Granulin b

NameGranulin b
Smed IDSMED30003962
Length (bp)1344
Neoblast Clusters

Zeng et. al., 2018

▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population





Single cell RNA-seq of pluripotent neoblasts and its early progenies

We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)

Explore this single cell expression dataset with our NB Cluster Shiny App


Neoblast Population


t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.

Expression of Granulin b (SMED30003962) t-SNE clustered cells

Violin plots show distribution of expression levels for Granulin b (SMED30003962) in cells (dots) of each of the 12 neoblast clusters.


back to top


Sub-lethal Irradiated Surviving X1 and X2 Cell Population


t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Granulin b (SMED30003962) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Granulin b (SMED30003962) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.


back to top


Embryonic Expression

Davies et. al., 2017

Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods


back to top
Anatomical Expression

PAGE et. al., 2020


has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE

PAGE Curations: 19

Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30003962SMESG000018767.1 SMESG000018766.1 SMESG000018762.1 SMESG000018760.1 Contig3866uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003962SMESG000018767.1 SMESG000018766.1 SMESG000018762.1 SMESG000018760.1 Contig3866newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003962SMESG000041898.1 Contig3866uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003962SMESG000041898.1 Contig3866newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30003962SMESG000018760.1 dd_Smed_v4_2701_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30003962SMESG000018760.1 dd_Smed_v4_2701_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003962SMESG000018760.1 dd_Smed_v4_2701_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003962SMESG000018760.1 dd_Smed_v4_2701_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30003962SMESG000018760.1 dd_Smed_v4_2701_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30003962SMESG000018760.1 dd_Smed_v4_2701_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003962SMESG000018767.1 SMESG000018762.1 SMESG000018760.1 dd_Smed_v4_427_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003962SMESG000018767.1 SMESG000018762.1 SMESG000018760.1 dd_Smed_v4_427_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003962SMESG000018767.1 SMESG000018762.1 SMESG000018760.1 dd_Smed_v4_427_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003962SMESG000018767.1 SMESG000018762.1 SMESG000018760.1 dd_Smed_v4_427_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003962SMESG000018767.1 SMESG000018766.1 SMESG000018762.1 SMESG000018760.1 Contig50053uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003962SMESG000018767.1 SMESG000018766.1 SMESG000018762.1 SMESG000018760.1 Contig50053newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
body wall musculatureSMED30003962SMESG000018760.1 dd_Smed_v4_2701_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003962SMESG000018766.1 SMESG000018760.1 SMESG000018767.1 SMESG000018762.1 dd_Smed_v6_427_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30003962SMESG000018766.1 SMESG000018760.1 SMESG000018767.1 SMESG000018762.1 dd_Smed_v6_427_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
BLAST of Granulin b vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 143.665 bits (361), Expect = 5.276e-38
Identity = 101/327 (30.89%), Postives = 138/327 (42.20%), Query Frame = 3
            +CP+ R++C +  TCC+     Y CC   NA CC D  HCCP+ + CD  Q KC+    +  ++   +PA  V D          V    EV CP+  T C+            + CCP   AVCC D   CCP   TCD +   C   PH +  M +   H S        + +            SD  C +T+G  G C      CCSD + CCPQ   C  +      +      EK      +      +  D  T C   +TCC     S+ CC+L +AVCC DR  CCP    C++K  SC +   + +   P TF  RS

HSP 2 Score: 80.1073 bits (196), Expect = 1.061e-15
Identity = 67/237 (28.27%), Postives = 97/237 (40.93%), Query Frame = 3
            TVG++  +    C +  TCC+ +  ++ CC +  AVCC D  HCCP G TCD ++  C +       M K    L +   P    L+  V   +   CP++ T C+ T          + CCP   AVCCSD   CCP+  TC +   +C        +   E++    K       +     +G  Q  S       CP   G    C+     CC D + CCP    C+ K   C

HSP 3 Score: 58.151 bits (139), Expect = 1.311e-8
Identity = 56/216 (25.93%), Postives = 75/216 (34.72%), Query Frame = 3
            ++V C D    CP+ +TC                                                    C + +G+ G C     TCCSD   CCPQ T CD   +KC      +TD  T+   H+     +  V C D E  C    TCC +   ++GCC    AVCC D + CCP    CD +  +C      V        H  L  P+  K

HSP 4 Score: 56.6102 bits (135), Expect = 4.880e-8
Identity = 27/66 (40.91%), Postives = 38/66 (57.58%), Query Frame = 3
            TNR     S+V+CPD  + C    TCC +    YGCC + NA CC+D + CCP +  CD+  + C+
BLAST of Granulin b vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 144.05 bits (362), Expect = 7.296e-37
Identity = 101/327 (30.89%), Postives = 138/327 (42.20%), Query Frame = 3
            +CP+ R++C +  TCC+     Y CC   NA CC D  HCCP+ + CD  Q KC+    +  ++   +PA  V D          V    EV CP+  T C+            + CCP   AVCC D   CCP   TCD +   C   PH +  M +   H S        + +            SD  C +T+G  G C      CCSD + CCPQ   C  +      +      EK      +      +  D  T C   +TCC     S+ CC+L +AVCC DR  CCP    C++K  SC +   + +   P TF  RS

HSP 2 Score: 128.642 bits (322), Expect = 1.697e-31
Identity = 98/317 (30.91%), Postives = 138/317 (43.53%), Query Frame = 3
            S   +VG I CP+ + +C +  TCC     S+ CC    A CC D+ HCCP G+ CD    +C+        + K +PA +             V     VMCP+ +++C D  TCC      Y CCP  NA CCSD   CCP+ T CD+   KC S  ++  ++  +L  H     + +             + S  D Y  C + +G  G C F+   CC D   CCP    CD +   C          +   +    P    L   V  DN + C S +TCC ++   +GCC +  AVCC+D   CCP    C

HSP 3 Score: 103.99 bits (258), Expect = 3.137e-23
Identity = 90/336 (26.79%), Postives = 131/336 (38.99%), Query Frame = 3
            TVG++  +    C +  TCC+ +  ++ CC +  AVCC D  HCCP G TCD ++  C +       M K    L +   P    L+  V   +   CP++ T C+ T          + CCP   AVCCSD   CCP+  TC +   +C        +   E++    K       +     +G  Q  S       CP   G    C+     CC D + CCP    C+ K   C                    +  V C +    C   +TCC  + + + CC     VCCADR  CCP   +C  +   C+   +  R   PL  P   + 

HSP 4 Score: 84.7297 bits (208), Expect = 5.651e-17
Identity = 55/199 (27.64%), Postives = 81/199 (40.70%), Query Frame = 3
            CCP   AV C D + CCP    C    + C                    ++ +    +  +     +    DF   C + +G  G C     +CC D   CCP    CD  + +C   +      K   +  TNR     S+V+CPD  + C    TCC +    YGCC + NA CC+D + CCP +  CD+  + C+

HSP 5 Score: 72.0182 bits (175), Expect = 7.813e-13
Identity = 39/115 (33.91%), Postives = 52/115 (45.22%), Query Frame = 3
             +G S  C F     C D   CCP+   C      C   S +            N +  + CPD++ EC  + TCC + D S+GCC +  A CC DRV CCPH   CD+    C+
BLAST of Granulin b vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 130.954 bits (328), Expect = 6.002e-33
Identity = 103/345 (29.86%), Postives = 146/345 (42.32%), Query Frame = 3
            S   +VG I CP+ + +C +  TCC     S+ CC    A CC D+ HCCP G+ CD    +C+        + K +PA +             V     VMCP+ +++C D  TCC      Y CCP  NA CCSD   CCP+ T CD+   KC S  ++  ++  +L  H     + +             + S  D Y  C + +G  G C F+   CC D   CCP    CD +   C          +   +    P    L   V  DN + C S +TCC  + + + CC     VCCADR  CCP   +C  +   C+   +  R   PL  P   + 

HSP 2 Score: 72.0182 bits (175), Expect = 6.098e-13
Identity = 39/115 (33.91%), Postives = 52/115 (45.22%), Query Frame = 3
             +G S  C F     C D   CCP+   C      C   S +            N +  + CPD++ EC  + TCC + D S+GCC +  A CC DRV CCPH   CD+    C+
BLAST of Granulin b vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 112.849 bits (281), Expect = 1.214e-26
Identity = 91/319 (28.53%), Postives = 126/319 (39.50%), Query Frame = 3
            C+   +C  T   +  CC +  AV C D  HCCP G  C A    C +                           +  N    + CP+++ +C D  TCC+    ++ CCP   AVCC D   CCP   TCD +   C   PH +  M +   H S        + +            SD  C +T+G  G C      CCSD + CCPQ   C  +      +      EK      +      +  D  T C   +TCC     S+ CC+L +AVCC DR  CCP    C++K  SC +   + +   P TF  RS

HSP 2 Score: 105.916 bits (263), Expect = 2.930e-24
Identity = 94/341 (27.57%), Postives = 132/341 (38.71%), Query Frame = 3
            S   +VG I CP+ + +C +  TCC     S+ CC    AVCC D  HCCP G TCD ++  C +       M K    L +   P    L+  V   +   CP++ T C+ T          + CCP   AVCCSD   CCP+  TC +   +C        +   E++    K       +     +G  Q  S       CP   G    C+     CC D + CCP    C+ K   C                    +  V C +    C   +TCC  + + + CC     VCCADR  CCP   +C  +   C+   +  R   PL  P   + 
BLAST of Granulin b vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 66.2402 bits (160), Expect = 5.110e-12
Identity = 34/94 (36.17%), Postives = 45/94 (47.87%), Query Frame = 3
            C D   CCP+   C      C   S +            N +  + CPD++ EC  + TCC + D S+GCC +  A CC DRV CCPH   CD+

HSP 2 Score: 49.6766 bits (117), Expect = 2.356e-6
Identity = 24/57 (42.11%), Postives = 32/57 (56.14%), Query Frame = 3
            S   +VG I CP+ + +C +  TCC     S+ CC    A CC D+ HCCP G+ CD
BLAST of Granulin b vs. Ensembl Celegans
Match: pgrn-1 (ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:Q7JKP2])

HSP 1 Score: 92.4337 bits (228), Expect = 2.019e-20
Identity = 55/136 (40.44%), Postives = 80/136 (58.82%), Query Frame = 3
            +  T+C++ +TCC+   N++ CC   NAVCC D+ HCCP G+TCD +  +C+   + +V M K  PA K  +           N+ +EV+CP+  +KC D  TCC+ +  +Y CCP  NAVCC+D   CCP   TC

HSP 2 Score: 75.485 bits (184), Expect = 9.699e-15
Identity = 50/161 (31.06%), Postives = 73/161 (45.34%), Query Frame = 3
            +H SF +  +  KI+ L+L F               + + S  +  C + +   G C      CC D   CCP  T CD +  +C + + +      K  P       N+ + VVCPD  ++C    TCC +   SYGCC + NAVCCAD + CCP+   C

HSP 3 Score: 59.6918 bits (143), Expect = 1.230e-9
Identity = 34/82 (41.46%), Postives = 46/82 (56.10%), Query Frame = 3
            D ETEC   ETCC + D ++GCC + NAVCC DR  CCP    CD +   C+  +    +H P+   K+   RKT+ + N F

HSP 4 Score: 58.5362 bits (140), Expect = 3.363e-9
Identity = 25/50 (50.00%), Postives = 31/50 (62.00%), Query Frame = 3
            +CP+K +KC +  TCC  +  SY CC   NAVCC D  HCCP G TC  +

HSP 5 Score: 51.9878 bits (123), Expect = 3.940e-7
Identity = 35/114 (30.70%), Postives = 48/114 (42.11%), Query Frame = 3
            N + CCP  NAVCC D+  CCP  TTCD +  +C  +      M ++           F +++        KASK       C +  G  G C      CC+D+  CCP    C
BLAST of Granulin b vs. Ensembl Celegans
Match: pgrn-1 (ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:Q7JKP2])

HSP 1 Score: 91.6633 bits (226), Expect = 4.337e-20
Identity = 55/136 (40.44%), Postives = 80/136 (58.82%), Query Frame = 3
            +  T+C++ +TCC+   N++ CC   NAVCC D+ HCCP G+TCD +  +C+   + +V M K  PA K  +           N+ +EV+CP+  +KC D  TCC+ +  +Y CCP  NAVCC+D   CCP   TC

HSP 2 Score: 75.8702 bits (185), Expect = 8.764e-15
Identity = 47/155 (30.32%), Postives = 68/155 (43.87%), Query Frame = 3
            SF +     ++I L L              + + S  +  C + +   G C      CC D   CCP  T CD +  +C + + +      K  P       N+ + VVCPD  ++C    TCC +   SYGCC + NAVCCAD + CCP+   C

HSP 3 Score: 59.6918 bits (143), Expect = 1.561e-9
Identity = 32/76 (42.11%), Postives = 43/76 (56.58%), Query Frame = 3
            D ETEC   ETCC + D ++GCC + NAVCC DR  CCP    CD +   C+  +    +H P+   K+   RKT+

HSP 4 Score: 57.7658 bits (138), Expect = 6.247e-9
Identity = 25/50 (50.00%), Postives = 31/50 (62.00%), Query Frame = 3
            +CP+K +KC +  TCC  +  SY CC   NAVCC D  HCCP G TC  +

HSP 5 Score: 56.225 bits (134), Expect = 1.760e-8
Identity = 61/239 (25.52%), Postives = 88/239 (36.82%), Query Frame = 3
            N + CCP  NAVCC D+  CCP  TTCD +  +C  +      M ++           F +++        KASK       C +  G  G C      CC+D+  CCP    C      +N     +   F +      P    LS                P+++ +         C +  TCC V  K+      CC L NA+CC +  +CCP    C +    C +     R  F
BLAST of Granulin b vs. Ensembl Celegans
Match: T02B11.8 (pep chromosome:WBcel235:V:877530:878667:-1 gene:WBGene00044776.1 transcript:T02B11.8a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T02B11.8)

HSP 1 Score: 44.669 bits (104), Expect = 8.100e-6
Identity = 21/49 (42.86%), Postives = 26/49 (53.06%), Query Frame = 3
            N+C  KRT +C E   CC   +  Y CC +    CCP   HCCP G +C
BLAST of Granulin b vs. Ensembl Zebrafish
Match: grnb (granulin b [Source:ZFIN;Acc:ZDB-GENE-030131-7393])

HSP 1 Score: 148.673 bits (374), Expect = 2.559e-38
Identity = 113/350 (32.29%), Postives = 162/350 (46.29%), Query Frame = 3
            L W E+  A  +  V   CP+  ++C +  TCCQ     + CC   NAVCC D+ HCCP+G+TCD     CV     +    +   A + +   K  + L A+VN   EV+CP+  +KC +  TCC+ +  +Y CCP   AVCCSD+  CCPE TTCD+ +  C S+ + + EMA ++            K    ++   +    S     C    G    C      CC D   CCP+ T C+   + C     D     S   P   ++ST  + P      D  + C    TCC +S   +GCC L  AVCC D V CCPH   C++   +C   ++S  R   P+ 

HSP 2 Score: 130.568 bits (327), Expect = 3.757e-32
Identity = 105/323 (32.51%), Postives = 149/323 (46.13%), Query Frame = 3
            ICP+    C +  TCC T    Y CC   +A CC D  HCC +G+ CD +  KCV                      KT++L+   KV  K + V+CP+ +++C D  TCC      + CCP KNAVCC D+  CCP+ TTCD+ +  C S+ +      ++      K  E N   + + +   ++        K  +    C +  G  G C      CCSD + CCP+ T CD  ++ C   S +  +E +   P    L     V P NET  C S  TCC   + S+ CC L  AVCC D + CCP    C++  +SC

HSP 3 Score: 124.405 bits (311), Expect = 4.308e-30
Identity = 96/319 (30.09%), Postives = 134/319 (42.01%), Query Frame = 3
            ++ + C    TCC+    S+ CC    AVCC D+ HCCP+G TCD  Q  CV+    ++   +  PAL    +VED    ++ +A+ +  +D+  C  N+                + CCP   AVCC D   CCP   TC+ +   CT   H I            K     +K    LLG +     S   CP       +  G+ G C      CC D   CCPQ   C  +   C   S D        S T  ++  + C D  T C   ++CC ++D ++ CC    AVCC D   CCP   KCD K   C +

HSP 4 Score: 119.013 bits (297), Expect = 2.579e-28
Identity = 110/362 (30.39%), Postives = 152/362 (41.99%), Query Frame = 3
            V  S       +S  + W E+   S K       PNK+    + C    TCC+     + CC    AVCC D  HCCP GS C+     C   + S     V M K IPA+ V  +        K N  +   CP   T CK T         ++ CCP   AVCC+D+  CCP+  TCD+    C  S   +  MA      + + ET   ++    +   Q +   D  C   N  G+ G C      CC D   CCP    C+E+   CT  L+   + T+K+    K S        V C D+ T C S  TCC +    +GCC L  AVCC D   CCP    C ++  +C + +++

HSP 5 Score: 95.9005 bits (237), Expect = 1.109e-20
Identity = 63/216 (29.17%), Postives = 94/216 (43.52%), Query Frame = 3
              Y CCP  +A CCSD   CC + T CD+++ KC +  H +  +         K E     ++      + +       C + +G  G C      CC D + CCPQ T CD  ++ C   +         FD  + K             N +  V+CPD  ++C    TCC +   SYGCC +  AVCC+D+  CCP    CD+  ++C+  N 

HSP 6 Score: 82.8037 bits (203), Expect = 2.120e-16
Identity = 52/139 (37.41%), Postives = 68/139 (48.92%), Query Frame = 3
            C   +G  G C      CCSD   CC Q T CD +++KC   +   D  +   +    +L  VVCPD E+EC    TCC + D  +GCC ++NAVCC DR  CCP    CD+  + CV T           + RR  PL
BLAST of Granulin b vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 129.028 bits (323), Expect = 1.849e-31
Identity = 100/349 (28.65%), Postives = 143/349 (40.97%), Query Frame = 3
            N    C +  TCC+TK   + CC    AVCC D  HCCP G  CD     C   +  +V   + +P   +  +   N   + V+      D V CP+  T CKD          ++ CCP   AVCC D   CCP    C++    C     S+  + +  +H       +     +   G  +    S   C    G  G C FS   CC+D   CCP H KC+  +  C         ++   ++ +P       VV  D ++ C +  TCC +S    GCC    AVCC D+  CCP   +CD++  SCV+T        +  H     P+ S   K +  G  FS

HSP 2 Score: 120.939 bits (302), Expect = 7.749e-29
Identity = 105/355 (29.58%), Postives = 143/355 (40.28%), Query Frame = 3
            +C N  ++C    TCCQ     + CC    AVCC DK HCCPE + CD K  KCV      + M    PA L+ E E      P+T    A+                          +V C N+   C D  TCC TK   + CCP   AVCC D   CCP    CD+    C     S+  + +  +    K +    ++  +S  +     A+ +D    C    G    C      CC D   CCP+  KC+    KC          +  T   +  + +   T + S V C D    C    TCC   D  + CC L  AVCC D + CCPH +KCD+   SC + + +

HSP 3 Score: 117.087 bits (292), Expect = 1.582e-27
Identity = 95/330 (28.79%), Postives = 128/330 (38.79%), Query Frame = 3
            N    C +  TCC+TK   + CC    AVCC D  HCCP G  CD     C      +V   + +P   +  +       + V+      D V CP+  T CKD           + CCP   AVCC D   CCP    C++    C     S+  M +  +    K +    +  S    +     A+  D    C   +G    C      CC D   CCP   KCD     C  +S                     +K SP ++ ++   TV CPD         TCC   D  +GCC L  AVCC D + CCPH +KC++   SC

HSP 4 Score: 114.39 bits (285), Expect = 1.096e-26
Identity = 104/364 (28.57%), Postives = 142/364 (39.01%), Query Frame = 3
            N    C +  TCC+TK   + CC    AVCC D  HCCP G  CD     C      +V   + +P   +  + K  + +      D V C N+   C D  TCC TK  ++ CCP   AVCC D   CCP+   C+I   KC   P    E   +          N        +     A+  D    C   +G    C      CC D   CCP   KCD     C   S      EK    P         T + +S+ +  ++   C    TCC   D  +GCC L  AVCC D + CCPH +KC++   SC + + +       P+   K+ K   T        +  N T+   + S

HSP 5 Score: 102.064 bits (253), Expect = 1.396e-22
Identity = 65/228 (28.51%), Postives = 102/228 (44.74%), Query Frame = 3
              + CCP  +  CC D   CCPE   C +K+  CT++ H+     Q L   +   + +  K   ++  F   AS+SD  CP            + +   G C  + G  CSD + CCP   +C   ++ C                   ++ TV+C +  +EC +  TCC   D  +GCC +  AVCC D++ CCP +  CD+K   CV +++N+       FP R +

HSP 6 Score: 100.908 bits (250), Expect = 3.817e-22
Identity = 91/357 (25.49%), Postives = 134/357 (37.54%), Query Frame = 3
            CPN    C   Q+CCQ     + CC + +  CC D  HCCPEG  C  K   C     +     + +   K  D PK+   I     +E D + CP+  +   +     ++   +Y CCP    + CSD   CCP    C   +  C                          K+ ++L G       +D   C   +G+ G C      CC D   CCP+ T CD K  KC  ++                +++  K K   T                 N+++T+          V  ++   C    TCC   D  + CC L  AVCC D + CCPH +KCD+   SC + + +

HSP 7 Score: 99.3673 bits (246), Expect = 1.071e-21
Identity = 90/327 (27.52%), Postives = 127/327 (38.84%), Query Frame = 3
            R+Q  A+ K      ++  N    C +  TCC+ K   + CC    AVCC D  HCCP G  C+     C   + S   + K+   L+    P       KV       CP + T CK+           + CCP   AVCC+D   CCP    C++ +  C             +I    K          L LG      +   S     C ++   +G C F    CC D + CCP+  +CD +   C   +  + +  +  H  +     +VV  D +      C   ETCC  S  ++GCC    AVCC D   CCP   KC
BLAST of Granulin b vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 125.561 bits (314), Expect = 2.003e-30
Identity = 103/345 (29.86%), Postives = 143/345 (41.45%), Query Frame = 3
            N    C +  TCC+TK   + CC    AVCC D  HCCP G  CD     C      +V   + +P   +  + K  +  A     D V C N+   C D  TCC TK   + CCP   AVCC D   CCP    C++    C     S+  + +  +H       +     +   G  +    S   C    G  G C FS   CC+D   CCP H KC+  +  C         ++   ++ +P       VV  D ++ C +  TCC +S    GCC    AVCC D+  CCP   +CD++  SCV+T        +  H     P+ S   K +  G  FS

HSP 2 Score: 120.939 bits (302), Expect = 7.669e-29
Identity = 105/355 (29.58%), Postives = 143/355 (40.28%), Query Frame = 3
            +C N  ++C    TCCQ     + CC    AVCC DK HCCPE + CD K  KCV      + M    PA L+ E E      P+T    A+                          +V C N+   C D  TCC TK   + CCP   AVCC D   CCP    CD+    C     S+  + +  +    K +    ++  +S  +     A+ +D    C    G    C      CC D   CCP+  KC+    KC          +  T   +  + +   T + S V C D    C    TCC   D  + CC L  AVCC D + CCPH +KCD+   SC + + +

HSP 3 Score: 113.235 bits (282), Expect = 2.548e-26
Identity = 99/329 (30.09%), Postives = 131/329 (39.82%), Query Frame = 3
            A ++    ++  N    C +  TCC+TK   + CC    AVCC D  HCCP G  CD     C      +V   + +P   +  + K  + +      D V C N+   C D  TCC TK  ++ CCP   AVCC D   CCP+   C+I   KC   P    E   +          N        +     A+  D    C   +G    C      CC D   CCP   KCD     C   S               K K + TT   ++   P N+T  C    TCC   D  + CC L  AVCC D + CCPH +KC++   SC

HSP 4 Score: 102.064 bits (253), Expect = 1.215e-22
Identity = 65/228 (28.51%), Postives = 102/228 (44.74%), Query Frame = 3
              + CCP  +  CC D   CCPE   C +K+  CT++ H+     Q L   +   + +  K   ++  F   AS+SD  CP            + +   G C  + G  CSD + CCP   +C   ++ C                   ++ TV+C +  +EC +  TCC   D  +GCC +  AVCC D++ CCP +  CD+K   CV +++N+       FP R +

HSP 5 Score: 101.679 bits (252), Expect = 1.965e-22
Identity = 87/308 (28.25%), Postives = 120/308 (38.96%), Query Frame = 3
            N    C +  TCC+TK   + CC    AVCC D  HCCP G  C+     C   + S   + K+   L+    P       KV       CP + T CK+           + CCP   AVCC+D   CCP    C++ +  C             +I    K          L LG      +   S     C ++   +G C F    CC D + CCP+  +CD +   C   +  + +  +  H  +     +VV  D +      C   ETCC  S  ++GCC    AVCC D   CCP   KC

HSP 6 Score: 100.908 bits (250), Expect = 2.955e-22
Identity = 91/357 (25.49%), Postives = 134/357 (37.54%), Query Frame = 3
            CPN    C   Q+CCQ     + CC + +  CC D  HCCPEG  C  K   C     +     + +   K  D PK+   I     +E D + CP+  +   +     ++   +Y CCP    + CSD   CCP    C   +  C                          K+ ++L G       +D   C   +G+ G C      CC D   CCP+ T CD K  KC  ++                +++  K K   T                 N+++T+          V  ++   C    TCC   D  + CC L  AVCC D + CCPH +KCD+   SC + + +

HSP 7 Score: 77.0258 bits (188), Expect = 1.532e-14
Identity = 66/261 (25.29%), Postives = 100/261 (38.31%), Query Frame = 3
            S  + W E+      + +   G +  N    C E  TCC+     + CC ++ AVCC D  HCCP    C+     C+K         K+  A +    PK ++   K +E+                TCC+   +   CCP   AVCC D+  CCPE   CD++ + C  +     E+ Q L H           +  +  G        +  C  +    G C      CC D++ CCP   KC        +++ D D

HSP 8 Score: 70.0922 bits (170), Expect = 2.517e-12
Identity = 49/161 (30.43%), Postives = 77/161 (47.83%), Query Frame = 3
            VI +      +   + K  +G +  ++++ C+   TCC    +   CC +  AVCCPD+ HCCPEG  CD ++  CVK  +  VE+ +L       ++P+ +++   V       C +        +TCC+T    + CCP   AVCC D   CCP    C
BLAST of Granulin b vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 125.561 bits (314), Expect = 2.547e-30
Identity = 99/349 (28.37%), Postives = 140/349 (40.11%), Query Frame = 3
            N    C +  TCC+TK   + CC    AVCC D  HCCP G  CD     C      +V   + +P   +  +       + V+      D V CP+  T CKD           + CCP   AVCC D   CCP    C++    C     S+  + +  +H       +     +   G  +    S   C    G  G C FS   CC+D   CCP H KC+  +  C         ++   ++ +P       VV  D ++ C +  TCC +S    GCC    AVCC D+  CCP   +CD++  SCV+T        +  H     P+ S   K +  G  FS

HSP 2 Score: 120.939 bits (302), Expect = 8.031e-29
Identity = 105/355 (29.58%), Postives = 143/355 (40.28%), Query Frame = 3
            +C N  ++C    TCCQ     + CC    AVCC DK HCCPE + CD K  KCV      + M    PA L+ E E      P+T    A+                          +V C N+   C D  TCC TK   + CCP   AVCC D   CCP    CD+    C     S+  + +  +    K +    ++  +S  +     A+ +D    C    G    C      CC D   CCP+  KC+    KC          +  T   +  + +   T + S V C D    C    TCC   D  + CC L  AVCC D + CCPH +KCD+   SC + + +

HSP 3 Score: 114.005 bits (284), Expect = 1.444e-26
Identity = 96/329 (29.18%), Postives = 131/329 (39.82%), Query Frame = 3
            A ++    ++  N    C +  TCC+TK   + CC    AVCC D  HCCP G  CD     C      +V   + +P   +    K  +   +V+     +  N+   C D  TCC TK  ++ CCP   AVCC D   CCP+   C+I   KC   P    E   +          N        +     A+  D    C   +G    C      CC D   CCP   KCD     C   S      EK    P         T + +S+ +  ++   C    TCC   D  +GCC L  AVCC D + CCPH +KC++   SC

HSP 4 Score: 102.064 bits (253), Expect = 1.271e-22
Identity = 65/228 (28.51%), Postives = 102/228 (44.74%), Query Frame = 3
              + CCP  +  CC D   CCPE   C +K+  CT++ H+     Q L   +   + +  K   ++  F   AS+SD  CP            + +   G C  + G  CSD + CCP   +C   ++ C                   ++ TV+C +  +EC +  TCC   D  +GCC +  AVCC D++ CCP +  CD+K   CV +++N+       FP R +

HSP 5 Score: 100.908 bits (250), Expect = 3.036e-22
Identity = 91/357 (25.49%), Postives = 134/357 (37.54%), Query Frame = 3
            CPN    C   Q+CCQ     + CC + +  CC D  HCCPEG  C  K   C     +     + +   K  D PK+   I     +E D + CP+  +   +     ++   +Y CCP    + CSD   CCP    C   +  C                          K+ ++L G       +D   C   +G+ G C      CC D   CCP+ T CD K  KC  ++                +++  K K   T                 N+++T+          V  ++   C    TCC   D  + CC L  AVCC D + CCPH +KCD+   SC + + +

HSP 6 Score: 99.3673 bits (246), Expect = 1.128e-21
Identity = 86/308 (27.92%), Postives = 119/308 (38.64%), Query Frame = 3
            N    C +  TCC+ K   + CC    AVCC D  HCCP G  C+     C   + S   + K+   L+    P       KV       CP + T CK+           + CCP   AVCC+D   CCP    C++ +  C             +I    K          L LG      +   S     C ++   +G C F    CC D + CCP+  +CD +   C   +  + +  +  H  +     +VV  D +      C   ETCC  S  ++GCC    AVCC D   CCP   KC

HSP 7 Score: 77.0258 bits (188), Expect = 1.518e-14
Identity = 66/261 (25.29%), Postives = 100/261 (38.31%), Query Frame = 3
            S  + W E+      + +   G +  N    C E  TCC+     + CC ++ AVCC D  HCCP    C+     C+K         K+  A +    PK ++   K +E+                TCC+   +   CCP   AVCC D+  CCPE   CD++ + C  +     E+ Q L H           +  +  G        +  C  +    G C      CC D++ CCP   KC        +++ D D

HSP 8 Score: 70.0922 bits (170), Expect = 2.517e-12
Identity = 49/161 (30.43%), Postives = 77/161 (47.83%), Query Frame = 3
            VI +      +   + K  +G +  ++++ C+   TCC    +   CC +  AVCCPD+ HCCPEG  CD ++  CVK  +  VE+ +L       ++P+ +++   V       C +        +TCC+T    + CCP   AVCC D   CCP    C
BLAST of Granulin b vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 77.0258 bits (188), Expect = 2.809e-15
Identity = 68/231 (29.44%), Postives = 92/231 (39.83%), Query Frame = 3
            N    C +  TCC+TK   + CC    AVCC D  HCCP+G  C+    KC     +   + K  P   V+     N++     +K +V C N+   C D  TCC TK   + CCP   AVCC D   CCP    C++    C     S+  M +  +    K +    +  S          A+  D    C   +G    C      CC D   CCP   KC+     C

HSP 2 Score: 76.2554 bits (186), Expect = 3.867e-15
Identity = 60/209 (28.71%), Postives = 79/209 (37.80%), Query Frame = 3
              ++ CCP   AVCC D   CCP+   C+I   KC   P    E   +          N        +     A+  D    C   +G    C      CC D   CCP   KC+     C   S              +K K + T    ++   P N+T  C    TCC   D  + CC L  AVCC D + CCPH +KC++   SC

HSP 3 Score: 67.0106 bits (162), Expect = 6.534e-12
Identity = 52/150 (34.67%), Postives = 68/150 (45.33%), Query Frame = 3
            N    C +  TCC+TK   + CC    AVCC D  HCCP G  C+     C   + S   M K +P   ++ + K  + +A     D V C N+   C D  TCC TK   + CCP   AVCC D   CCP    C++    C     S+

HSP 4 Score: 57.7658 bits (138), Expect = 5.876e-9
Identity = 47/173 (27.17%), Postives = 67/173 (38.73%), Query Frame = 3
            C    G    C      CC D   CCP+  KC+    KC          +  T   +  + +   T + S V C D    C    TCC   D  + CC L  AVCC D + CCPH +KC++   SC + + +       P+   K+ K   T        +  N T+   + S
BLAST of Granulin b vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 120.168 bits (300), Expect = 1.984e-28
Identity = 102/350 (29.14%), Postives = 148/350 (42.29%), Query Frame = 3
            ASN+  V  +CP+ R++C    TCC  +  +S+ CC    AVCC D  HCCP  S CD +Q +C+        M KL   +K E +      E +V   D   CP+         TCC    + Y CC   +AVCCSD   CCP  TTCD+ +KKC S                   +T    ++  +   +++++         K +  C + +G+ G C      CC+D   CCP+   C +       +S  + T   K    T+    V C D+   C   +TCC ++   +GCC +  AVCC D   CCP          +C      K  H    F K    R+

HSP 2 Score: 109.768 bits (273), Expect = 4.676e-25
Identity = 85/297 (28.62%), Postives = 116/297 (39.06%), Query Frame = 3
            T C +  TCC+   ++Y CC   +AVCC D  HCCP G+TCD    KCV    S    G L+P +    E   N +      K E  C                    + CCP   AVCC+D   CCPE  TC     +C+   HSI    +   L H++   E +                     C + +G  G C  +   CC D   CCP    C     +C     +        +P   + +  V  D+   C   +TCC ++   +GCC +  AVCC D   CCP    C

HSP 3 Score: 105.916 bits (263), Expect = 1.023e-23
Identity = 93/329 (28.27%), Postives = 132/329 (40.12%), Query Frame = 3
            T+++TCC+     + CC    AVCC D  HCCPEG TC   Q +C K  + ++      PAL  E           V   D   CP+ +T C+           ++ CCP   AVCC D   CCP   TC     +C    HSI   ++     + + ET + K            +     C + +G  G C  +   CC D   CCP    C    ++C +         SK      +   V C D+   C   +TCC ++   +GCC +  AVCC+D   CCP    CD +  +CV            + P  +K      DG H

HSP 4 Score: 83.5741 bits (205), Expect = 1.499e-16
Identity = 89/322 (27.64%), Postives = 118/322 (36.65%), Query Frame = 3
             C + QTCC+     + CC  A AVCC D  HCCP G TC   Q       + ++      PALK               +  +V C ++   C D +TCC     ++ CCP   AVCCSD + CCP+  TCD +   C     SI  +         K     F     +             CP   G   RC                 A  C   L +     + C +      L     +T  S  S    RL  V C D++  CF  +TCC      + CC     VCC D V CCP+   C     SC  + S +

HSP 5 Score: 81.2629 bits (199), Expect = 8.217e-16
Identity = 86/293 (29.35%), Postives = 110/293 (37.54%), Query Frame = 3
            +    C + QTCC+     + CC  A AVCC D  HCCP G TC   Q  C K  + ++ +    PAL+ E +         V   D   C + +T C+           ++ CCP   AVCC D   CCP   TC     +C    HSI                 F K  +L    KQKA      D Y        C + +G  G C  +   CCSD   CCPQ   CD +   C L    F        P      T    D+   C S  TCC      + CC +E  

HSP 6 Score: 72.7886 bits (177), Expect = 4.161e-13
Identity = 46/136 (33.82%), Postives = 65/136 (47.79%), Query Frame = 3
             G +  C  + G  C D   CC   + C +  + C               P +N+ S VVCPD  +EC +  TCC +SD  S+GCC +  AVCC D + CCPHN +CD++   C+    + + H P     P R K
BLAST of Granulin b vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 119.783 bits (299), Expect = 2.319e-28
Identity = 102/350 (29.14%), Postives = 148/350 (42.29%), Query Frame = 3
            ASN+  V  +CP+ R++C    TCC  +  +S+ CC    AVCC D  HCCP  S CD +Q +C+        M KL   +K E +      E +V   D   CP+         TCC    + Y CC   +AVCCSD   CCP  TTCD+ +KKC S                   +T    ++  +   +++++         K +  C + +G+ G C      CC+D   CCP+   C +       +S  + T   K    T+    V C D+   C   +TCC ++   +GCC +  AVCC D   CCP          +C      K  H    F K    R+

HSP 2 Score: 109.768 bits (273), Expect = 4.442e-25
Identity = 85/297 (28.62%), Postives = 118/297 (39.73%), Query Frame = 3
            T C +  TCC+   ++Y CC   +AVCC D  HCCP G+TCD    KCV    S    G L+P +    E   N +      K E  C                    + CCP   AVCC+D   CCPE  TC     +C+   HSI    +   L H++   E +                     C + +G  G C  +   CC D   CCP    C     +   +S    ++    +P   + +  V  D+   C   +TCC ++   +GCC +  AVCC D   CCP    C

HSP 3 Score: 105.531 bits (262), Expect = 1.134e-23
Identity = 93/329 (28.27%), Postives = 132/329 (40.12%), Query Frame = 3
            T+++TCC+     + CC    AVCC D  HCCPEG TC   Q +C K  + ++      PAL  E           V   D   CP+ +T C+           ++ CCP   AVCC D   CCP   TC     +C    HSI   ++     + + ET + K            +     C + +G  G C  +   CC D   CCP    C    ++C +         SK      +   V C D+   C   +TCC ++   +GCC +  AVCC+D   CCP    CD +  +CV            + P  +K      DG H

HSP 4 Score: 83.5741 bits (205), Expect = 1.727e-16
Identity = 89/321 (27.73%), Postives = 118/321 (36.76%), Query Frame = 3
            C + QTCC+     + CC  A AVCC D  HCCP G TC   Q       + ++      PALK               +  +V C ++   C D +TCC     ++ CCP   AVCCSD + CCP+  TCD +   C     SI  +         K     F     +             CP   G   RC                 A  C   L +     + C +      L     +T  S  S    RL  V C D++  CF  +TCC      + CC     VCC D V CCP+   C     SC  + S +

HSP 5 Score: 81.2629 bits (199), Expect = 9.375e-16
Identity = 86/288 (29.86%), Postives = 109/288 (37.85%), Query Frame = 3
            C + QTCC+     + CC  A AVCC D  HCCP G TC   Q  C K  + ++ +    PAL+ E +         V   D   C + +T C+           ++ CCP   AVCC D   CCP   TC     +C    HSI                 F K  +L    KQKA      D Y        C + +G  G C  +   CCSD   CCPQ   CD +   C L    F        P      T    D+   C S  TCC      + CC +E  

HSP 6 Score: 72.7886 bits (177), Expect = 4.334e-13
Identity = 46/136 (33.82%), Postives = 65/136 (47.79%), Query Frame = 3
             G +  C  + G  C D   CC   + C +  + C               P +N+ S VVCPD  +EC +  TCC +SD  S+GCC +  AVCC D + CCPHN +CD++   C+    + + H P     P R K
BLAST of Granulin b vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 117.087 bits (292), Expect = 2.029e-27
Identity = 98/347 (28.24%), Postives = 146/347 (42.07%), Query Frame = 3
            ASN+  V  +CP+ R++C    TCC  +  +S+ CC    AVCC D  HCCP  S CD +Q +C+        M KL   +K E      +   E +V   D   CP+         TCC    + Y CC   +AVCCSD   CCP  TTCD+ +KKC S                   +T    ++  +   +++++      +   CP       +++ + G C ++   CC D   CCP    C   +     +S  +  +       T R+      D+   C   ETCC +    +GCC +  AVCC D + CCP    C     S +E +       P+ F

HSP 2 Score: 107.842 bits (268), Expect = 2.332e-24
Identity = 92/335 (27.46%), Postives = 128/335 (38.21%), Query Frame = 3
            T C +  TCC+   ++Y CC   +AVCC D  HCCP G+TCD    KCV    S    G L+P +    E   N +           CP+  T C  +          + CCP+  AVCC D   CCP   TC      C  + HSI  M + L            K   +         + +  C + +G+ G C      CC+D   CCP+   C +       +S  + T+               P  +    V C D+   C   +TCC ++   +GCC +  AVCC D   CCP          +C      K  H    F K    R+

HSP 3 Score: 93.5893 bits (231), Expect = 9.943e-20
Identity = 89/346 (25.72%), Postives = 126/346 (36.42%), Query Frame = 3
            Q  A  +E+   +  +  T C ++ TCC      + CC YA AVCC D  HCCP G TC      CV    S   M K +            +   +V   D   CP  +T C+            + CCP   AVCC+D   CCPE  TC     +C+   HSI    +  +     + +     I  ++   +     D Y        C + +G  G C  +   CC D   CCP    C     +   +S    ++                     P     S  +CP         D+   C   +TCC ++   +GCC +  AVCC D   CCP    C

HSP 4 Score: 92.4337 bits (228), Expect = 2.400e-19
Identity = 83/311 (26.69%), Postives = 125/311 (40.19%), Query Frame = 3
            + C +  +C  T      CC  A    C D  HCC  GS C    H C+                     P +N        +  V+CP+ +++C    TC  ++  +++ CCP   AVCC D   CCP  + CD++  +C S+   I  M++       + ++   K++ L    ++       +CP         +   G C   +  CCSD   CCP  T CD  + KC   + +        +      + V C D  T C    TCC +S + +GCC    AVCC D + CCP    C     SCV

HSP 5 Score: 92.0485 bits (227), Expect = 3.345e-19
Identity = 103/371 (27.76%), Postives = 142/371 (38.27%), Query Frame = 3
            +    C + QTCC+     + CC  A AVCC D  HCCP G TC   Q  C K  + ++ +    PAL+ E         DE   P   +    +   +    V C ++   C D +TCC     ++ CCP   AVCC D   CCP   TC     +C    HSI                 F K  +L    KQKA      D Y        C + +G  G C  +   CC D   CCP    C     +   +S  + ++             ++P       +V  D+   C    TCC +    +GCC +E AVCC+D   CCP    CD +  +CV            + P  +K      DG H

HSP 6 Score: 90.1225 bits (222), Expect = 1.308e-18
Identity = 103/366 (28.14%), Postives = 131/366 (35.79%), Query Frame = 3
            C + QTCC+     + CC  A AVCC D  HCCP G TC   Q       + ++      PALK               +  +V C ++   C D +TCC     ++ CCP   AVCC D   CCP   TC     +C    HSI        + QE   +      N F   I+     F  K    D Y  C + +G  G C      CCSD   CCPQ   CD +   C L            +  FD                                      T  S  S    RL  V C D++  CF  +TCC      + CC     VCC D V CCP+   C     SC  + S +

HSP 7 Score: 72.7886 bits (177), Expect = 5.736e-13
Identity = 45/142 (31.69%), Postives = 67/142 (47.18%), Query Frame = 3
            G +  C  + G  C D   CC   + C +  + C               P +N+ S VVCPD  +EC +  TCC +SD  S+GCC +  AVCC D + CCPHN +CD++   C+    +      L    +S+  K +  G+
BLAST of Granulin b vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 115.546 bits (288), Expect = 6.262e-27
Identity = 94/325 (28.92%), Postives = 139/325 (42.77%), Query Frame = 3
            ASN+  V  +CP+ R++C    TCC  +  +S+ CC    AVCC D  HCCP  S CD +Q +C+        M KL   +K E      +   E +V   D   CP+         TCC    + Y CC   +AVCCSD   CCP  TTCD+ +KKC S                   +T    ++  +   +++++      +   CP       +++ + G C ++   CC D   CCP    C   +     +S  +  +       T R+      D+   C   ETCC +    +GCC +  AVCC D + CCP    C

HSP 2 Score: 110.538 bits (275), Expect = 2.984e-25
Identity = 93/325 (28.62%), Postives = 128/325 (39.38%), Query Frame = 3
            T C +  TCC+   ++Y CC   +AVCC D  HCCP G+TCD    KCV    S    G L+P +    E   N +           CP+  T C  +          + CCP+  AVCC D   CCP   TC      C  + HSI  M + L            K   +         + +  C + +G+ G C      CC+D   CCP+   C +       +S  + T   K    T+    V C D+   C   +TCC ++   +GCC +  AVCC D   CCP          +C      K  H    F K    R+

HSP 3 Score: 98.9821 bits (245), Expect = 2.088e-21
Identity = 87/315 (27.62%), Postives = 123/315 (39.05%), Query Frame = 3
            Q  A  +E+   +  +  T C ++ TCC      + CC YA AVCC D  HCCP G TC      CV    S   M K +            +   +V   D   CP  +T C+            + CCP   AVCC+D   CCPE  TC     +C+   HSI    +   L H++   E +                     C + +G  G C  +   CC D   CCP    C     +   +S    ++    +P   + +  V  D+   C   +TCC ++   +GCC +  AVCC D   CCP    C

HSP 4 Score: 92.4337 bits (228), Expect = 2.663e-19
Identity = 89/338 (26.33%), Postives = 131/338 (38.76%), Query Frame = 3
            + C +  +C  T      CC  A    C D  HCC  GS C    H C+                     P +N        +  V+CP+ +++C    TC  ++  +++ CCP   AVCC D   CCP  + CD++  +C S+   I  M++       + ++   K++ L    ++       +CP         +   G C   +  CCSD   CCP  T CD  + KC   + +        +      + V C D  T C    TCC +S + +GCC    AVCC D + CCP    C     SCV           L        RKTL  G

HSP 5 Score: 72.7886 bits (177), Expect = 5.039e-13
Identity = 45/143 (31.47%), Postives = 67/143 (46.85%), Query Frame = 3
             G +  C  + G  C D   CC   + C +  + C               P +N+ S VVCPD  +EC +  TCC +SD  S+GCC +  AVCC D + CCPHN +CD++   C+    +      L    +S+  K +  G+

HSP 6 Score: 65.855 bits (159), Expect = 8.665e-11
Identity = 87/330 (26.36%), Postives = 119/330 (36.06%), Query Frame = 3
            C + QTCC+     + CC  A AVCC D  HCCP G TC   Q       + ++      PALK               +  +V C ++   C D +TCC     ++ CCP   AVCC D   CCP   TC     +C    HSI   ++     + K E N  K           A K  + C         C+  +G     +  CCP    C        L          K  P+   L+   C   +    S +  C     ++ C     AVCC+D   CCP    CD +  +CV            + P  +K      DG H
BLAST of Granulin b vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 122.865 bits (307), Expect = 9.793e-30
Identity = 99/325 (30.46%), Postives = 139/325 (42.77%), Query Frame = 3
            F  +   +G + CP  + +C +  TCC     S+ CC    A CC D+ HCCP G++CD    +CV    ++  + K  PA K             V+    V+CP+ KT+C D  TCC      Y CCP  NA+CCSD   CCP+ T CD+   KC S                  Y T+   +++ L G+  K  K D           C +  G  G C F+   CC D   CCP   +C  +   C +        K   +P        L +    D+ T C +  TCC ++   +GCC +  AVCC+D   CCP    C

HSP 2 Score: 119.398 bits (298), Expect = 1.416e-28
Identity = 91/308 (29.55%), Postives = 131/308 (42.53%), Query Frame = 3
            +CP+ +T+C +  TCC+     Y CC   NA+CC D  HCCP+ + CD  Q KC+    +   + KL         P   + E K +   EV CP   T C+            + CCP   AVCC D   CCP    C  +   C      +  M +++I      +    K  +    F  +   ++  C + +G  G C      CCSD + CCPQ   C  +      ++     EK     TT      +  D  T C   +TCC     S+ CC+L +AVCC DR  CCP    C++K  +C

HSP 3 Score: 107.071 bits (266), Expect = 2.305e-24
Identity = 89/327 (27.22%), Postives = 133/327 (40.67%), Query Frame = 3
            C    +C  T   +  CC ++  V C D +HCCP+G  C A    C                            +   N    V CP ++ +C D+ TCCI    ++ CCP   A CC D+  CCP   +CD+ + +C  SP   H + ++          +  F ++      K +       C +  G+ G C      CCSD   CCPQ T CD   +KC   S ++ T+     P    +  V C D E  C    TCC ++  ++GCC    AVCC D + CCP   +C  +  +C    ++    K+   PL  P     +

HSP 4 Score: 100.138 bits (248), Expect = 3.887e-22
Identity = 85/316 (26.90%), Postives = 119/316 (37.66%), Query Frame = 3
            +    C E  TCC+    ++ CC +A AVCC D  HCCP G  C  ++  C         M K+I  L++ D     IL++     D   CP N T CK           ++ CCP   AVCCSD   CCP+  TC +    C      +  + +         +T   +I  +              CP   G    C+     CC D + CCP    C+ K   C     DF  +         ++  V C +    C   +TCC  S   + CC     VCC D   CCP    C  +   C+     +   F

HSP 5 Score: 67.781 bits (164), Expect = 1.268e-11
Identity = 49/149 (32.89%), Postives = 71/149 (47.65%), Query Frame = 3
            +G+I  ++ T C   QTCC +   S+ CC+  +AVCC D+ HCCP G TC+ K   C K      ++  + P + +   PK   +E          C +N+T CKD+          + CCP+   VCC D   CCP    C  +  KC
BLAST of Granulin b vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 75.485 bits (184), Expect = 3.345e-15
Identity = 48/136 (35.29%), Postives = 59/136 (43.38%), Query Frame = 3
            + + C +T +G S  C FS G  C D   CCPQ   C      C   S              N L  V CP ++ EC    TCC + D S+GCC +  A CC DRV CCPH   CD+    CV         + FP

HSP 2 Score: 57.3806 bits (137), Expect = 4.955e-9
Identity = 43/152 (28.29%), Postives = 65/152 (42.76%), Query Frame = 3
            C    +C  T   +  CC ++  V C D +HCCP+G  C A    C                 ++ D P              V CP ++ +C D+ TCCI    ++ CCP   A CC D+  CCP   +CD+ + +C  SP   H + ++ 

HSP 3 Score: 53.9138 bits (128), Expect = 7.499e-8
Identity = 41/151 (27.15%), Postives = 56/151 (37.09%), Query Frame = 3
            CCP    V C D Y CCP+   C    K C                  F+   N    +    G + +   S   C + +G  G C     +CC D   CCP    CD  + +C   +      K   +  TNR      +VVCPD +T+C

HSP 4 Score: 53.1434 bits (126), Expect = 1.314e-7
Identity = 32/107 (29.91%), Postives = 49/107 (45.79%), Query Frame = 3
            F  +   +G + CP  + +C +  TCC     S+ CC    A CC D+ HCCP G++CD    +CV    ++  + K  PA K             V+    V+CP+
BLAST of Granulin b vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 67.781 bits (164), Expect = 2.544e-12
Identity = 49/149 (32.89%), Postives = 71/149 (47.65%), Query Frame = 3
            +G+I  ++ T C   QTCC +   S+ CC+  +AVCC D+ HCCP G TC+ K   C K      ++  + P + +   PK   +E          C +N+T CKD+          + CCP+   VCC D   CCP    C  +  KC

HSP 2 Score: 50.447 bits (119), Expect = 1.525e-6
Identity = 36/112 (32.14%), Postives = 46/112 (41.07%), Query Frame = 3
            T C   T+C   N  C LNS D+                    EK     TT      +  D  T C   +TCC     S+ CC+L +AVCC DR  CCP    C++K  +C

HSP 3 Score: 48.1358 bits (113), Expect = 8.290e-6
Identity = 24/59 (40.68%), Postives = 32/59 (54.24%), Query Frame = 3
            VGN+   +   C + QTCC+     + CC Y   VCC D  HCCP G  C A+  KC++
BLAST of Granulin b vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 63.5438 bits (153), Expect = 1.404e-10
Identity = 46/142 (32.39%), Postives = 65/142 (45.77%), Query Frame = 3
            T+C    TCC+     + CC    AVCC D  HCCP+G TC A+ +    C K +  +  L  IPA +      T +    +       CP  +T C   K        ++ CC   +AVCC D+  CCP   TC++K + C

HSP 2 Score: 62.3882 bits (150), Expect = 3.315e-10
Identity = 40/118 (33.90%), Postives = 56/118 (47.46%), Query Frame = 3
            C + +G  G C      CCSD + CCPQ   C  +      ++     EK     TT  ++  + C D  T C   +TCC     S+ CC+L +AVCC DR  CCP    C++K  +C

HSP 3 Score: 54.6842 bits (130), Expect = 1.048e-7
Identity = 30/86 (34.88%), Postives = 46/86 (53.49%), Query Frame = 3
            +G+I  ++ T C   QTCC +   S+ CC+  +AVCC D+ HCCP G TC+ K   C K      ++  + P + +   PK   +E
BLAST of Granulin b vs. UniProt/SwissProt
Match: sp|P28799|GRN_HUMAN (Progranulin OS=Homo sapiens OX=9606 GN=GRN PE=1 SV=2)

HSP 1 Score: 144.05 bits (362), Expect = 3.504e-36
Identity = 101/327 (30.89%), Postives = 138/327 (42.20%), Query Frame = 3
            +CP+ R++C +  TCC+     Y CC   NA CC D  HCCP+ + CD  Q KC+    +  ++   +PA  V D          V    EV CP+  T C+            + CCP   AVCC D   CCP   TCD +   C   PH +  M +   H S        + +            SD  C +T+G  G C      CCSD + CCPQ   C  +      +      EK      +      +  D  T C   +TCC     S+ CC+L +AVCC DR  CCP    C++K  SC +   + +   P TF  RS

HSP 2 Score: 128.642 bits (322), Expect = 8.150e-31
Identity = 98/317 (30.91%), Postives = 138/317 (43.53%), Query Frame = 3
            S   +VG I CP+ + +C +  TCC     S+ CC    A CC D+ HCCP G+ CD    +C+        + K +PA +             V     VMCP+ +++C D  TCC      Y CCP  NA CCSD   CCP+ T CD+   KC S  ++  ++  +L  H     + +             + S  D Y  C + +G  G C F+   CC D   CCP    CD +   C          +   +    P    L   V  DN + C S +TCC ++   +GCC +  AVCC+D   CCP    C

HSP 3 Score: 103.99 bits (258), Expect = 1.506e-22
Identity = 90/336 (26.79%), Postives = 131/336 (38.99%), Query Frame = 3
            TVG++  +    C +  TCC+ +  ++ CC +  AVCC D  HCCP G TCD ++  C +       M K    L +   P    L+  V   +   CP++ T C+ T          + CCP   AVCCSD   CCP+  TC +   +C        +   E++    K       +     +G  Q  S       CP   G    C+     CC D + CCP    C+ K   C                    +  V C +    C   +TCC  + + + CC     VCCADR  CCP   +C  +   C+   +  R   PL  P   + 

HSP 4 Score: 84.7297 bits (208), Expect = 2.714e-16
Identity = 55/199 (27.64%), Postives = 81/199 (40.70%), Query Frame = 3
            CCP   AV C D + CCP    C    + C                    ++ +    +  +     +    DF   C + +G  G C     +CC D   CCP    CD  + +C   +      K   +  TNR     S+V+CPD  + C    TCC +    YGCC + NA CC+D + CCP +  CD+  + C+

HSP 5 Score: 72.0182 bits (175), Expect = 3.752e-12
Identity = 39/115 (33.91%), Postives = 52/115 (45.22%), Query Frame = 3
             +G S  C F     C D   CCP+   C      C   S +            N +  + CPD++ EC  + TCC + D S+GCC +  A CC DRV CCPH   CD+    C+
BLAST of Granulin b vs. UniProt/SwissProt
Match: sp|P23785|GRN_RAT (Progranulin OS=Rattus norvegicus OX=10116 GN=Grn PE=1 SV=3)

HSP 1 Score: 128.257 bits (321), Expect = 8.860e-31
Identity = 102/306 (33.33%), Postives = 134/306 (43.79%), Query Frame = 3
            CP  + +C +  TCC     S+ CC    A CC D+ HCCP G++CD    +C+    ++       P LK     +TN   A  +    V+CP+ KT+C D  TCC      Y CCP  NA+CCSD   CCP+ T CD+   KC S      +   +L+     Y  N  K          + S  D Y  C +  G  G C F+   CC D   CCP   +C  +   C L        K    S   P    L   V  D+ + C S  TCC +S   +GCC +  AVCC D   CCP   KC

HSP 2 Score: 124.79 bits (312), Expect = 1.693e-29
Identity = 100/339 (29.50%), Postives = 140/339 (41.30%), Query Frame = 3
            +CP+ +T+C +  TCC+     Y CC   NA+CC D  HCCP+ + CD  Q KC+    +   M KL         P   + E K +   EV CP+  T C+            + CCP   AVCC D   CCP    C  +   C      +  M +     S   +    K       F    S ++  C +++G  G C      CC D + CCPQ  KC ++      +      EK     TT      +  D  T C   +TCC     S+ CC+L +AVCC DR  CCP    C++K  +C +   + +    LTF   SK         HF

HSP 3 Score: 108.997 bits (271), Expect = 3.132e-24
Identity = 93/332 (28.01%), Postives = 139/332 (41.87%), Query Frame = 3
            R  C +  +C  T   +  CC ++  V C D  HCCP G  C A    C + + S                    +L A       V CP ++ +C D+ TCCI    ++ CCP   A CC D+  CCP   +CD+ + +C S P   H + ++            F ++      K +       C +  G+ G C      CCSD   CCPQ T CD   +KC   S D+ T+     P    ++ V C D E  C    TCC ++  ++GCC    AVCC D + CCP   +C  +T +C    ++    K+    L+ P     +  +

HSP 4 Score: 90.8929 bits (224), Expect = 3.500e-18
Identity = 77/312 (24.68%), Postives = 117/312 (37.50%), Query Frame = 3
            +    C +  TCC+    ++ CC +  AVCC D  HCCP G  C  +   C         M K+  +L +   P   IL+  V   D   CP+N T C+ +         ++ CCP   AVCC D   CCP+   C +    C      +  + +  +      +T   +   +              CP   G    C+     CC D + CCP    C+ K   C  ++     + S      +++  V C      C   ++CC  S   + CC     VCC D   CCP    C  K   C+   + +

HSP 5 Score: 75.0998 bits (183), Expect = 4.444e-13
Identity = 68/260 (26.15%), Postives = 108/260 (41.54%), Query Frame = 3
             Q+ W ++  AS    + + + N  P +  + C    TCC+     + CC    AVCC D  HCCP+G  C  + +    C K +    +++  L+     +T +L+   +       CP  +T C   K        ++ CC   +AVCC D+  CCP   TC++K + C     S+ + + +L   S        K+ ++  G       +   C  + G    C +  G CC D R CCP    C  K  KC    T
BLAST of Granulin b vs. UniProt/SwissProt
Match: sp|P28798|GRN_MOUSE (Progranulin OS=Mus musculus OX=10090 GN=Grn PE=1 SV=2)

HSP 1 Score: 122.479 bits (306), Expect = 8.678e-29
Identity = 99/325 (30.46%), Postives = 139/325 (42.77%), Query Frame = 3
            F  +   +G + CP  + +C +  TCC     S+ CC    A CC D+ HCCP G++CD    +CV    ++  + K  PA K             V+    V+CP+ KT+C D  TCC      Y CCP  NA+CCSD   CCP+ T CD+   KC S                  Y T+   +++ L G+  K  K D           C +  G  G C F+   CC D   CCP   +C  +   C +        K   +P        L +    D+ T C +  TCC ++   +GCC +  AVCC+D   CCP    C

HSP 2 Score: 119.398 bits (298), Expect = 1.138e-27
Identity = 91/308 (29.55%), Postives = 131/308 (42.53%), Query Frame = 3
            +CP+ +T+C +  TCC+     Y CC   NA+CC D  HCCP+ + CD  Q KC+    +   + KL         P   + E K +   EV CP   T C+            + CCP   AVCC D   CCP    C  +   C      +  M +++I      +    K  +    F  +   ++  C + +G  G C      CCSD + CCPQ   C  +      ++     EK     TT      +  D  T C   +TCC     S+ CC+L +AVCC DR  CCP    C++K  +C

HSP 3 Score: 106.686 bits (265), Expect = 1.815e-23
Identity = 89/327 (27.22%), Postives = 133/327 (40.67%), Query Frame = 3
            C    +C  T   +  CC ++  V C D +HCCP+G  C A    C                            +   N    V CP ++ +C D+ TCCI    ++ CCP   A CC D+  CCP   +CD+ + +C  SP   H + ++          +  F ++      K +       C +  G+ G C      CCSD   CCPQ T CD   +KC   S ++ T+     P    +  V C D E  C    TCC ++  ++GCC    AVCC D + CCP   +C  +  +C    ++    K+   PL  P     +

HSP 4 Score: 100.138 bits (248), Expect = 3.282e-21
Identity = 85/316 (26.90%), Postives = 119/316 (37.66%), Query Frame = 3
            +    C E  TCC+    ++ CC +A AVCC D  HCCP G  C  ++  C         M K+I  L++ D     IL++     D   CP N T CK           ++ CCP   AVCCSD   CCP+  TC +    C      +  + +         +T   +I  +              CP   G    C+     CC D + CCP    C+ K   C     DF  +         ++  V C +    C   +TCC  S   + CC     VCC D   CCP    C  +   C+     +   F

HSP 5 Score: 67.781 bits (164), Expect = 9.291e-11
Identity = 49/149 (32.89%), Postives = 71/149 (47.65%), Query Frame = 3
            +G+I  ++ T C   QTCC +   S+ CC+  +AVCC D+ HCCP G TC+ K   C K      ++  + P + +   PK   +E          C +N+T CKD+          + CCP+   VCC D   CCP    C  +  KC
BLAST of Granulin b vs. UniProt/SwissProt
Match: sp|P28797|GRN_CAVPO (Progranulin OS=Cavia porcellus OX=10141 GN=GRN PE=1 SV=2)

HSP 1 Score: 110.538 bits (275), Expect = 1.051e-24
Identity = 93/369 (25.20%), Postives = 134/369 (36.31%), Query Frame = 3
            G          ICP+ R++C +  TCC      Y CC   NA+CC D  HCCP+ + CD +Q +C+   K+   + KL P+  V D          V    EV CP  +T C+            + CCP   AVCC D   CCPE   C  +   C       P +    AQ                      + E +  +++S   G        +  C + +G  G C  S G  C                  +C +       + + H  + ++ + V C D    C   +TCC      + CC+L +AVCC D   CCP    C++K  SC +         PL                HF

HSP 2 Score: 106.301 bits (264), Expect = 3.009e-23
Identity = 86/314 (27.39%), Postives = 125/314 (39.81%), Query Frame = 3
            C    +C  T   +  CC ++ A+ C D  HCCP G  C      C++                    P  ++L A      E  CP++ T C            ++ CCP   A CC D+  CCP   +CD+ + +C ++  S H +  +L      Y T       +  G    A  +   CP              + +G  G C      CCSD   CCPQ T CD + ++C L+     T  +K    T  +  V C D E  C   +TCC +    +GCC    AVCC D V CCP   +C  + ++C

HSP 3 Score: 99.7525 bits (247), Expect = 3.869e-21
Identity = 70/234 (29.91%), Postives = 107/234 (45.73%), Query Frame = 3
            CP    +C +  TCC     S+ CC    A CC D+ HCCP G++CD    +CV    S+    KL PA +      E  P  +           V+CP+++++C D  TCC+     Y CCP  NA+CCSD   CCP+ T CD++  +C S        A+ L+      +   + +  +    +    +    C + +G+ G C F    CC D   CCP+  +C  + + C

HSP 4 Score: 86.6557 bits (213), Expect = 8.326e-17
Identity = 62/228 (27.19%), Postives = 92/228 (40.35%), Query Frame = 3
                CCP   A+ C D + CCP    C      C   P  IH                       LLG  Q     +F CP       + +G  G C     +CC D   CCP    CD  + +C   L S    T+          ++ +P  +         ++V+CPD+ ++C    TCC ++   YGCC + NA+CC+D + CCP +  CD++ + C+  N  K

HSP 5 Score: 79.337 bits (194), Expect = 1.907e-14
Identity = 82/347 (23.63%), Postives = 122/347 (35.16%), Query Frame = 3
            TV ++  ++   C E QTCC+ +   + CC +  AVCC D  HCCPEG  C  ++  C +     V   +  PA        +             +                           ++ + C +   C P    C + + +  C  S      MA E   + D    E     ++SL     +G  Q AS       CP   G    C+     CC D + CCP    C+ K   C   +            +T  +  V C D    C   +TCC  S   + CC     VCC D+  CCP    C+ +   CV   S    H+  + P+ +  R  L
BLAST of Granulin b vs. UniProt/SwissProt
Match: sp|Q54QR7|GRN_DICDI (Granulin OS=Dictyostelium discoideum OX=44689 GN=grn PE=3 SV=1)

HSP 1 Score: 50.447 bits (119), Expect = 1.989e-6
Identity = 29/70 (41.43%), Postives = 36/70 (51.43%), Query Frame = 3
            T+KS     T    +V CPD    C +  TCC+ SD SY CC   NA CC+D+  CCP+   C    N C
BLAST of Granulin b vs. TrEMBL
Match: A0A2B4SIQ6 (Granulin OS=Stylophora pistillata OX=50429 GN=GRN PE=4 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 1.048e-47
Identity = 122/369 (33.06%), Postives = 173/369 (46.88%), Query Frame = 3
            +G  S  +  +       K     +CP+ +++C +  TCC+     Y CC Y NAVCC D  HCCP G TCD     C +   S++ M + +PAL  E                 V+CP+ +++C D  TCC      Y CCP+ NAVCCSD   CCP   TCD+    CT    S+  M Q+L   +   E N   ++    G + +    +  C +++G+ G C +    CCSD   CCP    CD     CT  S+    E  +  P   R    S VVCPD E+EC    TCC +S   YGCC L NAVCC+D V CCP+   CD+   +C + +S        + P   K    + + N  +++

HSP 2 Score: 176.407 bits (446), Expect = 4.034e-44
Identity = 114/337 (33.83%), Postives = 161/337 (47.77%), Query Frame = 3
            S  +  +       +     +CP  +++C +  TCC+     Y CC Y NAVCC D+ HCCP G TCD     C +   S++EM + +PA+K E            +    V+CP+ +++C D  TCC      Y CCP  NAVCCSD   CCP   TCD+    CT    SI  M Q+L   +   E N   ++      + +    +  C +++G+ G C +    CCSD   CCP    CD     CT  S+       +  P   R    S VVCP  ++EC    TCC +S   YGCC L NAVCC+D   CCP+   CD+   +C + +S+

HSP 3 Score: 175.637 bits (444), Expect = 7.385e-44
Identity = 115/358 (32.12%), Postives = 163/358 (45.53%), Query Frame = 3
            + +   +KG  S     +        +    +CP+  ++C +  TCC+     Y CC   NAVCC D  HCCP G TCD     C +   S++ M + +PAL  E                 V+CP+ +++C D  TCC      Y CCP+ NAVCCSD   CCP   TCD+    CT    SI  M Q+L   +   E N   ++      + +    +  C +++G+ G C +    CCSD   CCP    CD     CT  S+     +   +    R  S VVCP  ++EC    TCC +S   YGCC   NAVCC+DR  CCP    CD+   +C + +S+      +   KR

HSP 4 Score: 175.252 bits (443), Expect = 9.441e-44
Identity = 118/360 (32.78%), Postives = 165/360 (45.83%), Query Frame = 3
            + +    +G  S  +  +       K     +CP+ +++C +  TCC+     Y CC Y NAVCC D  HCCP G TCD     C +   S++ M + +PAL  E                 V+CP  +++C D  TCC      Y CCP+ NAVCCSD+  CCP   TCD+    CT    SI EM Q++   + K E+    ++      + +       C ++ G+ G C      CCSD   CCP    CD     CT  S+     +K          S VVCPD ++EC    TCC +S   YGCC   NAVCC+D   CCP+   CD+   +C + +S+      L   KR K

HSP 5 Score: 170.629 bits (431), Expect = 3.473e-42
Identity = 114/367 (31.06%), Postives = 160/367 (43.60%), Query Frame = 3
            + +    +G  S  +  +       K     +CP+ +++C +  TCC+     Y CC Y NAVCC D  HCCP G TCD     C +   S++ M + +PALK E             +   V+CP  +++C D  TCC      Y CCP  NAVCCSD   CCP   TCD+    C     SI  +    +H + +  T    +  +L   K+ +       C + +G  G C      CCSD   CCP    CD +  KC  N+          S  S        + CPD    C  +ETCC +SD  +GCC L +AVCC D   CCP   +CD+    CV  N        +  P++ K  + 

HSP 6 Score: 166.007 bits (419), Expect = 1.319e-40
Identity = 117/393 (29.77%), Postives = 177/393 (45.04%), Query Frame = 3
            +IF+ +    +   ++V         ++  +   + A + +  ASN      +CP+  ++C +  TCC+     Y CC    AVCC D  HCCP G TCD     C K   + + + KL PA++            + ++ + V+CP+ +++C D  TCC      Y CCP   AVCCSD   CCP+  TCD+    CT    SI    ++        E+N      +    + +       C +++G+ G C      CCSD   CCP    CD     C+  +T     +    P   R S   +VVCPD E++C    TCC +S   YGCC L NAVCC+D   CCP+   CD+   SC + +S+    +  P    ++S       DG

HSP 7 Score: 164.851 bits (416), Expect = 3.256e-40
Identity = 105/345 (30.43%), Postives = 161/345 (46.67%), Query Frame = 3
            + +    +G  S ++  +             +CP+  ++C +  TCC+     Y CC   NAVCC D  HCCP G TCD     C +   S++ M + + AL  E                 V+CP+ +++C D  TCC      Y CCP+ NAVCCSD   CCP   TCD+    CT    S+  M Q L   + K E +   ++    G + +    +  C +++G+ G C      CCSD + CCP    CD     C   S+   + +   +         +  V+CPD + +C +  TCC V   +YGCC ++NAVCC+D + CCP+   CD++   C++
BLAST of Granulin b vs. TrEMBL
Match: V4ARK5 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_146967 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 7.880e-44
Identity = 109/326 (33.44%), Postives = 158/326 (48.47%), Query Frame = 3
            + W ++  + + +    +CP+++++C +  TCC+     Y CC   NAVCC D+ HCCP G+TCD    KC +   ++V   K           KT+    KV   + V+CP+ +++C D  TCC      Y CCP  NAVCCSD+  CCP  TTCD    KC       +      +  S K  +   K+ +++   +Q +       C ++ G+ G C      CCSD   CCP  T CD    KC            K S  + ++  VVCPD +++C    TCC +S   YGCC L NAVCC+D++ CCP    CD     C

HSP 2 Score: 157.918 bits (398), Expect = 3.784e-40
Identity = 108/323 (33.44%), Postives = 152/323 (47.06%), Query Frame = 3
            C +  TCC+     Y CC   NAVCC D+ HCCP G+TCD    KC +   ++V   K           KT+    KV   + V+CP+ +++C D  TCC      Y CCP  NAVCCSD+  CCP  TTCD    KC       +      +  S K  +   K+ +++   +Q +       C ++ G+ G C      CCSD   CCP  T CD    KC            K S  + ++  VVCPD +++C    TCC +S   YGCC L NAVCC+D++ CCP    CD     C     N++    + + K++  +

HSP 3 Score: 108.997 bits (271), Expect = 2.498e-22
Identity = 81/276 (29.35%), Postives = 128/276 (46.38%), Query Frame = 3
            + W ++  + + +    +CP+++++C +  TCC+     Y CC   NAVCC D+ HCCP G+TCD    KC +   ++V   K           KT+    KV   + V+CP+ +++C D  TCC      Y CCP  NAVCCSD+  CCP  TTCD    KC       +      +  S K  +   K+ +++   +Q +       C ++ G+ G C      CCSD   CCP          KCD ++    + S    ++  K +  + R+
BLAST of Granulin b vs. TrEMBL
Match: A0A1A7X3H3 (Granulin b OS=Iconisemion striatum OX=60296 GN=GRNB PE=4 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.878e-43
Identity = 109/314 (34.71%), Postives = 160/314 (50.96%), Query Frame = 3
            +CP+    C +++TCC+     Y CC   +A CC D  HCC EG+ CD    KCV      V +   +  L  +  P  + L  +V     V+CP+ +++C D  TCC    +++ CCP   AVCC DK  CCPE TTCD+ + KC S       + ++L     +   N   +  +  G K     +   CP+T+G  G C +   TCCSD   CCP +T CD ++  C          +   + +T+    VVCPD ++ C    TCC +S+ +YGCC L  AVCC+D V CCP + +CD+K ++CV    N

HSP 2 Score: 86.2705 bits (212), Expect = 9.146e-15
Identity = 63/182 (34.62%), Postives = 86/182 (47.25%), Query Frame = 3
            ++ SK A+    SF L  +       NK  V  ICP  ++ C +  TCC      Y CC Y +A CC D  HCCP  + CD +   C      + E+  LIP           ++E       +V+CP+ K+ C D  TCC+  +  Y CCP   AVCCSD   CCP  T CD+K+  C  +
BLAST of Granulin b vs. TrEMBL
Match: A0A3P8VPE0 (Granulin b OS=Cynoglossus semilaevis OX=244447 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 4.781e-43
Identity = 113/314 (35.99%), Postives = 152/314 (48.41%), Query Frame = 3
            +CP+    C +R TCC+     Y CC   +A CC D  HCC EG+ CD    KCV    S   + +L           +  L+  V   D+  CP+N        TCC     N+ CCP   AVCC DK+ CCPEATTCDI  +KC S+      M ++L     K  ++   +     G K     S   C +T+G  G C ++   CCSD   CCP HT+CD K   C    T     K   +   +    V CPD +T C    TCC +++ SYGCC + NAVCC+D + CCP    CD++ ++CV T  N

HSP 2 Score: 148.673 bits (374), Expect = 7.263e-35
Identity = 114/362 (31.49%), Postives = 159/362 (43.92%), Query Frame = 3
            +  L W  +  A    +V          +CP     C +  TCCQ    ++ CC    AVCC DK HCCPE +TCD  + KCV  +  +  M + +PAL+ +D     ++         V CP  K+ C D+ TCC+    +Y CCP+  AVCCSD+  CCP  T CD+K   C S+                        I+ LL   K  A  +D  CP              +TNG  G C      CCSD   CCP+ T CD +++ C     +  T  S+ +         +LS    P NE+  C   +TCC      +GCC L  AVCC D + CCPH   C++  ++C +   N

HSP 3 Score: 135.576 bits (340), Expect = 2.357e-30
Identity = 101/318 (31.76%), Postives = 143/318 (44.97%), Query Frame = 3
            S++  V   CP  ++ C +  TCC      Y CC Y  AVCC D+ HCCP  + CD K+  C + A++ V + K +PA+                  ++V CP+ KT C D  TCC   + +Y CCP  NAVCCSD   CCPE T CD+++  C S+  +   MA E+     +         S+        +     C    G  G C      CC D   CCP  T C+   + C   T N+    T   ++ P  +  S     D  T C    TCC  +   + CC L  AVCC D + CCP++  C++K  +

HSP 4 Score: 120.939 bits (302), Expect = 1.427e-25
Identity = 98/330 (29.70%), Postives = 135/330 (40.91%), Query Frame = 3
            T   TCC+     + CC    AVCC D+ HCCP+G  C+  Q  C K     +     +PAL+ E   +   L A++  K   MC +N +  KDT  C + +   + CCP   AVCCSD   CCP   TC+     C+  PH I    +          +    +  +    K   +     C +  G  G C      CC D + CCPQ   C+ K   C          TL+       +S+ S   + +        + +C   ETCC  S   + CC    AVCC+D   CCP    CD +T SC   NSN+         KR  F

HSP 5 Score: 71.633 bits (174), Expect = 1.934e-9
Identity = 68/245 (27.76%), Postives = 101/245 (41.22%), Query Frame = 3
            +  T C +  TCC  +    + CC    AVCC D  HCCP G TC+  +  C +       +      L    EP         +   +V C +NK+ C    TCC      + CCP   AVCC D   CCP+  TC++K   C         H++H++  +++    ++  +   +     G  Q  SKS+  C  +      C      CCSD + CCP    CD +   C+    N   +DT

HSP 6 Score: 64.6994 bits (156), Expect = 3.185e-7
Identity = 49/158 (31.01%), Postives = 72/158 (45.57%), Query Frame = 3
            S  ++V ++  + ++ C    TCC+     + CC    AVCC D  HCCP+G TC+ K   C K  K    +   +  +KV  +P++   E      D+V  P + T             T  + + CCP   AVCCSD   CCP   TCD +   C+
BLAST of Granulin b vs. TrEMBL
Match: A0A3P8VL47 (Granulin b OS=Cynoglossus semilaevis OX=244447 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 5.489e-43
Identity = 113/314 (35.99%), Postives = 152/314 (48.41%), Query Frame = 3
            +CP+    C +R TCC+     Y CC   +A CC D  HCC EG+ CD    KCV    S   + +L           +  L+  V   D+  CP+N        TCC     N+ CCP   AVCC DK+ CCPEATTCDI  +KC S+      M ++L     K  ++   +     G K     S   C +T+G  G C ++   CCSD   CCP HT+CD K   C    T     K   +   +    V CPD +T C    TCC +++ SYGCC + NAVCC+D + CCP    CD++ ++CV T  N

HSP 2 Score: 148.673 bits (374), Expect = 7.516e-35
Identity = 110/334 (32.93%), Postives = 152/334 (45.51%), Query Frame = 3
            +CP     C +  TCCQ    ++ CC    AVCC DK HCCPE +TCD  + KCV  +  +  M + +PAL+ +D     ++         V CP  K+ C D+ TCC+    +Y CCP+  AVCCSD+  CCP  T CD+K   C S+                        I+ LL   K  A  +D  CP              +TNG  G C      CCSD   CCP+ T CD +++ C     +  T  S+ +         +LS    P NE+  C   +TCC      +GCC L  AVCC D + CCPH   C++  ++C +   N

HSP 3 Score: 139.813 bits (351), Expect = 8.311e-32
Identity = 107/340 (31.47%), Postives = 152/340 (44.71%), Query Frame = 3
            S++  V   CP  ++ C +  TCC      Y CC Y  AVCC D+ HCCP  + CD K+  C + A++ V + K +PA+                  ++V CP+ KT C D  TCC   + +Y CCP  NAVCCSD   CCPE T CD+++  C S+  +   MA E+     +         S+        +     C    G  G C      CC D   CCP  T C+   + C   T N+    T   ++ P  +  S     D  T C    TCC  +   + CC L  AVCC D + CCP++  C++K  +C      V + S  ++  PLT 

HSP 4 Score: 130.183 bits (326), Expect = 1.319e-28
Identity = 96/309 (31.07%), Postives = 134/309 (43.37%), Query Frame = 3
            CP+K+T C ++ TCCQ  + SY CC   NAVCC D  HCCPEG+ CD +   CV    + V M   + A  V +     + +A V   + V C +        KTCC  K  ++ CCP   AVCC D   CCP  T C++    C    ++           +F  +++  K              +   C    G    C  +   CC D   CCP  T C+ K   C          +   K SP T ++    C D +T C    TCC  +   + CC L  AVCC+D+  CCP   KC++   +C

HSP 5 Score: 125.176 bits (313), Expect = 5.981e-27
Identity = 103/356 (28.93%), Postives = 147/356 (41.29%), Query Frame = 3
            ++W ++  +     VGN   + +T C    TCC+     + CC    AVCC D+ HCCP+G  C+  Q  C K     +     +PAL+ E   +   L A++  K   MC +N +  KDT  C + +   + CCP   AVCCSD   CCP   TC+     C+  PH I    +          +    +  +    K   +     C +  G  G C      CC D + CCPQ   C+ K   C          TL+       +S+ S   + +        + +C   ETCC  S   + CC    AVCC+D   CCP    CD +T SC   NSN+         KR  F

HSP 6 Score: 115.161 bits (287), Expect = 1.499e-23
Identity = 104/347 (29.97%), Postives = 148/347 (42.65%), Query Frame = 3
            W     A + ++  N C ++ T C    TCC      + CC  A AVCC D  HCCP  +TC+ K   C        S   M KL P  +KV +E          N   + MCP   T CK T          + CCP   AVCCSD+  CCP+   C++  + C   P  +  +   L   + + E    + +SL     +K   S+  CP            + G C      CCSD   CCP    C+     C+       + T+ S +S   + ++ V C DN++ C +  TCC +    +GCC L  AVCC D   CCP    C++KT +C + + N   H
BLAST of Granulin b vs. Ensembl Cavefish
Match: grnb (granulins-like [Source:NCBI gene;Acc:103046308])

HSP 1 Score: 150.984 bits (380), Expect = 4.279e-39
Identity = 106/335 (31.64%), Postives = 156/335 (46.57%), Query Frame = 3
            +CP++ ++C +  TCCQ    S+ CC   NAVCC DK HCCP+G+TCD    KCV     +V + +  PA K  E + + +     + + ++V CP+  + C D  TCC   + +Y CCP   AVCCSD   CCP+ T+CD+ + KC SS  ++ E     +    + +     + S+              C   +G    C      CC D   CCPQ T C        + S D  T     +  PT NR+     P NE     T C    TCC +   ++GCC L  AVCC D + CCP N  C++   +C    S       + + +++

HSP 2 Score: 134.42 bits (337), Expect = 1.784e-33
Identity = 109/316 (34.49%), Postives = 143/316 (45.25%), Query Frame = 3
            ICP+    C +  TCCQT    Y CC   NA CC D  HCC EG+ CD +  KCV      ++    +P        + ++ +A V    E  CP++        TCC     ++ CCP  NAVCC DK  CCP+ TTCD+ + KC SS     P      A +      + ++N   +  S  +    K S        CP+ NG  G C      CCSD   CCPQ T CD  ++KC ++S   +   +  SP      TV   P NE+  C S  TCC   D  + CC L  AVCC D + CCP    C   T

HSP 3 Score: 107.842 bits (268), Expect = 1.155e-24
Identity = 99/350 (28.29%), Postives = 132/350 (37.71%), Query Frame = 3
              + W  +  A++     + C ++ + C    TCC+ K  ++ CC    AVCC D  HCCP+G  CD     C      ++   K  PAL           K   E     +E+K     +  CP + T C   K       N + CCP   AVCC D   CCP + TCD     C      I            K E    +   +  G       S   CP       +T G+ G C      CC D   CCP    CD +   C   ST      +     T+    V+C D  + C   +TCC +SD  + CC  + AVCC D   CCP    CD K   C    S

HSP 4 Score: 105.531 bits (262), Expect = 7.093e-24
Identity = 89/329 (27.05%), Postives = 132/329 (40.12%), Query Frame = 3
            +  T C +  TCC+ +  ++ CC    AVCC D  HCCP  + C+     C   A S       +P   V   P T++  A     +   CP   T C+            + CCP   AVCC D   CCP+   CDI ++ C     P  +    Q  +    +      K I  S +   + K    +   CP  N         + G C      CC D   CCP    CD   N C     +       + + ++ S   + ++ V C D+   C +  TCC ++   +GCC    AVCC D V CCP    CD++  +C+ T++

HSP 5 Score: 99.3673 bits (246), Expect = 6.600e-22
Identity = 68/217 (31.34%), Postives = 97/217 (44.70%), Query Frame = 3
              Y CCP  NA CCSD   CC E T CD+++ KC +  H++  + +  I            +   ++   Q++   D    C + +G  G C      CC D   CCPQ T CD  ++KC    L S             ++   K  +       + V CPD  + C    TCC + + SYGCC +  AVCC+D V CCP    CD+  + CV +N

HSP 6 Score: 97.4413 bits (241), Expect = 3.245e-21
Identity = 97/359 (27.02%), Postives = 139/359 (38.72%), Query Frame = 3
            K TV ++  N+   C    TCC+TK   + CC    AVCC D  HCCP+G+ C   +  CV    ++ ++  L+    VE +P  N +    NEK      CP   T CK            + CCP   AVCC D   CCP  T C++    C S+        Q  +    K         +               C   +G    C      CC D   CCPQ  KCD  +  C                L S    +  +  +   + ++ V      D +T C    TCC +     +GCC L  AVCC D   CCP++  CD   N+C+      + H  + + K+ + + T

HSP 7 Score: 85.8853 bits (211), Expect = 1.898e-17
Identity = 53/146 (36.30%), Postives = 69/146 (47.26%), Query Frame = 3
            C   +G  G C      CCSD   CC + T CD +++KC   +   D          +    VVCPD E+EC    TCC + D S+GCC + NAVCC D++ CCP    CD+  + CV +       RR FP       K RK  N
BLAST of Granulin b vs. Ensembl Cavefish
Match: grnb (granulins-like [Source:NCBI gene;Acc:103046308])

HSP 1 Score: 150.984 bits (380), Expect = 4.279e-39
Identity = 106/335 (31.64%), Postives = 156/335 (46.57%), Query Frame = 3
            +CP++ ++C +  TCCQ    S+ CC   NAVCC DK HCCP+G+TCD    KCV     +V + +  PA K  E + + +     + + ++V CP+  + C D  TCC   + +Y CCP   AVCCSD   CCP+ T+CD+ + KC SS  ++ E     +    + +     + S+              C   +G    C      CC D   CCPQ T C        + S D  T     +  PT NR+     P NE     T C    TCC +   ++GCC L  AVCC D + CCP N  C++   +C    S       + + +++

HSP 2 Score: 134.42 bits (337), Expect = 1.784e-33
Identity = 109/316 (34.49%), Postives = 143/316 (45.25%), Query Frame = 3
            ICP+    C +  TCCQT    Y CC   NA CC D  HCC EG+ CD +  KCV      ++    +P        + ++ +A V    E  CP++        TCC     ++ CCP  NAVCC DK  CCP+ TTCD+ + KC SS     P      A +      + ++N   +  S  +    K S        CP+ NG  G C      CCSD   CCPQ T CD  ++KC ++S   +   +  SP      TV   P NE+  C S  TCC   D  + CC L  AVCC D + CCP    C   T

HSP 3 Score: 107.842 bits (268), Expect = 1.155e-24
Identity = 99/350 (28.29%), Postives = 132/350 (37.71%), Query Frame = 3
              + W  +  A++     + C ++ + C    TCC+ K  ++ CC    AVCC D  HCCP+G  CD     C      ++   K  PAL           K   E     +E+K     +  CP + T C   K       N + CCP   AVCC D   CCP + TCD     C      I            K E    +   +  G       S   CP       +T G+ G C      CC D   CCP    CD +   C   ST      +     T+    V+C D  + C   +TCC +SD  + CC  + AVCC D   CCP    CD K   C    S

HSP 4 Score: 105.531 bits (262), Expect = 7.093e-24
Identity = 89/329 (27.05%), Postives = 132/329 (40.12%), Query Frame = 3
            +  T C +  TCC+ +  ++ CC    AVCC D  HCCP  + C+     C   A S       +P   V   P T++  A     +   CP   T C+            + CCP   AVCC D   CCP+   CDI ++ C     P  +    Q  +    +      K I  S +   + K    +   CP  N         + G C      CC D   CCP    CD   N C     +       + + ++ S   + ++ V C D+   C +  TCC ++   +GCC    AVCC D V CCP    CD++  +C+ T++

HSP 5 Score: 99.3673 bits (246), Expect = 6.600e-22
Identity = 68/217 (31.34%), Postives = 97/217 (44.70%), Query Frame = 3
              Y CCP  NA CCSD   CC E T CD+++ KC +  H++  + +  I            +   ++   Q++   D    C + +G  G C      CC D   CCPQ T CD  ++KC    L S             ++   K  +       + V CPD  + C    TCC + + SYGCC +  AVCC+D V CCP    CD+  + CV +N

HSP 6 Score: 97.4413 bits (241), Expect = 3.245e-21
Identity = 97/359 (27.02%), Postives = 139/359 (38.72%), Query Frame = 3
            K TV ++  N+   C    TCC+TK   + CC    AVCC D  HCCP+G+ C   +  CV    ++ ++  L+    VE +P  N +    NEK      CP   T CK            + CCP   AVCC D   CCP  T C++    C S+        Q  +    K         +               C   +G    C      CC D   CCPQ  KCD  +  C                L S    +  +  +   + ++ V      D +T C    TCC +     +GCC L  AVCC D   CCP++  CD   N+C+      + H  + + K+ + + T

HSP 7 Score: 85.8853 bits (211), Expect = 1.898e-17
Identity = 53/146 (36.30%), Postives = 69/146 (47.26%), Query Frame = 3
            C   +G  G C      CCSD   CC + T CD +++KC   +   D          +    VVCPD E+EC    TCC + D S+GCC + NAVCC D++ CCP    CD+  + CV +       RR FP       K RK  N
BLAST of Granulin b vs. Ensembl Cavefish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 111.694 bits (278), Expect = 7.052e-26
Identity = 102/369 (27.64%), Postives = 143/369 (38.75%), Query Frame = 3
            +CP+  ++C  + TCC T    + CC    AVCC DK HCCPE S C     KCV      + M    PA    D            +PKT+  +     N+   + C             ++   C D  TCC      + CCP   AVCC D   CCP    C++   KC   + S   + ++    I +    ET  F I    +     A+  D    C  + G    C      CC D   CCP   KC+     C   S      K K  P    L + V  ++   C    TCC      + CC L  AVCC D   CCPH +KC++   +C + + +     K    P++  K  K +  +

HSP 2 Score: 100.523 bits (249), Expect = 3.199e-22
Identity = 98/385 (25.45%), Postives = 133/385 (34.55%), Query Frame = 3
            N    C +  TCC+     + CC    AVCC D  HCCP G  C+     C   + S   M K +P            L + V   D V CP+         TCC      + CCP   AVCC D   CCP    C++    C     S+       I        +  K+  +  G    A+         C    G    C    G CC D   CCP    C+ +   C  N+T                                           +  +K++ S        P  N+L+    PD           ++T C +  TCC +S   +GCC L  A CC DR  CCP    CD+ + SCV+T   +    PLT+

HSP 3 Score: 99.7525 bits (247), Expect = 6.143e-22
Identity = 100/399 (25.06%), Postives = 148/399 (37.09%), Query Frame = 3
            ++   +A    G  +     G  CPN++  C ++ TCCQ      Y+CC +    CC D  HCCP G  C      C       + +    P     D   +    + V + + VMCP+  ++C    TCC T    + CCP   AVCC+DK  CCPE + C + + KC SS                               P +   +     + +       F + ++  +      + +D      NG  G   C      CC D   CCP   KC+    KC         L        + K  P T              T  CPD         TCC  S+  + CC L  AVCC D + CCPH +KC++   +C + + +    ++  PL

HSP 4 Score: 85.5001 bits (210), Expect = 2.169e-17
Identity = 93/408 (22.79%), Postives = 143/408 (35.05%), Query Frame = 3
            S  + W ++          ++  N    C +  TCC+     ++CC    AVCC D  HCCP G  C+     C      +V   K +P+  +  +  PK        A    +DE  C  N                 + CCP    VCC D+  CCP   TC+++    +K  TS P +    A                                 +   K +T+  K   ++  + + A++S                         C I+ G+ G C     TCC D   CCP+   CD  +  C + +     E      T  R   + C      C   ETCC  S  ++GCC    AVCC+D   CCP    C+    SC +       ++ + F ++ +

HSP 5 Score: 79.337 bits (194), Expect = 2.609e-15
Identity = 50/143 (34.97%), Postives = 69/143 (48.25%), Query Frame = 3
            +++G    C F  G CC D   CCP    C      C +N   F       D E S  S +   +   V+CPD  +EC    TCC  +D  +GCC +  AVCCAD+V CCP N  C + ++ CV +++NK       FP R +
BLAST of Granulin b vs. Ensembl Cavefish
Match: ENSAMXT00000029960.1 (pep primary_assembly:Astyanax_mexicanus-2.0:23:26786284:26792241:-1 gene:ENSAMXG00000014237.2 transcript:ENSAMXT00000029960.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.686 bits (265), Expect = 6.231e-25
Identity = 101/368 (27.45%), Postives = 147/368 (39.95%), Query Frame = 3
            L     G  S+  T    CP+  T C +  TCC T    Y CC   NAVCCP + +CCP+G  CD    +   C K  +    +   L+      E++P T+++E   +    V C ++   C D  TCC T +  + CCP+    CC D   CCP    CD  + +C     SI   + +   LI +  K  E    K  + ++     +S      S + CP          GR   C ++ G CC D   CCP    CD  + +CTL +    +               E+++  P    +      S +V  D+   C    TCC      + CC      CC D + CCPH   CD  +  C 

HSP 2 Score: 97.0561 bits (240), Expect = 1.114e-21
Identity = 74/260 (28.46%), Postives = 112/260 (43.08%), Query Frame = 3
            C +  TCC+T +  + CC Y    CC D  HCCP G  CD+   +C++ A S +      PA+ +          E++P   ++E   +    V C ++   C D  TCC T +  + CCP+    CC D   CCP    CD  + +CT    SI   +Q+   LI +    E    K ++ L+     +S      S + CP          GR   C ++ G CC D   CCP    CD  + +CTL +    +   +

HSP 3 Score: 49.6766 bits (117), Expect = 4.266e-6
Identity = 35/133 (26.32%), Postives = 58/133 (43.61%), Query Frame = 3
            S S    L  L++  S      +I  Q A  E   +  A+  E   +  P    +    C +  TCC+T +  + CC Y    CC D  HCCP G  CD+   +C   A S +      PA+ ++++  ++++

HSP 4 Score: 48.9062 bits (115), Expect = 6.070e-6
Identity = 42/175 (24.00%), Postives = 64/175 (36.57%), Query Frame = 3
            +I +L+        SD  CP            +T+     C      CC     CCPQ  KCD  + + C      +           E+++  P+T+ +      S +V  D+   C    TCC      + CC      CC D + CCPH   CD  +  C++   + R   P
BLAST of Granulin b vs. Ensembl Cavefish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 107.071 bits (266), Expect = 2.373e-24
Identity = 96/348 (27.59%), Postives = 133/348 (38.22%), Query Frame = 3
            +CP+  ++C  + TCC T    + CC    AVCC DK HCCPE S C     KCV      + M    PA    D                +PKT+             A V+    V C ++   C D  TCC      + CCP   AVCC D   CCP    C++   KC     S+  + +       + +    K+ ++              C  + G    C      CC D   CCP   KC+     C         +        K K  P T ++  V C D    C    TCC  S+  + CC L  AVCC D   CCPH +KC++   +C + + +

HSP 2 Score: 103.99 bits (258), Expect = 2.075e-23
Identity = 93/360 (25.83%), Postives = 138/360 (38.33%), Query Frame = 3
            TV N+  +    C +  TCC+     + CC    AVCC D  HCCP G  C+    KC      +V   K +P+  + ++  P+T +     N  D   CP+         TCC      + CCP   AVCC D   CCP    C++    C     S+  M +         +    K+ ++              C  + G    C      CC D + CCP   KC+     C   S      +K    P +     ++     P N T  C    TCC      + CC L  AVCC D + CCPH +KC++   +C + + +     K+   P+    + K +        D +HF

HSP 3 Score: 102.064 bits (253), Expect = 9.466e-23
Identity = 70/255 (27.45%), Postives = 104/255 (40.78%), Query Frame = 3
            K  +  A +       CPN +        C +     Y CCP     CC D   CCP    C     KC +S HS+     + AQ  +  SF+  ++       ++     +   +F C     + G C  + G  C+D   CCP   +C   +  C                   +   V+CPD  +EC    TCC  +D  +GCC +  AVCCAD+V CCP N  C + ++ CV +++NK       FP R +

HSP 4 Score: 101.293 bits (251), Expect = 1.617e-22
Identity = 97/361 (26.87%), Postives = 136/361 (37.67%), Query Frame = 3
            GS    K V S  +  RE+     K  V N+  N    C +  TCC+     + CC    AVCC D  HCCP G  C+     C   + S   M KL    +K +  P+T +     N  D   CP+  T CKD+          + CCP   AVCC D   CCP    C++    C     S+  + +         +    K   +              C    G    C      CC D   CCP   KC+     C   S      EK    P   +         + V C D+   C +  TCC   +  + CC     VCC DR+ CCPH+  C+++T +C +  ++     P+

HSP 5 Score: 97.0561 bits (240), Expect = 3.747e-21
Identity = 98/409 (23.96%), Postives = 157/409 (38.39%), Query Frame = 3
            ++   +A    G  +     G  CPN++  C ++ TCCQ      Y+CC +    CC D  HCCP G  C   + KC     S +   +  PA     +    ++ +    KD ++CP+N +   +     +T  + Y CCP    + C+D+  CCP    C   +  C      +  M  + + +     T                      CP T+G  G C      CC+D   CCP+++ C   ++KC                                 L +    T  +  S TTN+     +STV  V  D+   C    TCC   +  + CC L  AVCC D + CCPH +KC++    C + + +    +    P R    K L +   +++  N T+
BLAST of Granulin b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009302.1 (pep scaffold:Pmarinus_7.0:GL483232:1183:11161:1 gene:ENSPMAG00000008413.1 transcript:ENSPMAT00000009302.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.487 bits (319), Expect = 8.679e-32
Identity = 98/371 (26.42%), Postives = 150/371 (40.43%), Query Frame = 3
            + ++   +G +S   + +        E    IC + ++ C +  TCC+     + CC    AVCC D  HCCPEG+TC+    +C K    ++      PAL+V  EP   I +      D+  CP+         TCC     ++ CCP   AVCC D   CCP+ TTC++  + C           Q  +   +  +T   ++      ++   +      D  C + +G  G C      CC D   CCPQ T C+     C   +     + K+         + V C D++  C    TCC      +GCC L  AVCC D   CCP    C++   SC       +   P +   P R++    L

HSP 2 Score: 124.405 bits (311), Expect = 9.077e-31
Identity = 102/361 (28.25%), Postives = 144/361 (39.89%), Query Frame = 3
            KG +S   + +        E    IC + +  C +  TCC+     + CC    AVCC D  HCCP+G+TC+     C +    ++      PAL+V  EP   I +      D+  CP+  T CK           ++ CCP   AVCC D   CCP+ TTC++  + C     S+   + +        E N  K    +    Q        C    G  G C      CC D   CCP+ T C+     C  +        S  +P   RL+ ++ P            D+   C    TCC +    +GCC L  A CC+D V CCP    CD+   SC+     K+ HF    PK

HSP 3 Score: 119.398 bits (298), Expect = 3.979e-29
Identity = 90/320 (28.12%), Postives = 133/320 (41.56%), Query Frame = 3
            +K+   ++  +  T C+++ TCC      + CC    AVCC DK HCCPEG+ C+     C   A S +      PAL++  EP        V   D V CP+         TCC T   ++ CCP   AVCC D   CCP+ TTC++  + C           Q  +   +  +T   ++      ++   +      +  C    G    C      CC D   CCPQ T C+     C   +     + K+         + V+C D+++ C    TCC +    +GCC L  AVCC D   CCP    C++    C

HSP 4 Score: 111.309 bits (277), Expect = 1.842e-26
Identity = 85/324 (26.23%), Postives = 129/324 (39.81%), Query Frame = 3
            WR +  A +       CP+  T C +  TCC      Y CC   +AVCC D  HCCP+ + CD K  KCV   K ++      P+ +   + + +   +  ++    + P+                  + CCP   AVCC DK  CCPE T C++ ++ C  +  S+   + +        E N  +   L+          +  C    G    C      CC D   CCPQ T C+     C   +     + K+         + V+C D+++ C    TCC      + CC L  AVCC D   CCP    C++   +C

HSP 5 Score: 90.1225 bits (222), Expect = 1.435e-19
Identity = 67/213 (31.46%), Postives = 93/213 (43.66%), Query Frame = 3
             AVCCSD   CCP  T CD+ +  C     S+  + +     +F   T  +++  SL +   Q             CP+ +G+ G C      CCSD   CCP++T CD K  KC           SK+ P+    S V C D  T C    TCC +    +GCC L  AVCC D+  CCP    C++ + +C         H  L+ P  +K

HSP 6 Score: 69.3218 bits (168), Expect = 8.118e-13
Identity = 50/132 (37.88%), Postives = 62/132 (46.97%), Query Frame = 3
             CCSD   CCP  T CD  +  C     S  +  +    +P T R     S  V    CPD  T C    TCC ++   YGCC LE+AVCC+D + CCP N  CD+K   CV        H  L+ P  SK+
BLAST of Granulin b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001039.1 (pep scaffold:Pmarinus_7.0:GL484091:11570:24665:-1 gene:ENSPMAG00000000936.1 transcript:ENSPMAT00000001039.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 1.147e-22
Identity = 89/304 (29.28%), Postives = 123/304 (40.46%), Query Frame = 3
            C   QTCC+++   + CC    A CC D  HCCP  + C   Q          V    LIP LK E       L   V   D V+       C+  +TCC ++   + CC  + A CCSD   CCP   + D+K + C +S   I  + +E    S     N         G  Q   +    C    G  G C     TCCSD   CCP  T+C      C+ +S     E       ++ LS  +  D+   C  W+TCC      +GCC    A CC+D + CCP   +C +    C  ++

HSP 2 Score: 93.2041 bits (230), Expect = 1.372e-20
Identity = 84/297 (28.28%), Postives = 112/297 (37.71%), Query Frame = 3
            C   QTCC+++   + CC    A CC D  HCCP  + C   Q          V    LIP LK E      + +  V+      C   +T C+            + CC  + A CCSD   CCP  T C +   +C +S   I  + +E    S     N         G  Q   +    C    G  G C     TCCSD   CCP  T+C        +NS        K +  +  +   VV       C  W+TCC      +GCC    A CC+D + CCP     D+K

HSP 3 Score: 88.1965 bits (217), Expect = 4.881e-19
Identity = 77/291 (26.46%), Postives = 116/291 (39.86%), Query Frame = 3
            CC+++   + CC    A CC D  HCCP  + C    + +CV  A        LIP LK E      + +  V+      C   +T C+            + CC  + A CCSD   CCP  T C +  + C+ S  ++      ++    + + + + ++    G  Q   +    C    G  G C     TCCSD   CCP  T+C        +NS        K +  +  +   VV       C  W+TCC      +GCC    A CC+D + CCP   +C +

HSP 4 Score: 85.5001 bits (210), Expect = 3.851e-18
Identity = 79/302 (26.16%), Postives = 114/302 (37.75%), Query Frame = 3
            C   QTCC+++   + CC    A CC D  HCCP  + C      C +    + E   ++  L  E +   N++     +   + +  C +                  + CC  + A CCSD   CCP  T C +   +C +S   I  + +E    S     N         G  Q   +    C    G  G C     TCCSD   CCP  T+C        +NS         E +   P  + L  V C   +  C  W+TCC      +GCC    A CC+D + CCP   +C +

HSP 5 Score: 50.447 bits (119), Expect = 5.091e-7
Identity = 37/120 (30.83%), Postives = 50/120 (41.67%), Query Frame = 3
            G  G C     TCCSD   CCP  T+C        +NS         E +   P  + L  V C   +  C  W+TCC      +GCC    A CC+D + CCP   +C +    C  ++
BLAST of Granulin b vs. Ensembl Nematostella
Match: EDO27824 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T870])

HSP 1 Score: 72.7886 bits (177), Expect = 1.197e-14
Identity = 71/236 (30.08%), Postives = 97/236 (41.10%), Query Frame = 3
            N  + C + +TCC+    SY CC   NAVCC D  HCCP G  CD     C   AK +  M      ++     +  + E K   KD   C   +T C             Y CCP  +AVCC+D   CCP   TC+ K+  C    H +  M Q+  H S        K   II   + F  +  +      + Y   C  ++ +   C     +CCSD   CCPQ   CD++  

HSP 2 Score: 71.633 bits (174), Expect = 2.556e-14
Identity = 58/206 (28.16%), Postives = 81/206 (39.32%), Query Frame = 3
             +Y CCP  NAVCCSD   CCP    CDI +  C        +MA++     S+        +  +        +  +  C +   + G C   +  CC+D++ CCP    C++K+  C         F    S H P      T V  D+               C  + TCC  S     CC L NA CC+D + CCP    CD

HSP 3 Score: 66.6254 bits (161), Expect = 1.141e-12
Identity = 48/141 (34.04%), Postives = 64/141 (45.39%), Query Frame = 3
            C ++ G  G C      CCSD + CCP    CD  ++ C + + D     S H+ T  R  +  + C D  + C + ETCC V    YGCC L +AVCCAD   CCP    C+ K+  C      + RH    F K     

HSP 4 Score: 59.3066 bits (142), Expect = 4.487e-10
Identity = 30/82 (36.59%), Postives = 45/82 (54.88%), Query Frame = 3
            ++ + C+ +ETCC +S  SYGCC L NAVCC+D   CCP    CDI +++C +  +S     +  T  +         DG+H

HSP 5 Score: 55.4546 bits (132), Expect = 8.284e-9
Identity = 46/162 (28.40%), Postives = 63/162 (38.89%), Query Frame = 3
             +  VG I     + C   +TCC      Y CC   +AVCC D  HCCP G TC+ K   C +  +  + M +  P++     P+  + +  V     +   P                  +      CCP  NA CCSD   CCP+   CD   K C   P
BLAST of Granulin b vs. Ensembl Medaka
Match: grnb (granulin precursor [Source:NCBI gene;Acc:101166910])

HSP 1 Score: 149.058 bits (375), Expect = 2.034e-38
Identity = 120/387 (31.01%), Postives = 171/387 (44.19%), Query Frame = 3
            ++  VLVGL+         V A G   F  +    GF     +      ICP++ ++C +  TCCQ    S+ CC +  AVCC D+ HCCPEG+TCD    KC   +     M + +PA +V   P   +  A  +    V+CP  K+ C ++ TCC+    ++ CCP+  A CCSD   CCP  TTCD++   C S      E   E I        +      L    +         C + NG  G C      CCSD   CCP+ T CD  ++ C   +           S   P T+ +  +  P N +  C    TCC  S   +GCC L  AVCC D + CCPH   C++  ++C + + +     PL      FP RS+

HSP 2 Score: 130.954 bits (328), Expect = 2.878e-32
Identity = 100/372 (26.88%), Postives = 152/372 (40.86%), Query Frame = 3
            ++ SK A+  + +F +     A R             +CP  ++ C    TCC      + CC Y  A CC D  HCCP  +TCD ++  C    KS               E +   + A     ++V+CP+ ++ C D  TCC   +  + CCP  NAVCCSD   CCPE TTCD+ +  C S+     E     +  +   +T+  + +++        +     C  + G+ G C      CC D   CCP  T C+   + C   S    T    ++P     S     D    C    TCC      + CC L  AVCC D + CCP+   C+++  +C +  S      P    KR +    + +

HSP 3 Score: 112.464 bits (280), Expect = 4.071e-26
Identity = 91/328 (27.74%), Postives = 131/328 (39.94%), Query Frame = 3
             K   C  R TCC+     + CC    AVCC D  HCCP+G  C+A    C +    ++   + +PAL+ +   +T  +E K +   +  CP + T C   +T        + CCP   AVCC D   CCP   +C      C+   H +    +          T    +  +    K   +     CP+  G  G C      CC+D   CCPQ   C+ +   C   +       S+  P   + +  V  D   E  C    TCC +S  ++GCC    AVCC D   CCP    CD+K   C  T   +     L   +R+ F

HSP 4 Score: 108.227 bits (269), Expect = 9.378e-25
Identity = 104/361 (28.81%), Postives = 139/361 (38.50%), Query Frame = 3
            +GV     A  E   A +      +CP++R+ C +  TCCQ  + ++ CC   NAVCC D  HCCPEG+TCD     CV  A    E   ++P       PKT+ +         V C N    C D  TCC      + CCP   AVCC D   CCP  T C++    C     S       L+ ++  F Y +   +                  C    G    C      CC D   CCP  T C+ +   C     D  +  S   P   +   +     E +C          TCC  S   + CC L  AVCC+D   CCP   KC+    +C      +R   P + P R K 

HSP 5 Score: 73.9442 bits (180), Expect = 1.192e-13
Identity = 48/172 (27.91%), Postives = 75/172 (43.60%), Query Frame = 3
            S  + W  + G  +    V ++  + ++ C    TCC  +   + CC    AVCC D  HCCP+  TC+ +   C K A   + + +++PA   + +      +   +   E  CP   T C+ +          + CCP   AVCC D   CCP   +CD+K   CT  P 

HSP 6 Score: 69.707 bits (169), Expect = 2.694e-12
Identity = 70/257 (27.24%), Postives = 104/257 (40.47%), Query Frame = 3
            L WR++   + ++  G   P     + +T C +  TCC  +    + CC    AVCC D  HCCP G +C   +  C +          ++P        K   L       D V C +NK+ C    TCC  +   + CCP   AVCC+D   CCP++ TC+++   C        +  Q L +      +    + +      + K  K +  C I+    G C      CC D + CCP    CD K   CTL 
BLAST of Granulin b vs. Ensembl Medaka
Match: grna (granulins [Source:NCBI gene;Acc:101162601])

HSP 1 Score: 122.479 bits (306), Expect = 2.015e-29
Identity = 91/339 (26.84%), Postives = 135/339 (39.82%), Query Frame = 3
            +  T C ++ TCC+T+   + CC +  AVCC D  HCCP+G TC+     C      +V M + +P+       K ++    V       CP+  T CK            + CCP   AVCC D   CCP+  TC++  + C     S+      ++     +     K+  +              C    G  G C F    CC D   CCP+   C+     C  +  S     +    S  + ++  V C D  T C    TCC   D ++GCC L  AVCC D   CCP    CD+ T SC++ +      +  P +    S   + +  G  

HSP 2 Score: 118.242 bits (295), Expect = 5.849e-28
Identity = 87/326 (26.69%), Postives = 134/326 (41.10%), Query Frame = 3
            A+ E    + + +  +I  N+   C ++ TCC+T+   + CC +  AVCC D  HCCP+G TC+     C      +V M + +P+       K ++    V       CP+         TCC T+   + CCP   AVCC D   CCP+  TC++  + C     S+      ++     +     K+  +              C    G  G C F    CC D   CCP+   C+     C  +  S     +    S  + ++  V C D  T C    TCC   +  +GCC    AVCC D + CCP  + C++   +C

HSP 3 Score: 114.775 bits (286), Expect = 7.923e-27
Identity = 95/360 (26.39%), Postives = 145/360 (40.28%), Query Frame = 3
            +  T C ++ TCC+TK  ++ CC    AVCC D  HCCP G+TCD     C+K A   V M K +PA        + ++                        E K +E+  + C ++    + T  C + +   + CCP   AVCC+D   CCP    C  ++  C      I    +    DS + +++F +  ++      +  +    C +  G  G C      CC D   CCP+   CD  +  C            L       ++S+H P    L+     D+   C   ETCC  S  ++GCC    AVCC D   CCP   +C  K  SC++       ++   F  + K

HSP 4 Score: 110.153 bits (274), Expect = 2.657e-25
Identity = 102/376 (27.13%), Postives = 140/376 (37.23%), Query Frame = 3
            +S  L    + F   +  +G    NICP+ +++C    +C +     Y CC  A  V CPD  HCCPEG  C      CVK                 ++  KT + +  V+E  DE  C  N+                + CCP   AVCC DK  CCPE TTCD++  KC SS      M  +    +                         F   T    + + L G     +AS  D  C  T              G  G C F    CC D   CCP+   C+     C  +  S     +    S  + ++  V C D  T C    TCC   +  +GCC    AVCC D + CCP  + C++   +C

HSP 5 Score: 106.686 bits (265), Expect = 3.570e-24
Identity = 93/350 (26.57%), Postives = 138/350 (39.43%), Query Frame = 3
            +  T C ++ TCC+T+   + CC +  AVCC D  HCCP+G TC+     C      +V M + +P     ++K+ED P     +   +  D+  C             C T+   + CCP   AVCC D   CCP+  TC++  + C     S+      ++     +     K+  +              C   +G  G C      CC D   CCP  T CD     C                         L  T  +TE+ ++ P              T+    + C D+ T+C    TCC +   + +GCC L  AVCCAD   CCP + KC  +  SCV+

HSP 6 Score: 95.9005 bits (237), Expect = 1.270e-20
Identity = 61/222 (27.48%), Postives = 98/222 (44.14%), Query Frame = 3
            +Y CCP   A CC D   CCP+   CD+    C ++  S+  +  E +  + +  T  F++I   +G         Q    ++F C     R G C  + G  C D + CCP+  +C   +  C    +               + TV+C D  +EC    TCC   +  + CC +  AVCC D++ CCP    CD++   C+ ++S+K       FP R++

HSP 7 Score: 93.5893 bits (231), Expect = 6.134e-20
Identity = 89/370 (24.05%), Postives = 133/370 (35.95%), Query Frame = 3
            W    + S      ++CPN   KC + QTCCQ+    Y CC +  A CC D  HCCP+   CD     C     S   + ++   L++  +    ++ + + E ++ +CP+      +           Y CCP    V C D   CCPE   C + ++ C                   K E+   K +    G  +   ++   C    G+   C      CC D   CCP+ T CD +  KC L+S+D         P   R           +S V    NET+                                    C    TCC   +  +GCC    AVCC D + CCP  + C++   +C

HSP 8 Score: 68.1662 bits (165), Expect = 8.534e-12
Identity = 67/243 (27.57%), Postives = 99/243 (40.74%), Query Frame = 3
            G I  +  T+C +  TCC  K    + CC    AVCC D  HCCP    C  +   CVK  +  +     IPA        + +  + V++  E M            +CC      + CCP  NAVCC DK  CCPE  TCD+ +K C    H +  +  E +  +  +    ++    +  +L       S    +  C  ++   G C      CC D++ CCP   +C  K   C  N+
BLAST of Granulin b vs. Ensembl Medaka
Match: grna (granulins [Source:NCBI gene;Acc:101162601])

HSP 1 Score: 117.857 bits (294), Expect = 7.877e-28
Identity = 87/326 (26.69%), Postives = 134/326 (41.10%), Query Frame = 3
            A+ E    + + +  +I  N+   C ++ TCC+T+   + CC +  AVCC D  HCCP+G TC+     C      +V M + +P+       K ++    V       CP+         TCC T+   + CCP   AVCC D   CCP+  TC++  + C     S+      ++     +     K+  +              C    G  G C F    CC D   CCP+   C+     C  +  S     +    S  + ++  V C D  T C    TCC   +  +GCC    AVCC D + CCP  + C++   +C

HSP 2 Score: 115.161 bits (287), Expect = 5.076e-27
Identity = 84/312 (26.92%), Postives = 128/312 (41.03%), Query Frame = 3
            +  T C ++ TCC+T+   + CC +  AVCC D  HCCP+G TC+     C      +V M + +P+     +K+ED P     +   +  D+  C             C T+   + CCP   AVCC D   CCP+  TC++  + C     S+      ++     +     K+  +              C    G  G C F    CC D   CCP+   C+     C  +  S     +    S  + ++  V C D  T C    TCC   +  +GCC    AVCC D + CCP  + C++   +C

HSP 3 Score: 114.39 bits (285), Expect = 9.821e-27
Identity = 95/360 (26.39%), Postives = 145/360 (40.28%), Query Frame = 3
            +  T C ++ TCC+TK  ++ CC    AVCC D  HCCP G+TCD     C+K A   V M K +PA        + ++                        E K +E+  + C ++    + T  C + +   + CCP   AVCC+D   CCP    C  ++  C      I    +    DS + +++F +  ++      +  +    C +  G  G C      CC D   CCP+   CD  +  C            L       ++S+H P    L+     D+   C   ETCC  S  ++GCC    AVCC D   CCP   +C  K  SC++       ++   F  + K

HSP 4 Score: 109.768 bits (273), Expect = 3.116e-25
Identity = 102/376 (27.13%), Postives = 140/376 (37.23%), Query Frame = 3
            +S  L    + F   +  +G    NICP+ +++C    +C +     Y CC  A  V CPD  HCCPEG  C      CVK                 ++  KT + +  V+E  DE  C  N+                + CCP   AVCC DK  CCPE TTCD++  KC SS      M  +    +                         F   T    + + L G     +AS  D  C  T              G  G C F    CC D   CCP+   C+     C  +  S     +    S  + ++  V C D  T C    TCC   +  +GCC    AVCC D + CCP  + C++   +C

HSP 5 Score: 105.916 bits (263), Expect = 6.192e-24
Identity = 97/357 (27.17%), Postives = 140/357 (39.22%), Query Frame = 3
            +  T C ++ TCC+T+   + CC +  AVCC D  HCCP+G TC+     C      +V M + +P+       K ++    V       CP+         TCC TK   + CCP   AVCC D   CCP  TTCD+    C  +   +  M+++L        T      S L+   Q           +  + DF                   CP            + G C      CC+D   CCP   KC E++  C           K   + +    S+ V      +C    +CC +    +GCC L NAVCC D+  CCP    CD+ + SC +  + +    PLT

HSP 6 Score: 95.9005 bits (237), Expect = 1.386e-20
Identity = 61/222 (27.48%), Postives = 98/222 (44.14%), Query Frame = 3
            +Y CCP   A CC D   CCP+   CD+    C ++  S+  +  E +  + +  T  F++I   +G         Q    ++F C     R G C  + G  C D + CCP+  +C   +  C    +               + TV+C D  +EC    TCC   +  + CC +  AVCC D++ CCP    CD++   C+ ++S+K       FP R++

HSP 7 Score: 93.5893 bits (231), Expect = 7.067e-20
Identity = 89/370 (24.05%), Postives = 133/370 (35.95%), Query Frame = 3
            W    + S      ++CPN   KC + QTCCQ+    Y CC +  A CC D  HCCP+   CD     C     S   + ++   L++  +    ++ + + E ++ +CP+      +           Y CCP    V C D   CCPE   C + ++ C                   K E+   K +    G  +   ++   C    G+   C      CC D   CCP+ T CD +  KC L+S+D         P   R           +S V    NET+                                    C    TCC   +  +GCC    AVCC D + CCP  + C++   +C

HSP 8 Score: 68.1662 bits (165), Expect = 9.439e-12
Identity = 67/243 (27.57%), Postives = 99/243 (40.74%), Query Frame = 3
            G I  +  T+C +  TCC  K    + CC    AVCC D  HCCP    C  +   CVK  +  +     IPA        + +  + V++  E M            +CC      + CCP  NAVCC DK  CCPE  TCD+ +K C    H +  +  E +  +  +    ++    +  +L       S    +  C  ++   G C      CC D++ CCP   +C  K   C  N+
BLAST of Granulin b vs. Ensembl Medaka
Match: ENSORLT00000029765.1 (granulins [Source:NCBI gene;Acc:101168633])

HSP 1 Score: 74.7146 bits (182), Expect = 1.407e-14
Identity = 72/270 (26.67%), Postives = 102/270 (37.78%), Query Frame = 3
            CP+ +  C +  TCC T H  + CC    AVCC DK HCCP G  C+     C K  +  V +  L        PAL +     TN++E   N+                MCP+  T C+            ++CCP+    CC D + CCP    CD+    C             ++  +   LI    +      K ++ L       S+       S F+CP       G  G+   C +  G CC+D R CC     CD  +  C
BLAST of Granulin b vs. Ensembl Medaka
Match: ENSORLT00000005071.2 (granulins [Source:NCBI gene;Acc:101168633])

HSP 1 Score: 74.7146 bits (182), Expect = 1.574e-14
Identity = 72/270 (26.67%), Postives = 102/270 (37.78%), Query Frame = 3
            CP+ +  C +  TCC T H  + CC    AVCC DK HCCP G  C+     C K  +  V +  L        PAL +     TN++E   N+                MCP+  T C+            ++CCP+    CC D + CCP    CD+    C             ++  +   LI    +      K ++ L       S+       S F+CP       G  G+   C +  G CC+D R CC     CD  +  C
BLAST of Granulin b vs. Planmine SMEST
Match: SMESG000018760.1 (SMESG000018760.1)

HSP 1 Score: 630.943 bits (1626), Expect = 0.000e+0
Identity = 332/352 (94.32%), Postives = 335/352 (95.17%), Query Frame = 3

HSP 2 Score: 263.077 bits (671), Expect = 4.239e-81
Identity = 172/343 (50.15%), Postives = 207/343 (60.35%), Query Frame = 3
            K      CPN RTKC + QTCC TKH SYHCCK+ANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEM KLIPALKVEDEPKTNILEAKVNEKDE       +CPN +TKC + +TCC TKHN+Y+CC + NAVCC DK+ CCP  T+CD  +KKC  +  +     Q   E +      ET+  KII+       + K   S   C   +G    CKF+   CC D   CCP+ + CD K +KC +     + E  K  P     N L T            V+CP+N+T+C   +TCC     +Y CC  +NAVCC+D+  CCP    CDIK   C  +

HSP 3 Score: 214.157 bits (544), Expect = 1.340e-62
Identity = 147/343 (42.86%), Postives = 186/343 (54.23%), Query Frame = 3
            A NKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCP G++CD+   KC +    N+E  K       E      I E  V    +  CPNN+TKC+D++TCC+TKH +Y+CC   NAVCC DK+ CCPE +TCD K  KC     S  EM + +     + E  TN  +            + ++    + K ++    C   +     CK++   CC D   CCP  T CD  + KC  N     S    T +    P         ++   CP+N T+C   +TCC     SY CC+  NAVCC D+  CCP    CD K + CV+
BLAST of Granulin b vs. Planmine SMEST
Match: SMESG000018760.1 (SMESG000018760.1)

HSP 1 Score: 630.558 bits (1625), Expect = 0.000e+0
Identity = 332/352 (94.32%), Postives = 335/352 (95.17%), Query Frame = 3

HSP 2 Score: 268.855 bits (686), Expect = 6.631e-83
Identity = 185/374 (49.47%), Postives = 213/374 (56.95%), Query Frame = 3
            K      CPN RTKC + QTCC TKH SYHCCK+ANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEM KLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKD KTCCITKHNNYYCCPHK                                     NAVCC DK+ CCP  T+CD  +KKC  +  +     Q   E +      ET+  KII+       + K   S   C   +G    CKF+   CC D   CCP+ + CD K +KC +     + E  K  P     N L T            V+CP+N+T+C   +TCC     +Y CC  +NAVCC+D+  CCP    CDIK   C  +

HSP 3 Score: 202.986 bits (515), Expect = 3.162e-58
Identity = 147/374 (39.30%), Postives = 187/374 (50.00%), Query Frame = 3
            A NKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCP G++CD+   KC +    N+E  K       E      I E  V    +  CPNN+TKC+D++TCC+TKH +Y+CC   NAVCC DK+ CCPE +TCD K  KC     S  EM + +    + D  K                                         ++ N   + ++    + K ++    C   +     CK++   CC D   CCP  T CD  + KC  N     S    T +    P         ++   CP+N T+C   +TCC     SY CC+  NAVCC D+  CCP    CD K + CV+
BLAST of Granulin b vs. Planmine SMEST
Match: SMESG000018760.1 (SMESG000018760.1)

HSP 1 Score: 630.172 bits (1624), Expect = 0.000e+0
Identity = 332/352 (94.32%), Postives = 335/352 (95.17%), Query Frame = 3

HSP 2 Score: 268.47 bits (685), Expect = 1.510e-82
Identity = 185/374 (49.47%), Postives = 213/374 (56.95%), Query Frame = 3
            K      CPN RTKC + QTCC TKH SYHCCK+ANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEM KLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKD KTCCITKHNNYYCCPHK                                     NAVCC DK+ CCP  T+CD  +KKC  +  +     Q   E +      ET+  KII+       + K   S   C   +G    CKF+   CC D   CCP+ + CD K +KC +     + E  K  P     N L T            V+CP+N+T+C   +TCC     +Y CC  +NAVCC+D+  CCP    CDIK   C  +

HSP 3 Score: 226.868 bits (577), Expect = 6.202e-67
Identity = 159/412 (38.59%), Postives = 206/412 (50.00%), Query Frame = 3
            MK  +SI  + V L ++ S   A G +SF L+W +     NKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCP G++CD+   KC +    N+E  K       E      I E  V    +  CPNN+TKC+D++TCC+TKH +Y+CC   NAVCC DK+ CCPE +TCD K  KC     S  EM + +    + D  K                                         ++ N   + ++    + K ++    C   +     CK++   CC D   CCP  T CD  + KC  N     S    T +    P         ++   CP+N T+C   +TCC     SY CC+  NAVCC D+  CCP    CD K + CV+

HSP 4 Score: 189.119 bits (479), Expect = 4.892e-53
Identity = 141/353 (39.94%), Postives = 189/353 (53.54%), Query Frame = 3
            +NKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCP G++CD+   KC +    N+E  K       E      I E  V    +  CPNN+TKC+D++TCC+TKH +Y+CC   NAVCC DK+ CCPE +TCD K  KC     S  EM + +  +    + +TN        K   +    K K   +   C   +     C      CCSD   CCP+ T CD KN KCT +           + +   +  K+     ++ +++    +    S +  C +++   G C+     CC+D  +CCP + KCD K N C     + ++ K +H P T
BLAST of Granulin b vs. Planmine SMEST
Match: SMESG000018767.1 (SMESG000018767.1)

HSP 1 Score: 319.701 bits (818), Expect = 1.948e-104
Identity = 200/392 (51.02%), Postives = 234/392 (59.69%), Query Frame = 3
            G  S   +   +       T  NICPNKRTKCT+RQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPE T CD+KNKKC S+   +        + H  F  E + ++++  L   ++  +     CP       +  G+ G CKF                                     +   CC D   CCP+ + CD K +KC   +             K +  P TN L         V+CP+N+T+C   +TCC     +Y CC  +NAVCC+D+  CCP   KCD+K   C+

HSP 2 Score: 307.76 bits (787), Expect = 9.381e-100
Identity = 173/252 (68.65%), Postives = 193/252 (76.59%), Query Frame = 3

HSP 3 Score: 153.68 bits (387), Expect = 2.688e-41
Identity = 132/372 (35.48%), Postives = 180/372 (48.39%), Query Frame = 3
            +CPN +TKC + +TCC TKHN+Y+CC + NAVCC DK+ CCPEG+ CD K  KC+  +                    +SN E+  +    K+E    D+  T        +++A      K N K+   + +CPN +TKC D +TCC TKHN+Y+CC + NAVCC DK+ CCPE +TCD K  KC     S  EM + +     + E  TN        K   +    K K   +   C   +     C      CCSD   CCP+ TKCD KN KC   S      T+ DT        E+S +            C D +  C   + CC +    +GCC+  + VCC D  +CCPH  +CD KTN C+

HSP 4 Score: 96.6709 bits (239), Expect = 2.139e-21
Identity = 94/286 (32.87%), Postives = 122/286 (42.66%), Query Frame = 3
            K N   + +CPN +TKC D +TCC TKHN+Y+CC + NAVCC DK+ CCPE +TCD K  KC     S  EM + +     + E  TN        K   +    K K   +   C   +     C      CCSD   CCP+ TKCD KN KC   S      T+ DT        E+S +                                          N  +  +CP+  T+C   +TCC     SY CC+  NAVCC D+  CCP    CD K + CV+
BLAST of Granulin b vs. Planmine SMEST
Match: SMESG000018762.1 (SMESG000018762.1)

HSP 1 Score: 319.316 bits (817), Expect = 1.795e-103
Identity = 209/415 (50.36%), Postives = 246/415 (59.28%), Query Frame = 3
            S+ A L  LA   S +A    +GV    +L      +  N  T  NICPNKRTKCT+RQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPE T CD+KNKKC S+   +        + H  F  E + ++++  L   ++  +     CP       +  G+ G CKF                                     +   CC D   CCP+ + CD K +KC   +             K +  P TN L         V+CP+N+T+C   +TCC     +Y CC  +NAVCC+D+  CCP   KCD+K   C+

HSP 2 Score: 308.145 bits (788), Expect = 3.606e-99
Identity = 173/252 (68.65%), Postives = 193/252 (76.59%), Query Frame = 3

HSP 3 Score: 153.68 bits (387), Expect = 7.259e-41
Identity = 132/372 (35.48%), Postives = 180/372 (48.39%), Query Frame = 3
            +CPN +TKC + +TCC TKHN+Y+CC + NAVCC DK+ CCPEG+ CD K  KC+  +                    +SN E+  +    K+E    D+  T        +++A      K N K+   + +CPN +TKC D +TCC TKHN+Y+CC + NAVCC DK+ CCPE +TCD K  KC     S  EM + +     + E  TN        K   +    K K   +   C   +     C      CCSD   CCP+ TKCD KN KC   S      T+ DT        E+S +            C D +  C   + CC +    +GCC+  + VCC D  +CCPH  +CD KTN C+

HSP 4 Score: 99.3673 bits (246), Expect = 3.710e-22
Identity = 97/301 (32.23%), Postives = 128/301 (42.52%), Query Frame = 3
             +K  D+ +   LE   N   + +CPN +TKC D +TCC TKHN+Y+CC + NAVCC DK+ CCPE +TCD K  KC     S  EM + +     + E  TN        K   +    K K   +   C   +     C      CCSD   CCP+ TKCD KN KC   S      T+ DT        E+S +                                          N  +  +CP+  T+C   +TCC     SY CC+  NAVCC D+  CCP    CD K + CV+
The following BLAST results are available for this feature:
BLAST of Granulin b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRN5.276e-3830.89granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN7.296e-3730.89granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN6.002e-3329.86granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN1.214e-2628.53granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN5.110e-1236.17granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
back to top
BLAST of Granulin b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pgrn-12.019e-2040.44ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:... [more]
pgrn-14.337e-2040.44ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:... [more]
T02B11.88.100e-642.86pep chromosome:WBcel235:V:877530:878667:-1 gene:WB... [more]
back to top
BLAST of Granulin b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Granulin b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grnb2.559e-3832.29granulin b [Source:ZFIN;Acc:ZDB-GENE-030131-7393][more]
grna1.849e-3128.65granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
grna2.003e-3029.86granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
grna2.547e-3028.37granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
grna2.809e-1529.44granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
back to top
BLAST of Granulin b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
trappc111.984e-2829.14trafficking protein particle complex 11 [Source:Xe... [more]
trappc112.319e-2829.14trafficking protein particle complex 11 [Source:Xe... [more]
trappc112.029e-2728.24trafficking protein particle complex 11 [Source:Xe... [more]
trappc116.262e-2728.92trafficking protein particle complex 11 [Source:Xe... [more]
back to top
BLAST of Granulin b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Grn9.793e-3030.46granulin [Source:MGI Symbol;Acc:MGI:95832][more]
Grn3.345e-1535.29granulin [Source:MGI Symbol;Acc:MGI:95832][more]
Grn2.544e-1232.89granulin [Source:MGI Symbol;Acc:MGI:95832][more]
Grn1.404e-1032.39granulin [Source:MGI Symbol;Acc:MGI:95832][more]
back to top
BLAST of Granulin b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P28799|GRN_HUMAN3.504e-3630.89Progranulin OS=Homo sapiens OX=9606 GN=GRN PE=1 SV... [more]
sp|P23785|GRN_RAT8.860e-3133.33Progranulin OS=Rattus norvegicus OX=10116 GN=Grn P... [more]
sp|P28798|GRN_MOUSE8.678e-2930.46Progranulin OS=Mus musculus OX=10090 GN=Grn PE=1 S... [more]
sp|P28797|GRN_CAVPO1.051e-2425.20Progranulin OS=Cavia porcellus OX=10141 GN=GRN PE=... [more]
sp|Q54QR7|GRN_DICDI1.989e-641.43Granulin OS=Dictyostelium discoideum OX=44689 GN=g... [more]
back to top
BLAST of Granulin b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2B4SIQ61.048e-4733.06Granulin OS=Stylophora pistillata OX=50429 GN=GRN ... [more]
V4ARK57.880e-4433.44Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
A0A1A7X3H31.878e-4334.71Granulin b OS=Iconisemion striatum OX=60296 GN=GRN... [more]
A0A3P8VPE04.781e-4335.99Granulin b OS=Cynoglossus semilaevis OX=244447 PE=... [more]
A0A3P8VL475.489e-4335.99Granulin b OS=Cynoglossus semilaevis OX=244447 PE=... [more]
back to top
BLAST of Granulin b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grnb4.279e-3931.64granulins-like [Source:NCBI gene;Acc:103046308][more]
grnb4.279e-3931.64granulins-like [Source:NCBI gene;Acc:103046308][more]
grna7.052e-2627.64granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
ENSAMXT00000029960.16.231e-2527.45pep primary_assembly:Astyanax_mexicanus-2.0:23:267... [more]
grna2.373e-2427.59granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
back to top
BLAST of Granulin b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009302.18.679e-3226.42pep scaffold:Pmarinus_7.0:GL483232:1183:11161:1 ge... [more]
ENSPMAT00000001039.11.147e-2229.28pep scaffold:Pmarinus_7.0:GL484091:11570:24665:-1 ... [more]
back to top
BLAST of Granulin b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Granulin b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO278241.197e-1430.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Granulin b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grnb2.034e-3831.01granulin precursor [Source:NCBI gene;Acc:101166910... [more]
grna2.015e-2926.84granulins [Source:NCBI gene;Acc:101162601][more]
grna7.877e-2826.69granulins [Source:NCBI gene;Acc:101162601][more]
ENSORLT00000029765.11.407e-1426.67granulins [Source:NCBI gene;Acc:101168633][more]
ENSORLT00000005071.21.574e-1426.67granulins [Source:NCBI gene;Acc:101168633][more]
back to top
BLAST of Granulin b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
back to top
The following sequences are available for this feature:

transcript sequence

>SMED30003962 ID=SMED30003962|Name=Granulin b|organism=Schmidtea mediterranea sexual|type=transcript|length=1344bp
back to top

protein sequence of SMED30003962-orf-1

>SMED30003962-orf-1 ID=SMED30003962-orf-1|Name=SMED30003962-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=390bp
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
GO:0048675axon extension
GO:0007165signal transduction
GO:0043312neutrophil degranulation
Vocabulary: Planarian Anatomy
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000240body wall musculature
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
Vocabulary: molecular function
GO:0003723RNA binding
GO:0005125cytokine activity
GO:0005515protein binding
GO:0008083growth factor activity
Vocabulary: cellular component
GO:0005576extracellular region
GO:0005615extracellular space
GO:0005783endoplasmic reticulum
GO:0035578azurophil granule lumen
GO:0070062extracellular exosome
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000118GranulinSMARTSM00277GRAN_2coord: 49..101
e-value: 1.0E-10
score: 51.6
coord: 141..193
e-value: 1.0E-10
score: 51.6
coord: 307..359
e-value: 1.1E-11
score: 54.9
coord: 239..281
e-value: 0.02
score: 7.8
IPR000118GranulinPFAMPF00396Granulincoord: 61..102
e-value: 1.4E-12
score: 47.7
coord: 153..193
e-value: 5.0E-11
score: 42.7
coord: 319..360
e-value: 3.4E-12
score: 46.5
coord: 243..281
e-value: 1.1E-6
score: 28.9
IPR000118GranulinPROSITEPS00799GRANULINScoord: 81..94
IPR037277Granulin superfamilyGENE3DG3DSA: 304..370
e-value: 2.1E-14
score: 55.4
coord: 232..295
e-value: 5.6E-7
score: 31.6
coord: 47..113
e-value: 1.3E-13
score: 52.9
coord: 138..207
e-value: 1.9E-13
score: 52.4
IPR039036Granulin familyPANTHERPTHR12274GRANULINcoord: 36..363
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..23
score: 0.54
NoneNo IPR availableTMHMMTMhelixcoord: 7..29