHMR----IHTGEKPFFCQECNKSFRQTFDLKIHMRTHTGEKPFSCKECDS----SFNQVSSLKTHMRTHTGERPFSCKECNKGFSQISHLKAHMS-----------THSGVKPFSCK--RCDKGFSRIYHLKRHMRTHTEETPFSCTGCEKNYT 363          

HSP 4 Score: 74.7146 bits (182), Expect = 2.474e-13
Identity = 51/185 (27.57%), Postives = 80/185 (43.24%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRS 920
            + C  C + ++  N   +HMR     K + C++C + +     L +H R TH          G   F C +C+   N   +++ H R HTG +PFSC  C K F+Q +++K H + H    + F C+ C K F+       H+RT   E                C GC   +  + +L  H RS
Sbjct:  213 FSCKECDKRFRQINNLKRHMRIHTGEKPFFCQECNKSFRQTFDLKIHMR-THT---------GEKPFSCKECDSSFNQVSSLKTHMRTHTGERPFSCKECNKGFSQISHLKAHMSTHS-GVKPFSCKRCDKGFSRIYHLKRHMRTHTEE------------TPFSCTGCEKNYTKLRSLKTHMRS 374          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000011011.2 (pep primary_assembly:ASM223467v1:2:7061989:7065174:1 gene:ENSORLG00000026684.1 transcript:ENSORLT00000011011.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.472 bits (293), Expect = 1.007e-26
Identity = 81/291 (27.84%), Postives = 135/291 (46.39%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTRE-------HELREHFQMIASSKLILG---------CMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHI 1190
            + C  C +++ + ++   HMR     K +TC++C+  +  LS L  H R TH          G   F C +C+   N    ++ H R HTG KPFSC  C KHF++ +N+K H   H   ++ F C+ C  +F+       H+R          +E  + F  ++  K  +          C  C+ +F ++ N  +H R+       E  F CK CD+ FS +  L++H+++H G +  SC  C +R F   + L  HI R H     +   C+ C+++F    +L  H+
Sbjct:  207 FSCIECDKTFSHKSSLKTHMRTHTGEKPFTCKECDSSFSDLSNLKTHMR-THT---------GEKPFFCKECDRSFNQMSHLKTHMRTHTGEKPFSCKECKKHFSRISNLKAHMRTHT-GEKPFTCKECNSSFSHVSKLKKHIRIHTEGNPFSCNECEKRFSAVSLLKRHMRTHIVEKGFFCKECDKSFSTVSNFKRHMRT----HTGEKPFSCKECDTSFSRVSNLQTHMRTHTGEKPFSCEKC-DRSFRNISNLKTHI-RTHT--GEKPFYCKECDTSFSQISNLKTHM 478          

HSP 2 Score: 102.449 bits (254), Expect = 8.293e-22
Identity = 75/261 (28.74%), Postives = 119/261 (45.59%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHE-----------------LREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHI 1097
            + C  C +S+   +    HMR     K ++C++C++ +  +S L  H R TH          G   F C +CN   ++   ++ H R HT   PFSC+ C K F+  + +K H   HI  ++ F C+ C K+F++   +  H+RT   E                 L+ H +     K    C  C+ +F ++ NL  H R+       E  F CK CD+ FS I  LK+H+++H G    SC  C E+ F   + L  H+
Sbjct:  263 FFCKECDRSFNQMSHLKTHMRTHTGEKPFSCKECKKHFSRISNLKAHMR-THT---------GEKPFTCKECNSSFSHVSKLKKHIRIHTEGNPFSCNECEKRFSAVSLLKRHMRTHI-VEKGFFCKECDKSFSTVSNFKRHMRTHTGEKPFSCKECDTSFSRVSNLQTHMRTHTGEK-PFSCEKCDRSFRNISNLKTHIRT----HTGEKPFYCKECDTSFSQISNLKTHMRTHTGESPFSCKDC-EKRFSHISNLKAHM 506          

HSP 3 Score: 92.4337 bits (228), Expect = 1.086e-18
Identity = 63/229 (27.51%), Postives = 104/229 (45.41%), Query Frame = 3
Query:  366 YRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVC 1052
            + C  C  S+ + +   KH+R       ++C +CE+ +  +S L  H R TH+  K          F C +C+   +     + H R HTG KPFSC  C   F++ +N++TH   H   ++ F CE C ++F +      H+RT             + +    C  C+ +F  + NL  H R+       E+ F CK C+  FS I  LK+H+++  G +  +   C
Sbjct:  319 FTCKECNSSFSHVSKLKKHIRIHTEGNPFSCNECEKRFSAVSLLKRHMR-THIVEKG---------FFCKECDKSFSTVSNFKRHMRTHTGEKPFSCKECDTSFSRVSNLQTHMRTHT-GEKPFSCEKCDRSFRNISNLKTHIRTH------------TGEKPFYCKECDTSFSQISNLKTHMRT----HTGESPFSCKDCEKRFSHISNLKAHMRTRTGEKPFTFKEC 520          

HSP 4 Score: 79.7221 bits (195), Expect = 1.205e-14
Identity = 51/192 (26.56%), Postives = 82/192 (42.71%), Query Frame = 3
Query:  345 IDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRS 920
            I   G  + C  C + +   +   +HMR     K + C++C++ + T+S    H  RTH          G   F C +C+   +    ++ H R HTG KPFSC+ C + F   +N+KTH   H   ++ F C+ C  +F+       H+RT             + +    C  C   F  + NL  H R+
Sbjct:  340 IHTEGNPFSCNECEKRFSAVSLLKRHMRTHIVEKGFFCKECDKSFSTVSNFKRHM-RTHT---------GEKPFSCKECDTSFSRVSNLQTHMRTHTGEKPFSCEKCDRSFRNISNLKTHIRTHT-GEKPFYCKECDTSFSQISNLKTHMRTH------------TGESPFSCKDCEKRFSHISNLKAHMRT 508          

HSP 5 Score: 72.7886 bits (177), Expect = 1.960e-12
Identity = 55/217 (25.35%), Postives = 92/217 (42.40%), Query Frame = 3
Query:  726 DRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEE----RNARQSRGAVGRLRCRY-----------TNCDFTSNSVMLMDRHHRQHTLQ 1331
            +R + C+ CGK+F++  ++  H+R  E + R              C+ C+ TF    +L  H R+       E  F CK CDS FSD+  LK+H+++H G +   C  C       FNQ++H  T        +   C+ C+  F    +L  H+     E+    +    S   V +L+                C+   ++V L+ RH R H ++
Sbjct:  176 ERCYICKECGKSFSNISLFRIHIRIHEEDKR------------FSCIECDKTFSHKSSLKTHMRT----HTGEKPFTCKECDSSFSDLSNLKTHMRTHTGEKPFFCKECDR----SFNQMSHLKTHMRTHTGEKPFSCKECKKHFSRISNLKAHMRTHTGEKPFTCKECNSSFSHVSKLKKHIRIHTEGNPFSCNECEKRFSAVSLLKRHMRTHIVE 372          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000031886.1 (SMESG000031886.1)

HSP 1 Score: 1279.62 bits (3310), Expect = 0.000e+0
Identity = 685/685 (100.00%), Postives = 685/685 (100.00%), Query Frame = 3
Query:   39 MDDHNVFLTINDNQSMHDEDMVVISEETLDMNTLQSLFASGNVQTLSNDDEIIQVSDSGIISDTIVQLEGESYHVISDENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHTLQGTNGNYALTLPQSRYSKYNKRRKIREAKKQXXXXXXXXXXXXXXRVNASLEANEILRYPTLLXXXXXXXXXXXXXXXXXXXXXXXXLKNKHDVYHHDEVNDMQQLADSLNLSAENLLPIRSKSEILSKKQLHQSLVRVKTEHVVNVQAKTSTPKPPRQKKIETQIYTAXXXXXXXXXXXXXXXXXXXXXLTSGRSRKKPWWYKDYDTTDMMLEEGETARHASSSSSVGRNKSAAAYDTNNDALINDTEEWNIDM 2093
            MDDHNVFLTINDNQSMHDEDMVVISEETLDMNTLQSLFASGNVQTLSNDDEIIQVSDSGIISDTIVQLEGESYHVISDENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDPKKPKKNPGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHTLQGTNGNYALTLPQSRYSKYNKRRKIREAKKQEDYDDAELLDEEIERVNASLEANEILRYPTLLDEDDDEEEEDEEGIDNEDVEDDDDLKNKHDVYHHDEVNDMQQLADSLNLSAENLLPIRSKSEILSKKQLHQSLVRVKTEHVVNVQAKTSTPKPPRQKKIETQIYTASINNINHSSNNHSNNSIESNNLTSGRSRKKPWWYKDYDTTDMMLEEGETARHASSSSSVGRNKSAAAYDTNNDALINDTEEWNIDM
Sbjct:    1 MDDHNVFLTINDNQSMHDEDMVVISEETLDMNTLQSLFASGNVQTLSNDDEIIQVSDSGIISDTIVQLEGESYHVISDENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDPKKPKKNPGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHTLQGTNGNYALTLPQSRYSKYNKRRKIREAKKQEDYDDAELLDEEIERVNASLEANEILRYPTLLDEDDDEEEEDEEGIDNEDVEDDDDLKNKHDVYHHDEVNDMQQLADSLNLSAENLLPIRSKSEILSKKQLHQSLVRVKTEHVVNVQAKTSTPKPPRQKKIETQIYTASINNINHSSNNHSNNSIESNNLTSGRSRKKPWWYKDYDTTDMMLEEGETARHASSSSSVGRNKSAAAYDTNNDALINDTEEWNIDM 685          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000031886.1 (SMESG000031886.1)

HSP 1 Score: 1244.57 bits (3219), Expect = 0.000e+0
Identity = 672/685 (98.10%), Postives = 672/685 (98.10%), Query Frame = 3
Query:   39 MDDHNVFLTINDNQSMHDEDMVVISEETLDMNTLQSLFASGNVQTLSNDDEIIQVSDSGIISDTIVQLEGESYHVISDENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHTLQGTNGNYALTLPQSRYSKYNKRRKIREAKKQXXXXXXXXXXXXXXRVNASLEANEILRYPTLLXXXXXXXXXXXXXXXXXXXXXXXXLKNKHDVYHHDEVNDMQQLADSLNLSAENLLPIRSKSEILSKKQLHQSLVRVKTEHVVNVQAKTSTPKPPRQKKIETQIYTAXXXXXXXXXXXXXXXXXXXXXLTSGRSRKKPWWYKDYDTTDMMLEEGETARHASSSSSVGRNKSAAAYDTNNDALINDTEEWNIDM 2093
            MDDHNVFLTINDNQSMHDEDMVVISEETLDMNTLQSLFASGNVQTLSNDDEIIQ             LEGESYHVISDENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDPKKPKKNPGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHTLQGTNGNYALTLPQSRYSKYNKRRKIREAKKQEDYDDAELLDEEIERVNASLEANEILRYPTLLDEDDDEEEEDEEGIDNEDVEDDDDLKNKHDVYHHDEVNDMQQLADSLNLSAENLLPIRSKSEILSKKQLHQSLVRVKTEHVVNVQAKTSTPKPPRQKKIETQIYTASINNINHSSNNHSNNSIESNNLTSGRSRKKPWWYKDYDTTDMMLEEGETARHASSSSSVGRNKSAAAYDTNNDALINDTEEWNIDM
Sbjct:    1 MDDHNVFLTINDNQSMHDEDMVVISEETLDMNTLQSLFASGNVQTLSNDDEIIQ-------------LEGESYHVISDENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDPKKPKKNPGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHTLQGTNGNYALTLPQSRYSKYNKRRKIREAKKQEDYDDAELLDEEIERVNASLEANEILRYPTLLDEDDDEEEEDEEGIDNEDVEDDDDLKNKHDVYHHDEVNDMQQLADSLNLSAENLLPIRSKSEILSKKQLHQSLVRVKTEHVVNVQAKTSTPKPPRQKKIETQIYTASINNINHSSNNHSNNSIESNNLTSGRSRKKPWWYKDYDTTDMMLEEGETARHASSSSSVGRNKSAAAYDTNNDALINDTEEWNIDM 672          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000031885.1 (SMESG000031885.1)

HSP 1 Score: 706.057 bits (1821), Expect = 0.000e+0
Identity = 386/389 (99.23%), Postives = 387/389 (99.49%), Query Frame = 2
Query: 3605 MDQYLKNSDNFSPTKNANVRDFSDKISIISVVLLLAASGIISNKLYYINPLQCYTAVHPTGEKIDKFINAYTWTHGTIPKSAFSNQLPETKAQWIDVYDKYGIQYYQWIPFILILQAAMLYLPILLWDHCCSFAMRIDLVSVFNEARNALYKGDEARKKSIEKIXXXXXXXXXXXXXXXXXIAKIRRKIRNWMIAYTFSQSQRNFLFSSYIGLKVLSLVMCMIEIAMLHFMFNINLISMISYFQGAPNDISLSFPIETYGLLSDLRVLGADNIYYSECRLTVNMINEKLFVMXXXXXXXXXXXXXXXXXXXXXRVKVFYRQMRTIKKVFKIKGIEIPDSKLLKEFVCEFLKTDGIFLINMLERNAGDLVSTDVVYELWLKYSTNLLFLE 4771
            MDQYLKNSDNFSPTKNANVRDFSDKISIISVVLLLAASGIISNKLYYINPLQCYTAVHPTGEKIDKFINAYTWTHGTIPKSAFSNQLPETKAQWIDVYDKYGIQYYQWIPFILILQAAMLYLPILLWDHCCSFAMRIDLVSVFNEARNALYKGDEARKKSIEKISNSLELVL KKEKKSGLIAKIRRKIRNWMIAYTFSQSQRNFLFSSYIGLKVLSLVMCMIEIAMLHFMFNINLISMISYFQGAPNDISLSFPIETYGLLSDLRVLGADNIYYSECRLTVNMINEKLFVMIWIGLVVIGILQLISLLIWISRVKVFYRQMRTIKKVFKIKGIEIPDSKLLKEFVCEFLKTDGIFL NMLERNAGDLVSTDVVYELWLKYS+NLLFLE
Sbjct:    1 MDQYLKNSDNFSPTKNANVRDFSDKISIISVVLLLAASGIISNKLYYINPLQCYTAVHPTGEKIDKFINAYTWTHGTIPKSAFSNQLPETKAQWIDVYDKYGIQYYQWIPFILILQAAMLYLPILLWDHCCSFAMRIDLVSVFNEARNALYKGDEARKKSIEKISNSLELVLLKKEKKSGLIAKIRRKIRNWMIAYTFSQSQRNFLFSSYIGLKVLSLVMCMIEIAMLHFMFNINLISMISYFQGAPNDISLSFPIETYGLLSDLRVLGADNIYYSECRLTVNMINEKLFVMIWIGLVVIGILQLISLLIWISRVKVFYRQMRTIKKVFKIKGIEIPDSKLLKEFVCEFLKTDGIFLTNMLERNAGDLVSTDVVYELWLKYSSNLLFLE 389          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000032517.1 (SMESG000032517.1)

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 386/389 (99.23%), Postives = 387/389 (99.49%), Query Frame = 2
Query: 3605 MDQYLKNSDNFSPTKNANVRDFSDKISIISVVLLLAASGIISNKLYYINPLQCYTAVHPTGEKIDKFINAYTWTHGTIPKSAFSNQLPETKAQWIDVYDKYGIQYYQWIPFILILQAAMLYLPILLWDHCCSFAMRIDLVSVFNEARNALYKGDEARKKSIEKIXXXXXXXXXXXXXXXXXIAKIRRKIRNWMIAYTFSQSQRNFLFSSYIGLKVLSLVMCMIEIAMLHFMFNINLISMISYFQGAPNDISLSFPIETYGLLSDLRVLGADNIYYSECRLTVNMINEKLFVMXXXXXXXXXXXXXXXXXXXXXRVKVFYRQMRTIKKVFKIKGIEIPDSKLLKEFVCEFLKTDGIFLINMLERNAGDLVSTDVVYELWLKYSTNLLFLE 4771
            MDQYLKNSDNFSPTKNANVRDFSDKISIISVVLLLAASGIISNKLYYINPLQCYTAVHPTGEKIDKFINAYTWTHGTIPKSAFSNQLPETKAQWIDVYDKYGIQYYQWIPFILILQAAMLYLPILLWDHCCSFAMRIDLVSVFNEARN+LYKGDEARKKSIEKISNSLELVLSKKEKKSGLIAKIRRKIRNWMIAYTFSQSQRNFLFSSYIGLKVLSLVMCMIEIAMLHFMFNINLISMISYFQGAPNDISLSFPIETYGLLSDLRVLGADNIYYSECRLTVNMINEKLFVMIWIGLVVIGILQLISLLIWISRVKVFYRQMRTIKKVFKIKGIEIPD KLL EFVCEFLKTDGIFLINMLERNAGDLVSTDVVYELWLKYSTNLLFLE
Sbjct:    1 MDQYLKNSDNFSPTKNANVRDFSDKISIISVVLLLAASGIISNKLYYINPLQCYTAVHPTGEKIDKFINAYTWTHGTIPKSAFSNQLPETKAQWIDVYDKYGIQYYQWIPFILILQAAMLYLPILLWDHCCSFAMRIDLVSVFNEARNSLYKGDEARKKSIEKISNSLELVLSKKEKKSGLIAKIRRKIRNWMIAYTFSQSQRNFLFSSYIGLKVLSLVMCMIEIAMLHFMFNINLISMISYFQGAPNDISLSFPIETYGLLSDLRVLGADNIYYSECRLTVNMINEKLFVMIWIGLVVIGILQLISLLIWISRVKVFYRQMRTIKKVFKIKGIEIPDLKLLNEFVCEFLKTDGIFLINMLERNAGDLVSTDVVYELWLKYSTNLLFLE 389          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000014054.1 (SMESG000014054.1)

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 287/489 (58.69%), Postives = 354/489 (72.39%), Query Frame = 3
Query:   51 NVFLTINDNQSMHDEDMVVISEETLDMNTLQSLFASGNVQTLSNDDEIIQVSDSGIISDTIVQLEGESYHVISDENGQTYLAPTNQTGSSGNIAVAQTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETLSQLFLHARRTHVDXXXXXXXXGNYKFHCPDCNYMTNNGGTMEHHRRAHTGVKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLAHLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQMETKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGAVGRLRCRYTNCDFTSNSVMLMDRHHRQHTLQGTNGNYALTLPQSRYSKYNKRRKIREAKKQXXXXXXXXXXXXXXRVNASLEANEILRYPTLL 1517
            N+FL   DN+   ++  ++  +  +  + +Q     G        + IIQ++D+   +  IV + GE Y + ++++G  Y+   N +  + +       +N  +TYRCPSC  SYQNANAFTKHMREKHFVKV+TCRQCE F+E LS LFLHARRTHVDPKKP+KNP N+KFHCPDC+YMTNNGGTMEHHRRAH+GVKP+ CDIC K FAQKANMKTHKNRHIHKDRIFRCETC K+FNS+DIYLAHLRTREHEL+EHF ++ SSK+ + CMGCN  F++ F +NKH+RSC ILK +  KF C  C+  FS+   LK H+K H GNQII CPVCGE+GFPGFNQLNHHITRAHALKVNRR+VCRYCE  FE+K  LD HI DMH  E+NARQSRGA GRLRCRY NCDFTSNSVMLMDRHH QH           +LP  +  K   R++     +  D++  EL++ EIE VN++++ NEILR   +L
Sbjct:    6 NLFLYQTDNREPEEQMYIIADDGNMQFDGIQ-----GYTMADGTGENIIQLNDT---NGQIVDMNGEPYIIYNNDDGLHYIIDANASEGNSDNNNNLDTNNKSVTYRCPSCTLSYQNANAFTKHMREKHFVKVFTCRQCEDFFENLSLLFLHARRTHVDPKKPRKNPSNFKFHCPDCDYMTNNGGTMEHHRRAHSGVKPYKCDICFKMFAQKANMKTHKNRHIHKDRIFRCETCSKSFNSHDIYLAHLRTREHELQEHFHIMMSSKIRIRCMGCNEVFENYFYVNKHSRSCDILKSLGIKFWCIQCEVGFSNSTELKHHLKGHGGNQIIICPVCGEKGFPGFNQLNHHITRAHALKVNRRNVCRYCEMPFETKDLLDEHIEDMHHSEKNARQSRGAAGRLRCRYENCDFTSNSVMLMDRHHDQHVNN--------SLPSQKEIKARGRKRKLPPIEMLDFEKHELIEAEIEHVNSTIDHNEILRDDQVL 478          
The following BLAST results are available for this feature:
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF3332.309e-2426.38zinc finger protein 333 [Source:HGNC Symbol;Acc:HG... [more]
ZNF7741.651e-2323.78zinc finger protein 774 [Source:HGNC Symbol;Acc:HG... [more]
ZNF5832.838e-2327.12zinc finger protein 583 [Source:HGNC Symbol;Acc:HG... [more]
ZNF5832.838e-2327.12zinc finger protein 583 [Source:HGNC Symbol;Acc:HG... [more]
ZNF4974.880e-2328.83zinc finger protein 497 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inx-11.440e-2225.61Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-11.440e-2225.61Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-12.557e-2225.61Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
unc-96.393e-2128.53Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O0... [more]
inx-194.340e-2025.06Innexin-19 [Source:UniProtKB/Swiss-Prot;Acc:O6171... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Meics1.012e-2127.70gene:FBgn0025874 transcript:FBtr0333030[more]
Meics1.205e-2127.70gene:FBgn0025874 transcript:FBtr0075791[more]
CG122993.647e-2025.07gene:FBgn0032295 transcript:FBtr0080113[more]
CG66547.988e-1925.40gene:FBgn0038301 transcript:FBtr0083139[more]
CG154361.467e-1725.41gene:FBgn0031610 transcript:FBtr0077442[more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX936382.11.164e-2729.67pep chromosome:GRCz11:4:64530121:64542903:-1 gene:... [more]
znf10421.254e-2726.29zinc finger protein 1042 [Source:ZFIN;Acc:ZDB-GENE... [more]
znf9715.294e-2727.49zinc finger protein 971 [Source:ZFIN;Acc:ZDB-GENE-... [more]
znf9715.294e-2727.49zinc finger protein 971 [Source:ZFIN;Acc:ZDB-GENE-... [more]
znf9715.294e-2727.49zinc finger protein 971 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000020796.11.294e-2429.51gastrula zinc finger protein XlCGF57.1-like [Sourc... [more]
ENSXETT00000047268.12.974e-2227.14oocyte zinc finger protein XlCOF7.1-like [Source:N... [more]
ENSXETT00000047265.12.974e-2227.14oocyte zinc finger protein XlCOF7.1-like [Source:N... [more]
ENSXETT00000047261.12.974e-2227.14oocyte zinc finger protein XlCOF7.1-like [Source:N... [more]
ENSXETT00000047257.12.974e-2227.14oocyte zinc finger protein XlCOF7.1-like [Source:N... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zfp266.677e-2526.79zinc finger protein 26 [Source:MGI Symbol;Acc:MGI:... [more]
Zfp6483.557e-2430.66zinc finger protein 648 [Source:MGI Symbol;Acc:MGI... [more]
Zfp6684.234e-2427.07zinc finger protein 668 [Source:MGI Symbol;Acc:MGI... [more]
Zfp6684.234e-2427.07zinc finger protein 668 [Source:MGI Symbol;Acc:MGI... [more]
Zfp6684.234e-2427.07zinc finger protein 668 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P10076|ZFP26_MOUSE8.154e-2426.79Zinc finger protein 26 OS=Mus musculus OX=10090 GN... [more]
sp|Q96JL9|ZN333_HUMAN1.109e-2326.38Zinc finger protein 333 OS=Homo sapiens OX=9606 GN... [more]
sp|Q90625|ZBT17_CHICK1.401e-2326.91Zinc finger and BTB domain-containing protein 17 (... [more]
sp|Q8K2R5|ZN668_MOUSE2.962e-2327.07Zinc finger protein 668 OS=Mus musculus OX=10090 G... [more]
sp|Q6NX45|ZN774_HUMAN7.931e-2323.78Zinc finger protein 774 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3WKD60.000e+065.38Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A0R3W5T80.000e+065.17Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
U6J2H90.000e+064.96Zinc finger and SCAN domain-containing protein 2 O... [more]
A0A068Y1F60.000e+064.96Zinc finger protein 271 OS=Echinococcus multilocul... [more]
A0A0R3TTN30.000e+062.79Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000031188.15.534e-2627.88pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000043964.14.983e-2428.10pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000032114.16.554e-2429.73zinc finger protein 2-like [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000039310.16.554e-2429.73zinc finger protein 2-like [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000026869.29.180e-2330.33pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF4364.363e-2230.50zinc finger protein 436 [Source:HGNC Symbol;Acc:HG... [more]
ENSPMAT00000000467.19.513e-2226.67pep scaffold:Pmarinus_7.0:GL480927:176958:178556:1... [more]
ENSPMAT00000002487.11.045e-1925.93pep scaffold:Pmarinus_7.0:GL476414:876407:883640:1... [more]
ENSPMAT00000007433.11.642e-1925.42pep scaffold:Pmarinus_7.0:GL498585:318:1981:-1 gen... [more]
ZNF4364.959e-1925.08zinc finger protein 436 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
AZF12.564e-1133.33Zinc-finger transcription factor; involved in diau... [more]
ZAP15.086e-927.91Zinc-regulated transcription factor; binds to zinc... [more]
PZF15.926e-926.91Transcription factor IIIA (TFIIIA); essential DNA ... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO489567.415e-2028.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318387.964e-2025.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384192.757e-1928.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488396.099e-1825.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410827.056e-1826.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000046977.12.066e-2931.82zinc finger protein 782-like [Source:NCBI gene;Acc... [more]
ENSORLT00000008836.23.938e-2829.64pep primary_assembly:ASM223467v1:17:11395122:11396... [more]
ENSORLT00000027779.16.404e-2729.20pep primary_assembly:ASM223467v1:2:7000025:7001683... [more]
ENSORLT00000000405.27.722e-2724.94pep primary_assembly:ASM223467v1:2:7440720:7481203... [more]
ENSORLT00000011011.21.007e-2627.84pep primary_assembly:ASM223467v1:2:7061989:7065174... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031886.10.000e+0100.00SMESG000031886.1[more]
SMESG000031886.10.000e+098.10SMESG000031886.1[more]
SMESG000031885.10.000e+099.23SMESG000031885.1[more]
SMESG000032517.10.000e+099.23SMESG000032517.1[more]
SMESG000014054.10.000e+058.69SMESG000014054.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003965 ID=SMED30003965|Name=Zinc finger and SCAN domain-containing protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=5197bp
ATTTAATTAATTTTAGATATATTTAATATAACTTACTTATGGATGATCAT
AATGTATTTTTGACTATAAATGACAATCAGAGTATGCATGATGAAGATAT
GGTTGTCATTTCTGAAGAAACTCTTGACATGAACACCTTACAATCTTTAT
TTGCTTCTGGCAATGTGCAGACTTTATCAAACGATGATGAGATAATACAG
GTTTCTGATTCTGGCATTATAAGTGATACTATTGTTCAGCTCGAGGGTGA
AAGTTATCATGTAATAAGTGATGAAAATGGTCAGACTTATTTGGCTCCAA
CCAATCAAACAGGTTCATCCGGAAATATTGCAGTTGCGCAAACAATAGAT
AATAATGGCATAACATATAGATGCCCTTCATGTCCTCAATCGTATCAAAA
TGCGAATGCTTTCACAAAGCATATGCGAGAAAAACACTTTGTTAAAGTCT
ATACTTGTCGACAATGTGAACAGTTTTATGAAACCCTCAGCCAATTATTT
TTGCATGCACGCCGAACCCACGTGGATCCAAAAAAACCAAAAAAGAATCC
TGGAAATTATAAATTCCATTGTCCAGACTGCAATTATATGACAAACAATG
GTGGGACAATGGAACACCATCGTCGTGCACATACTGGTGTTAAACCCTTT
TCGTGTGATATTTGTGGGAAACATTTCGCACAGAAAGCCAACATGAAAAC
TCATAAAAATCGTCACATTCATAAAGATAGAATATTTCGCTGTGAAACCT
GTGGCAAAGCATTCAATTCATATGATATTTATCTAGCTCATTTACGAACT
CGTGAGCATGAATTACGGGAGCATTTTCAAATGATTGCGTCATCGAAGTT
GATTCTCGGGTGTATGGGATGCAATAACACTTTTGATAGTATGTTTAATC
TCAATAAACATACTCGAAGTTGTGGAATTCTGAAACAAATGGAAACGAAA
TTCTGTTGTAAATCGTGTGACTCGTATTTCAGTGACATTATGACGCTGAA
ATCACATGTGAAATCTCACGAAGGCAATCAGATAATCTCTTGTCCTGTTT
GTGGGGAACGCGGTTTCCCTGGATTCAATCAATTGAATCATCACATTACT
CGCGCACATGCATTGAAAGTCAACCGTAGACACGTGTGCCGATACTGTGA
GTCGACTTTTGAAAGTAAAAAAGATCTTGACGGTCACATTTCCGATATGC
ATTCTGAAGAACGAAACGCCCGTCAATCTCGTGGCGCTGTTGGCCGATTG
CGTTGTCGATACACCAATTGCGATTTCACATCGAATTCTGTCATGCTGAT
GGATCGTCACCATCGCCAACACACCTTGCAAGGAACCAATGGAAATTATG
CTCTTACTCTTCCACAATCTCGATATTCGAAATACAACAAACGCCGAAAA
ATTCGCGAAGCGAAAAAACAAGAAGATTACGATGATGCCGAGTTGCTGGA
TGAAGAAATCGAACGAGTAAATGCCAGCTTAGAGGCGAATGAAATTTTAC
GATACCCGACGTTGTTGGATGAGGACGACGACGAAGAAGAAGAAGACGAA
GAAGGAATCGACAATGAGGACGTTGAAGACGACGACGATTTGAAAAACAA
GCATGATGTATATCATCACGATGAAGTAAATGACATGCAACAATTGGCCG
ATTCGTTGAATTTGTCTGCGGAAAATCTCCTACCGATTCGATCGAAATCG
GAAATTTTAAGCAAAAAACAACTGCACCAATCACTGGTTAGGGTGAAAAC
GGAACACGTGGTCAATGTTCAAGCGAAAACGTCAACACCAAAACCACCAC
GTCAAAAGAAAATAGAAACTCAGATATACACCGCTAGCATCAACAACATT
AACCATAGCAGCAATAACCATAGCAACAACAGCATTGAAAGCAACAATCT
GACCTCAGGAAGATCTCGCAAAAAGCCTTGGTGGTACAAAGATTACGACA
CAACGGATATGATGCTGGAAGAGGGTGAGACTGCTCGGCATGCATCATCA
TCGTCATCAGTAGGCCGCAACAAATCAGCAGCAGCTTATGACACCAATAA
CGACGCCTTGATTAATGACACGGAGGAATGGAACATAGATATGTAGAATT
GATCCTGTACATAATCAATATCGATATATACATATACATATATATATATA
CATACATATTTCCAATTTGATAATTGCGCTGCGTCGAATTATGTGTGTGT
GTGTTCGTCTGGTGTTTTGAATGTTTTGGAGATTCAATAATAATAATAAT
TCTGATGATGATAATAATATAAATTATATAATTATTTATTGCTACTAAAT
AGTTGTGTCTGTTGTTGATTGGCCGATTCAACGTTAATGATGATTAGACA
GTAATATAAAATTATTACTATTATCTCGGGCCCCAGAAACGCCTTGGAAT
ATAATAAAAATTTTTGTTACTATATTTGAAATTTAGATATTTTATTCGAT
TGGTTATTTTATTAAATAAATGTAAATGTTATTTATTGAAATTTTTTAGT
AAAATGATTTTTGGTCGGGCGCTTTTTTTTATAGGTTTAATATATTGTAT
TGCTCGTGGAGATGATACAGACATAAAATACAATTACAAAAGAATTCTAA
AGATTTTAAAAATTATATAAATTTCTTAATGAGAAAAAAATATACGTTTT
ATCCACTGCATTTTGTTGAAAGTATTGCGGCCTATTTATGAAGATACATT
TTAACTACATTGATTTTTCAAAACATTTGTGAAAAATTCAATTAAAATAT
TGAAAAGTTACGCAAAATTTTGTCAGAGAATCATTCTGTGATGTCTAAAA
ATATTAGAGAAAAATTTGTTTTAACTGAATAATGTTGGTGAAAACAATTG
GCAGATGTGTATTTATAACAACTACTCCCAATTATGATTCCGTCGCTACT
AATTAAAAGTGTTGTGTTGCTTTAGCTTTCTAACTTGACTTTGATTTTAA
CAGTTGATTTATTAGTGAGGCTCATAGTGATATGGTAGCAATAACCTTTG
CCAATCAACAAACTTCTGTATTTATCGGTAAACAATTTTTATTTTCATTT
TATGGTTATTTTGTAAACAATACATCGTTGAGAACATTGCTTTATATATT
ATTAACTGATGTAATTTCACATTGTAATAAGTGATAAGGTGATCACTAAT
ATTTTTTGCAATCAAATGTTGTCAGTAAATCACACTATGCTTGGTGACTA
CATTTGGTAAAACTTTTTCACGTCAGAAATCCACTCGCGATAACGTCTAA
ACATTACTGGAGCACGATTGGTATCAACGGAGTTGATATTATTCAGTGGA
ATACATTTTTTATAAGGTTGATACATTACTTACAATATAGACTCTCTAGT
AGTGTCGGTTTCTAATTTTGTGAATAATGATTTTTATTTATAATCAAACA
TTTCCAGCGTTCTTGCTAATACAGCCAAATGATGTTGGTCTCCAGCAACC
TTTAATATATAATAATCCCTTTAATCTAATAATAATAATCAAATAATAAT
GCGGAAATAATTCATAAACTGTTTTAATCAACATTGCGCAACATAACGTA
ATTAATTAATATATAAATAAACTCACGAAATATTATTTTCATTCCATCAA
TTAAATGGACCAATATTTAAAGAATTCGGACAATTTTAGTCCCACTAAAA
ATGCGAACGTTCGAGATTTCTCGGATAAAATCTCAATAATTTCTGTAGTG
CTGCTGCTGGCCGCAAGTGGGATCATTTCCAACAAATTGTATTACATTAA
TCCTTTACAATGTTACACAGCCGTTCATCCGACTGGAGAAAAAATTGACA
AATTCATCAATGCTTACACATGGACTCATGGAACTATTCCGAAATCGGCG
TTTTCCAATCAGCTTCCTGAAACAAAAGCACAATGGATTGATGTATATGA
CAAATATGGGATTCAATATTACCAATGGATCCCGTTTATTTTGATCTTAC
AAGCTGCCATGCTGTATTTGCCGATTCTACTTTGGGATCATTGTTGCTCC
TTCGCAATGAGAATTGACCTGGTTTCTGTATTCAATGAAGCGAGAAATGC
ATTATATAAAGGCGATGAGGCGAGAAAGAAAAGTATTGAGAAAATATCAA
ATTCATTAGAATTAGTTTTATCAAAAAAAGAAAAGAAAAGCGGATTAATC
GCAAAGATTCGTCGAAAAATTCGTAATTGGATGATCGCTTACACATTTTC
TCAATCACAGAGGAACTTTCTATTTTCCTCATACATTGGATTAAAGGTTT
TGTCATTGGTCATGTGCATGATTGAAATTGCGATGCTCCATTTCATGTTC
AACATCAATTTGATCTCGATGATTTCATATTTCCAAGGAGCTCCCAATGA
CATATCATTGTCATTCCCGATCGAGACATACGGGTTGCTGAGTGATCTTC
GGGTTCTCGGAGCTGATAACATTTACTACAGCGAATGCCGATTGACAGTC
AACATGATCAATGAGAAATTATTCGTCATGATTTGGATTGGATTAGTAGT
GATTGGGATTTTACAGTTGATCTCATTGTTGATCTGGATCAGCCGAGTGA
AAGTGTTTTACAGGCAGATGAGAACAATCAAAAAAGTCTTCAAAATTAAA
GGCATTGAAATTCCAGACTCAAAATTGCTGAAAGAATTTGTGTGTGAATT
TCTTAAAACCGATGGAATATTTCTGATAAACATGTTGGAAAGAAACGCTG
GAGATTTAGTTTCAACGGATGTTGTGTATGAATTGTGGTTGAAATATTCG
ACTAATTTACTTTTCTTGGAGTGATTATTTGTGGATATTTCTTCCGCATA
AATATTATGAGTAATGCTATTGGTTGAAATTGAGATTTGTGCGCATTCCA
ATAAAATTCAAAGCTAGTCAAATTGTAAATTGGGAAAAGCACATCAATGA
TCTCTGGAAAGCAAAGTTTTTTGAAAATTTCGAGATAAAATGAATTTTAA
CACATTGTGATCGGGCAGTTTTCGGCCGCGTACTAGTGCTGGTAACGAGT
GATTTTTCGCGTAACGTAGACCTCTAGAAAAATTGCGATAACTTCAAAAA
TATTGGAACCCGCATTTCTACGTGACCCGCGCTCCACTAACAATCTATCA
AAAACGTATAAATACGTGATACGCTCTCTAGCATTAATTTGCTAAACACG
TATTAATACGTGATCCGATTACAATGTGTTAATAAAATCGTTGCCAG
back to top

protein sequence of SMED30003965-orf-1

>SMED30003965-orf-1 ID=SMED30003965-orf-1|Name=SMED30003965-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=390bp
MDQYLKNSDNFSPTKNANVRDFSDKISIISVVLLLAASGIISNKLYYINP
LQCYTAVHPTGEKIDKFINAYTWTHGTIPKSAFSNQLPETKAQWIDVYDK
YGIQYYQWIPFILILQAAMLYLPILLWDHCCSFAMRIDLVSVFNEARNAL
YKGDEARKKSIEKISNSLELVLSKKEKKSGLIAKIRRKIRNWMIAYTFSQ
SQRNFLFSSYIGLKVLSLVMCMIEIAMLHFMFNINLISMISYFQGAPNDI
SLSFPIETYGLLSDLRVLGADNIYYSECRLTVNMINEKLFVMIWIGLVVI
GILQLISLLIWISRVKVFYRQMRTIKKVFKIKGIEIPDSKLLKEFVCEFL
KTDGIFLINMLERNAGDLVSTDVVYELWLKYSTNLLFLE*
back to top

protein sequence of SMED30003965-orf-2

>SMED30003965-orf-2 ID=SMED30003965-orf-2|Name=SMED30003965-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=686bp
MDDHNVFLTINDNQSMHDEDMVVISEETLDMNTLQSLFASGNVQTLSNDD
EIIQVSDSGIISDTIVQLEGESYHVISDENGQTYLAPTNQTGSSGNIAVA
QTIDNNGITYRCPSCPQSYQNANAFTKHMREKHFVKVYTCRQCEQFYETL
SQLFLHARRTHVDPKKPKKNPGNYKFHCPDCNYMTNNGGTMEHHRRAHTG
VKPFSCDICGKHFAQKANMKTHKNRHIHKDRIFRCETCGKAFNSYDIYLA
HLRTREHELREHFQMIASSKLILGCMGCNNTFDSMFNLNKHTRSCGILKQ
METKFCCKSCDSYFSDIMTLKSHVKSHEGNQIISCPVCGERGFPGFNQLN
HHITRAHALKVNRRHVCRYCESTFESKKDLDGHISDMHSEERNARQSRGA
VGRLRCRYTNCDFTSNSVMLMDRHHRQHTLQGTNGNYALTLPQSRYSKYN
KRRKIREAKKQEDYDDAELLDEEIERVNASLEANEILRYPTLLDEDDDEE
EEDEEGIDNEDVEDDDDLKNKHDVYHHDEVNDMQQLADSLNLSAENLLPI
RSKSEILSKKQLHQSLVRVKTEHVVNVQAKTSTPKPPRQKKIETQIYTAS
INNINHSSNNHSNNSIESNNLTSGRSRKKPWWYKDYDTTDMMLEEGETAR
HASSSSSVGRNKSAAAYDTNNDALINDTEEWNIDM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
IPR000990Innexin
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005921gap junction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 305..327
e-value: 2.1
score: 17.3
coord: 333..357
e-value: 1.6
score: 17.8
coord: 404..428
e-value: 1.0
score: 18.4
coord: 273..293
e-value: 250.0
score: 1.0
coord: 204..226
e-value: 0.0044
score: 26.3
coord: 110..133
e-value: 8.3E-4
score: 28.6
coord: 233..257
e-value: 0.1
score: 21.7
coord: 176..198
e-value: 0.049
score: 22.8
coord: 138..161
e-value: 0.27
score: 20.3
coord: 365..388
e-value: 0.058
score: 22.5
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 110..133
e-value: 0.0054
score: 17.1
coord: 204..226
e-value: 0.0017
score: 18.7
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 367..388
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 306..327
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 206..228
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 112..133
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 235..257
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 140..161
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 138..166
score: 10.429
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 110..133
score: 9.411
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 233..262
score: 10.346
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 204..231
score: 11.448
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 365..393
score: 10.18
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 305..332
score: 10.346
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 176..203
score: 11.448
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 175..204
e-value: 1.5E-5
score: 26.7
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 328..403
e-value: 3.1E-8
score: 35.7
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 256..327
e-value: 1.4E-5
score: 26.9
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 205..255
e-value: 6.1E-12
score: 47.8
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 88..164
e-value: 8.8E-9
score: 37.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 488..517
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 492..514
NoneNo IPR availablePANTHERPTHR24377:SF856SI:DKEY-111K8.2-RELATEDcoord: 89..293
coord: 168..429
NoneNo IPR availablePANTHERPTHR24377FAMILY NOT NAMEDcoord: 89..293
coord: 168..429
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 108..156
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 191..242
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 302..342