Granulin b

Overview
NameGranulin b
Smed IDSMED30003962
Length (bp)1344
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Granulin b (SMED30003962) t-SNE clustered cells

Violin plots show distribution of expression levels for Granulin b (SMED30003962) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Granulin b (SMED30003962) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Granulin b (SMED30003962) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003962

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30003962SMESG000018760.1 dd_Smed_v4_2701_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003962SMESG000018760.1 dd_Smed_v4_2701_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30003962SMESG000018760.1 dd_Smed_v4_2701_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003962SMESG000018760.1 dd_Smed_v4_2701_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003962SMESG000018767.1 SMESG000018762.1 SMESG000018760.1 dd_Smed_v4_427_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
body wall musculatureSMED30003962SMESG000018760.1 dd_Smed_v4_2701_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003962SMESG000018766.1 SMESG000018760.1 SMESG000018767.1 SMESG000018762.1 dd_Smed_v6_427_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30003962SMESG000018766.1 SMESG000018760.1 SMESG000018767.1 SMESG000018762.1 dd_Smed_v6_427_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Granulin b vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 143.665 bits (361), Expect = 5.276e-38
Identity = 101/327 (30.89%), Postives = 138/327 (42.20%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRS 1205
            +CP+ R++C +  TCC+     Y CC   NA CC D  HCCP+ + CD  Q KC+    +  ++   +PA  V D          V    EV CP+  T C+            + CCP   AVCC D   CCP   TCD +   C   PH +  M +   H S        + +            SD  C +T+G  G C      CCSD + CCPQ   C  +      +      EK      +      +  D  T C   +TCC     S+ CC+L +AVCC DR  CCP    C++K  SC +   + +   P TF  RS
Sbjct:   21 MCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGD----------VKCDMEVSCPDGYTCCRLQS-------GAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVP--CDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQ---PATFLARS 325          

HSP 2 Score: 80.1073 bits (196), Expect = 1.061e-15
Identity = 67/237 (28.27%), Postives = 97/237 (40.93%), Query Frame = 3
Query:  213 TVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLL-LGFKQKAS--KSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKC 914
            TVG++  +    C +  TCC+ +  ++ CC +  AVCC D  HCCP G TCD ++  C +       M K    L +   P    L+  V   +   CP++ T C+ T          + CCP   AVCCSD   CCP+  TC +   +C        +   E++    K       +     +G  Q  S       CP   G    C+     CC D + CCP    C+ K   C
Sbjct:   92 TVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSL---PDPQALKRDVPCDNVSSCPSSDTCCQLTS-------GEWGCCPIPEAVCCSDHQHCCPQGYTC-VAEGQC--------QRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSC 309          

HSP 3 Score: 58.151 bits (139), Expect = 1.311e-8
Identity = 56/216 (25.93%), Postives = 75/216 (34.72%), Query Frame = 3
Query:  588 NAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLN---STDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC------VETNSNKRRHFPLTFPKRSK 1208
            ++V C D    CP+ +TC                                                    C + +G+ G C     TCCSD   CCPQ T CD   +KC      +TD  T+   H+     +  V C D E  C    TCC +   ++GCC    AVCC D + CCP    CD +  +C      V        H  L  P+  K
Sbjct:   18 SSVMCPDARSRCPDGSTC----------------------------------------------------CELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHT-----VGDVKC-DMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALK 175          

HSP 4 Score: 56.6102 bits (135), Expect = 4.880e-8
Identity = 27/66 (40.91%), Postives = 38/66 (57.58%), Query Frame = 3
Query:  966 TNRL----STVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCV 1151
            TNR     S+V+CPD  + C    TCC +    YGCC + NA CC+D + CCP +  CD+  + C+
Sbjct:   10 TNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCL 75          
BLAST of Granulin b vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 144.05 bits (362), Expect = 7.296e-37
Identity = 101/327 (30.89%), Postives = 138/327 (42.20%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRS 1205
            +CP+ R++C +  TCC+     Y CC   NA CC D  HCCP+ + CD  Q KC+    +  ++   +PA  V D          V    EV CP+  T C+            + CCP   AVCC D   CCP   TCD +   C   PH +  M +   H S        + +            SD  C +T+G  G C      CCSD + CCPQ   C  +      +      EK      +      +  D  T C   +TCC     S+ CC+L +AVCC DR  CCP    C++K  SC +   + +   P TF  RS
Sbjct:  207 MCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGD----------VKCDMEVSCPDGYTCCRLQS-------GAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVP--CDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQ---PATFLARS 511          

HSP 2 Score: 128.642 bits (322), Expect = 1.697e-31
Identity = 98/317 (30.91%), Postives = 138/317 (43.53%), Query Frame = 3
Query:  201 SNKETVGNI-CPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQEL-IHDSFKYETNFFKIISLLLGFKQKASKSDFY--CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHS----PTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKC 1127
            S   +VG I CP+ + +C +  TCC     S+ CC    A CC D+ HCCP G+ CD    +C+        + K +PA +             V     VMCP+ +++C D  TCC      Y CCP  NA CCSD   CCP+ T CD+   KC S  ++  ++  +L  H     + +             + S  D Y  C + +G  G C F+   CC D   CCP    CD +   C          +   +    P    L   V  DN + C S +TCC ++   +GCC +  AVCC+D   CCP    C
Sbjct:  116 SGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCIT-PTGTHPLAKKLPAQRTNR---------AVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDM------------EVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTC 410          

HSP 3 Score: 103.99 bits (258), Expect = 3.137e-23
Identity = 90/336 (26.79%), Postives = 131/336 (38.99%), Query Frame = 3
Query:  213 TVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLL-LGFKQKAS--KSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKF 1211
            TVG++  +    C +  TCC+ +  ++ CC +  AVCC D  HCCP G TCD ++  C +       M K    L +   P    L+  V   +   CP++ T C+ T          + CCP   AVCCSD   CCP+  TC +   +C        +   E++    K       +     +G  Q  S       CP   G    C+     CC D + CCP    C+ K   C                    +  V C +    C   +TCC  + + + CC     VCCADR  CCP   +C  +   C+   +  R   PL  P   + 
Sbjct:  278 TVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSL---PDPQALKRDVPCDNVSSCPSSDTCCQLTS-------GEWGCCPIPEAVCCSDHQHCCPQGYTC-VAEGQC--------QRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHF-CHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREA-PRWDAPLRDPALRQL 592          

HSP 4 Score: 84.7297 bits (208), Expect = 5.651e-17
Identity = 55/199 (27.64%), Postives = 81/199 (40.70%), Query Frame = 3
Query:  573 CCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFY--CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRL----STVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCV 1151
            CCP   AV C D + CCP    C    + C                    ++ +    +  +     +    DF   C + +G  G C     +CC D   CCP    CD  + +C   +      K   +  TNR     S+V+CPD  + C    TCC +    YGCC + NA CC+D + CCP +  CD+  + C+
Sbjct:   83 CCPFPEAVACGDGHHCCPRGFHCSADGRSC--------------------FQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCL 261          

HSP 5 Score: 72.0182 bits (175), Expect = 7.813e-13
Identity = 39/115 (33.91%), Postives = 52/115 (45.22%), Query Frame = 3
Query:  807 TNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCV 1151
             +G S  C F     C D   CCP+   C      C   S +            N +  + CPD++ EC  + TCC + D S+GCC +  A CC DRV CCPH   CD+    C+
Sbjct:   77 VSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGN------------NSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCI 179          
BLAST of Granulin b vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 130.954 bits (328), Expect = 6.002e-33
Identity = 103/345 (29.86%), Postives = 146/345 (42.32%), Query Frame = 3
Query:  201 SNKETVGNI-CPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQEL-IHDSFKYETNFFKIISLLLGFKQKASKSDFY--CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHS----PTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKF 1211
            S   +VG I CP+ + +C +  TCC     S+ CC    A CC D+ HCCP G+ CD    +C+        + K +PA +             V     VMCP+ +++C D  TCC      Y CCP  NA CCSD   CCP+ T CD+   KC S  ++  ++  +L  H     + +             + S  D Y  C + +G  G C F+   CC D   CCP    CD +   C          +   +    P    L   V  DN + C S +TCC  + + + CC     VCCADR  CCP   +C  +   C+   +  R   PL  P   + 
Sbjct:  116 SGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCIT-PTGTHPLAKKLPAQRTNR---------AVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDM------------EVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREA-PRWDAPLRDPALRQL 437          

HSP 2 Score: 72.0182 bits (175), Expect = 6.098e-13
Identity = 39/115 (33.91%), Postives = 52/115 (45.22%), Query Frame = 3
Query:  807 TNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCV 1151
             +G S  C F     C D   CCP+   C      C   S +            N +  + CPD++ EC  + TCC + D S+GCC +  A CC DRV CCPH   CD+    C+
Sbjct:   77 VSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGN------------NSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCI 179          
BLAST of Granulin b vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 112.849 bits (281), Expect = 1.214e-26
Identity = 91/319 (28.53%), Postives = 126/319 (39.50%), Query Frame = 3
Query:  249 CTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRS 1205
            C+   +C  T   +  CC +  AV C D  HCCP G  C A    C +                           +  N    + CP+++ +C D  TCC+    ++ CCP   AVCC D   CCP   TCD +   C   PH +  M +   H S        + +            SD  C +T+G  G C      CCSD + CCPQ   C  +      +      EK      +      +  D  T C   +TCC     S+ CC+L +AVCC DR  CCP    C++K  SC +   + +   P TF  RS
Sbjct:   67 CSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQ--------------------------RSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPC--DNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQ---PATFLARS 354          

HSP 2 Score: 105.916 bits (263), Expect = 2.930e-24
Identity = 94/341 (27.57%), Postives = 132/341 (38.71%), Query Frame = 3
Query:  201 SNKETVGNI-CPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLL-LGFKQKAS--KSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKF 1211
            S   +VG I CP+ + +C +  TCC     S+ CC    AVCC D  HCCP G TCD ++  C +       M K    L +   P    L+  V   +   CP++ T C+ T          + CCP   AVCCSD   CCP+  TC +   +C        +   E++    K       +     +G  Q  S       CP   G    C+     CC D + CCP    C+ K   C                    +  V C +    C   +TCC  + + + CC     VCCADR  CCP   +C  +   C+   +  R   PL  P   + 
Sbjct:  116 SGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSL---PDPQALKRDVPCDNVSSCPSSDTCCQLTS-------GEWGCCPIPEAVCCSDHQHCCPQGYTC-VAEGQC--------QRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHF-CHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREA-PRWDAPLRDPALRQL 435          
BLAST of Granulin b vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 66.2402 bits (160), Expect = 5.110e-12
Identity = 34/94 (36.17%), Postives = 45/94 (47.87%), Query Frame = 3
Query:  852 CSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDI 1133
            C D   CCP+   C      C   S +            N +  + CPD++ EC  + TCC + D S+GCC +  A CC DRV CCPH   CD+
Sbjct:  106 CGDGHHCCPRGFHCSADGRSCFQRSGN------------NSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDL 187          

HSP 2 Score: 49.6766 bits (117), Expect = 2.356e-6
Identity = 24/57 (42.11%), Postives = 32/57 (56.14%), Query Frame = 3
Query:  201 SNKETVGNI-CPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCD 368
            S   +VG I CP+ + +C +  TCC     S+ CC    A CC D+ HCCP G+ CD
Sbjct:  130 SGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCD 186          
BLAST of Granulin b vs. Ensembl Celegans
Match: pgrn-1 (ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:Q7JKP2])

HSP 1 Score: 92.4337 bits (228), Expect = 2.019e-20
Identity = 55/136 (40.44%), Postives = 80/136 (58.82%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTC 641
            +  T+C++ +TCC+   N++ CC   NAVCC D+ HCCP G+TCD +  +C+   + +V M K  PA K  +           N+ +EV+CP+  +KC D  TCC+ +  +Y CCP  NAVCC+D   CCP   TC
Sbjct:   99 DAETECSDDETCCKLGDNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGADEKHVPMKKKKPARKTVER----------NQFNEVVCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTC 224          

HSP 2 Score: 75.485 bits (184), Expect = 9.699e-15
Identity = 50/161 (31.06%), Postives = 73/161 (45.34%), Query Frame = 3
Query:  705 IHDSFKYETNFFKIISLLLGF---------------KQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTT-----NRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKC 1127
            +H SF +  +  KI+ L+L F               + + S  +  C + +   G C      CC D   CCP  T CD +  +C + + +      K  P       N+ + VVCPD  ++C    TCC +   SYGCC + NAVCCAD + CCP+   C
Sbjct:   66 LHSSFSFIFSI-KIMRLILLFLAVFLCRVTAHQCDAETECSDDETCCKLGDNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARC-IGADEKHVPMKKKKPARKTVERNQFNEVVCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTC 224          

HSP 3 Score: 59.6918 bits (143), Expect = 1.230e-9
Identity = 34/82 (41.46%), Postives = 46/82 (56.10%), Query Frame = 3
Query:  996 DNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGNHF 1241
            D ETEC   ETCC + D ++GCC + NAVCC DR  CCP    CD +   C+  +    +H P+   K+   RKT+ + N F
Sbjct:   99 DAETECSDDETCCKLGDNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGAD---EKHVPMK--KKKPARKTV-ERNQF 174          

HSP 4 Score: 58.5362 bits (140), Expect = 3.363e-9
Identity = 25/50 (50.00%), Postives = 31/50 (62.00%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAK 374
            +CP+K +KC +  TCC  +  SY CC   NAVCC D  HCCP G TC  +
Sbjct:  178 VCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTCHGQ 227          

HSP 5 Score: 51.9878 bits (123), Expect = 3.940e-7
Identity = 35/114 (30.70%), Postives = 48/114 (42.11%), Query Frame = 3
Query:  561 NNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASK---SDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKC 893
            N + CCP  NAVCC D+  CCP  TTCD +  +C  +      M ++           F +++        KASK       C +  G  G C      CC+D+  CCP    C
Sbjct:  116 NTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGADEKHVPMKKKKPARKTVERNQFNEVVC-----PDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTC 224          
BLAST of Granulin b vs. Ensembl Celegans
Match: pgrn-1 (ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:Q7JKP2])

HSP 1 Score: 91.6633 bits (226), Expect = 4.337e-20
Identity = 55/136 (40.44%), Postives = 80/136 (58.82%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTC 641
            +  T+C++ +TCC+   N++ CC   NAVCC D+ HCCP G+TCD +  +C+   + +V M K  PA K  +           N+ +EV+CP+  +KC D  TCC+ +  +Y CCP  NAVCC+D   CCP   TC
Sbjct:   99 DAETECSDDETCCKLGDNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGADEKHVPMKKKKPARKTVER----------NQFNEVVCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTC 224          

HSP 2 Score: 75.8702 bits (185), Expect = 8.764e-15
Identity = 47/155 (30.32%), Postives = 68/155 (43.87%), Query Frame = 3
Query:  714 SFKYETNFFKIISLLLGF------------KQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTT-----NRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKC 1127
            SF +     ++I L L              + + S  +  C + +   G C      CC D   CCP  T CD +  +C + + +      K  P       N+ + VVCPD  ++C    TCC +   SYGCC + NAVCCAD + CCP+   C
Sbjct:   71 SFIFSIKIMRLILLFLAVFLCRVTAHQCDAETECSDDETCCKLGDNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARC-IGADEKHVPMKKKKPARKTVERNQFNEVVCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTC 224          

HSP 3 Score: 59.6918 bits (143), Expect = 1.561e-9
Identity = 32/76 (42.11%), Postives = 43/76 (56.58%), Query Frame = 3
Query:  996 DNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTL 1223
            D ETEC   ETCC + D ++GCC + NAVCC DR  CCP    CD +   C+  +    +H P+   K+   RKT+
Sbjct:   99 DAETECSDDETCCKLGDNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGAD---EKHVPMK--KKKPARKTV 169          

HSP 4 Score: 57.7658 bits (138), Expect = 6.247e-9
Identity = 25/50 (50.00%), Postives = 31/50 (62.00%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAK 374
            +CP+K +KC +  TCC  +  SY CC   NAVCC D  HCCP G TC  +
Sbjct:  178 VCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTCHGQ 227          

HSP 5 Score: 56.225 bits (134), Expect = 1.760e-8
Identity = 61/239 (25.52%), Postives = 88/239 (36.82%), Query Frame = 3
Query:  561 NNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASK---SDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCD----EKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVC------------PDNETE---------CFSWETCCAVSDKS----YGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHF 1181
            N + CCP  NAVCC D+  CCP  TTCD +  +C  +      M ++           F +++        KASK       C +  G  G C      CC+D+  CCP    C      +N     +   F +      P    LS                P+++ +         C +  TCC V  K+      CC L NA+CC +  +CCP    C +    C +     R  F
Sbjct:  116 NTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGADEKHVPMKKKKPARKTVERNQFNEVVC-----PDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTCHGQFCSQNFAMIPHLRKFASTSIHRKPAVEFLSEEEEDDDDEESTSSEDPESDVDPIACGVGKTCPAKTTCCNVRGKNGEPKTMCCPLSNAICCEN--TCCPAGYHC-VDGGKCEKHAKTMRTRF 346          
BLAST of Granulin b vs. Ensembl Celegans
Match: T02B11.8 (pep chromosome:WBcel235:V:877530:878667:-1 gene:WBGene00044776.1 transcript:T02B11.8a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T02B11.8)

HSP 1 Score: 44.669 bits (104), Expect = 8.100e-6
Identity = 21/49 (42.86%), Postives = 26/49 (53.06%), Query Frame = 3
Query:  222 NICPNKRT-KCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTC 365
            N+C  KRT +C E   CC   +  Y CC +    CCP   HCCP G +C
Sbjct:   24 NLCDEKRTTQCDEYAVCCPIGNEQYGCCPFTGGTCCPGTNHCCPPGFSC 72          
BLAST of Granulin b vs. Ensembl Zebrafish
Match: grnb (granulin b [Source:ZFIN;Acc:ZDB-GENE-030131-7393])

HSP 1 Score: 148.673 bits (374), Expect = 2.559e-38
Identity = 113/350 (32.29%), Postives = 162/350 (46.29%), Query Frame = 3
Query:  174 LAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNI-LEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKA--SKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLST-VVCP------DNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC-VETNSNKRRHFPLT 1190
            L W E+  A  +  V   CP+  ++C +  TCCQ     + CC   NAVCC D+ HCCP+G+TCD     CV     +    +   A + +   K  + L A+VN   EV+CP+  +KC +  TCC+ +  +Y CCP   AVCCSD+  CCPE TTCD+ +  C S+ + + EMA ++            K    ++   +    S     C    G    C      CC D   CCP+ T C+   + C     D     S   P   ++ST  + P      D  + C    TCC +S   +GCC L  AVCC D V CCPH   C++   +C   ++S  R   P+ 
Sbjct:   80 LDWVEKVEAKLQAVV---CPDGESECPDDTTCCQMPDGGWGCCPMKNAVCCDDRKHCCPQGTTCDLVHSMCVSTTYGSSPFLRKFDARRRKPLEKNAVDLPAEVNNIREVICPDKISKCPEDTTCCLLETGSYGCCPMPKAVCCSDQKHCCPEGTTCDLIHSTCLSA-NGVSEMATKI------PAVTVLKPKEEVVPCNETVACSSGTTCCKTPEGSWACCPLPKAVCCEDHIHCCPEGTLCNVAASSC-----DDPAGLSVSVPWMEKVSTKPIAPPPNKKCDESSSCPGESTCCKLSSGDWGCCPLPEAVCCEDHVHCCPHGSVCNVAAETCETVSDSGLRISVPMV 414          

HSP 2 Score: 130.568 bits (327), Expect = 3.757e-32
Identity = 105/323 (32.51%), Postives = 149/323 (46.13%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILE--AKVNEKDE-VMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFK-YETNFFKIISLLLGFKQ--------KASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLST--VVCPDNET-ECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
            ICP+    C +  TCC T    Y CC   +A CC D  HCC +G+ CD +  KCV                      KT++L+   KV  K + V+CP+ +++C D  TCC      + CCP KNAVCC D+  CCP+ TTCD+ +  C S+ +      ++      K  E N   + + +   ++        K  +    C +  G  G C      CCSD + CCP+ T CD  ++ C   S +  +E +   P    L     V P NET  C S  TCC   + S+ CC L  AVCC D + CCP    C++  +SC
Sbjct:   21 ICPDGGM-CEDGNTCCLTPSGGYGCCPLPHAECCSDHLHCCYQGTLCDLEHSKCVN---------------------KTHVLDWVEKVEAKLQAVVCPDGESECPDDTTCCQMPDGGWGCCPMKNAVCCDDRKHCCPQGTTCDLVHSMCVSTTYGSSPFLRKFDARRRKPLEKNAVDLPAEVNNIREVICPDKISKCPEDTTCCLLETGSYGCCPMPKAVCCSDQKHCCPEGTTCDLIHSTCL--SANGVSEMATKIPAVTVLKPKEEVVPCNETVACSSGTTCCKTPEGSWACCPLPKAVCCEDHIHCCPEGTLCNVAASSC 319          

HSP 3 Score: 124.405 bits (311), Expect = 4.308e-30
Identity = 96/319 (30.09%), Postives = 134/319 (42.01%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPAL----KVEDEPKTNILEAKVN-EKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCP-------ITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVE 1154
            ++ + C    TCC+    S+ CC    AVCC D+ HCCP+G TCD  Q  CV+    ++   +  PAL    +VED    ++ +A+ +  +D+  C  N+                + CCP   AVCC D   CCP   TC+ +   CT   H I            K     +K    LLG +     S   CP       +  G+ G C      CC D   CCPQ   C  +   C   S D        S T  ++  + C D  T C   ++CC ++D ++ CC    AVCC D   CCP   KCD K   C +
Sbjct:  430 DETSSCPTGTTCCKLTSGSWACCPMPQAVCCADQEHCCPQGYTCDLAQSSCVRSGLPSMAWFRKEPALRETQRVEDR---HMCDAQTSCPRDDTCCFINRI-------------GKWGCCPLPKAVCCKDGDHCCPSGYTCNEEKTSCTKGLHQIPWFT--------KKTARVWKSSDELLGHEDVKCDSSTSCPSGSTCCILPTGQWGCCPLVKAVCCEDHEHCCPQGYICKLELGTCEKASADVSV-----SLTAVQMPEIQC-DTFTRCAHTQSCCRLADSTWACCPYTQAVCCKDMKHCCPMGYKCDPKVQGCTK 718          

HSP 4 Score: 119.013 bits (297), Expect = 2.579e-28
Identity = 110/362 (30.39%), Postives = 152/362 (41.99%), Query Frame = 3
Query:  129 VIGSKVAAKGVISFQLAWREQGFASNKETVGNICPNKR----TKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSN----VEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITN--GRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCT--LNSTDFDTEKS----KHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSN 1166
            V  S       +S  + W E+   S K       PNK+    + C    TCC+     + CC    AVCC D  HCCP GS C+     C   + S     V M K IPA+ V  +        K N  +   CP   T CK T         ++ CCP   AVCC+D+  CCP+  TCD+    C  S   +  MA      + + ET   ++    +   Q +   D  C   N  G+ G C      CC D   CCP    C+E+   CT  L+   + T+K+    K S        V C D+ T C S  TCC +    +GCC L  AVCC D   CCP    C ++  +C + +++
Sbjct:  314 VAASSCDDPAGLSVSVPWMEK--VSTKPIAPP--PNKKCDESSSCPGESTCCKLSSGDWGCCPLPEAVCCEDHVHCCPHGSVCNVAAETCETVSDSGLRISVPMVKKIPAVSVPSQ--------KQNCDETSSCPTGTTCCKLTS-------GSWACCPMPQAVCCADQEHCCPQGYTCDLAQSSCVRS--GLPSMAWFRKEPALR-ETQ--RVEDRHMCDAQTSCPRDDTCCFINRIGKWGCCPLPKAVCCKDGDHCCPSGYTCNEEKTSCTKGLHQIPWFTKKTARVWKSSDELLGHEDVKC-DSSTSCPSGSTCCILPTGQWGCCPLVKAVCCEDHEHCCPQGYICKLELGTCEKASAD 650          

HSP 5 Score: 95.9005 bits (237), Expect = 1.109e-20
Identity = 63/216 (29.17%), Postives = 94/216 (43.52%), Query Frame = 3
Query:  561 NNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTD-------FDTEKSKH--------SPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNS 1163
              Y CCP  +A CCSD   CC + T CD+++ KC +  H +  +         K E     ++      + +       C + +G  G C      CC D + CCPQ T CD  ++ C   +         FD  + K             N +  V+CPD  ++C    TCC +   SYGCC +  AVCC+D+  CCP    CD+  ++C+  N 
Sbjct:   40 GGYGCCPLPHAECCSDHLHCCYQGTLCDLEHSKCVNKTHVLDWVE--------KVEAKLQAVV--CPDGESECPDDTTCCQMPDGGWGCCPMKNAVCCDDRKHCCPQGTTCDLVHSMCVSTTYGSSPFLRKFDARRRKPLEKNAVDLPAEVNNIREVICPDKISKCPEDTTCCLLETGSYGCCPMPKAVCCSDQKHCCPEGTTCDLIHSTCLSANG 245          

HSP 6 Score: 82.8037 bits (203), Expect = 2.120e-16
Identity = 52/139 (37.41%), Postives = 68/139 (48.92%), Query Frame = 3
Query:  798 CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNS---------NKRRHFPL 1187
            C   +G  G C      CCSD   CC Q T CD +++KC   +   D  +   +    +L  VVCPD E+EC    TCC + D  +GCC ++NAVCC DR  CCP    CD+  + CV T           + RR  PL
Sbjct:   35 CLTPSGGYGCCPLPHAECCSDHLHCCYQGTLCDLEHSKCVNKTHVLDWVEKVEA----KLQAVVCPDGESECPDDTTCCQMPDGGWGCCPMKNAVCCDDRKHCCPQGTTCDLVHSMCVSTTYGSSPFLRKFDARRRKPL 169          
BLAST of Granulin b vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 129.028 bits (323), Expect = 1.849e-31
Identity = 100/349 (28.65%), Postives = 143/349 (40.97%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEK----DEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTD---FDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNS-----NKRRHFPLTFPKRSKFRKTLNDGNHFS 1244
            N    C +  TCC+TK   + CC    AVCC D  HCCP G  CD     C   +  +V   + +P   +  +   N   + V+      D V CP+  T CKD          ++ CCP   AVCC D   CCP    C++    C     S+  + +  +H       +     +   G  +    S   C    G  G C FS   CC+D   CCP H KC+  +  C         ++   ++ +P       VV  D ++ C +  TCC +S    GCC    AVCC D+  CCP   +CD++  SCV+T        +  H     P+ S   K +  G  FS
Sbjct:  641 NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCED-SSGSVPWVEKVPVRPIRKQKVANTKVSPVSSDVACNDTVACPDGSTCCKDK-------DGDWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVEKVPVHLRAGQRPSGKVKCNATHGCPE----SSTCCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKGDVVIPWYNKIAAESTPAPKLDLGVVKCDEQSSCSADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCVKTTRLYVEITQLTHIRSNKPQPSVVVKDVQCGGGFS 977          

HSP 2 Score: 120.939 bits (302), Expect = 7.749e-29
Identity = 105/355 (29.58%), Postives = 143/355 (40.28%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPA-LKVEDE------PKTNILEAKV---------------------NEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKI--ISLLLGFKQKASKSDFY--CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKC---------TLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSN 1166
            +C N  ++C    TCCQ     + CC    AVCC DK HCCPE + CD K  KCV      + M    PA L+ E E      P+T    A+                          +V C N+   C D  TCC TK   + CCP   AVCC D   CCP    CD+    C     S+  + +  +    K +    ++  +S  +     A+ +D    C    G    C      CC D   CCP+  KC+    KC          +  T   +  + +   T + S V C D    C    TCC   D  + CC L  AVCC D + CCPH +KCD+   SC + + +
Sbjct:  170 LCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVAC-NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVSWVEKVPVRPIRKQKVAVTQVSSVSSDVPCNDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPNVIGTQK-SDVPCNDT-AACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGS 521          

HSP 3 Score: 117.087 bits (292), Expect = 1.582e-27
Identity = 95/330 (28.79%), Postives = 128/330 (38.79%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEK----DEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLL--LGFKQKASKSDFY--CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFD--------------TEKSKHSPTTNRLS---TVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
            N    C +  TCC+TK   + CC    AVCC D  HCCP G  CD     C      +V   + +P   +  +       + V+      D V CP+  T CKD           + CCP   AVCC D   CCP    C++    C     S+  M +  +    K +    +  S    +     A+  D    C   +G    C      CC D   CCP   KCD     C  +S                     +K SP ++ ++   TV CPD         TCC   D  +GCC L  AVCC D + CCPH +KC++   SC
Sbjct:  465 NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCED-PSGSVPWVEKVPVRPIRKQKVAVTTVSPVSSDIACNDTVACPDGSTCCKDK-------DGEWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWMDKVPVRPIKKQKVAVTQASSASSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDSSGSVPWVEKVPVRPIRKQKVANTKVSPVSSDVACNDTVACPDG-------STCCKDKDGDWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSC 779          

HSP 4 Score: 114.39 bits (285), Expect = 1.096e-26
Identity = 104/364 (28.57%), Postives = 142/364 (39.01%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFY--CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFD-TEKSKHSP---------TTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNK--RRHFPLTFPKRSKFRKTLNDGNHFSIL*NSTSTKQNHS 1283
            N    C +  TCC+TK   + CC    AVCC D  HCCP G  CD     C      +V   + +P   +  + K  + +      D V C N+   C D  TCC TK  ++ CCP   AVCC D   CCP+   C+I   KC   P    E   +          N        +     A+  D    C   +G    C      CC D   CCP   KCD     C   S      EK    P         T + +S+ +  ++   C    TCC   D  +GCC L  AVCC D + CCPH +KC++   SC + + +       P+   K+ K   T        +  N T+   + S
Sbjct:  292 NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCED-PSGSVSWVEKVPVRPIRKQ-KVAVTQVSSVSSD-VPC-NDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKC-EDPLCTEEPLVKQTPVQSTTTPNVIGTQKSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVPWVEKVPVRPIRKQKVAVTTVSPVSSDIACNDTVACPDGSTCCKDKDGEWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWMDKVPVRPIKKQKVAVTQASSASSDVPCNDTAACPDGS 650          

HSP 5 Score: 102.064 bits (253), Expect = 1.396e-22
Identity = 65/228 (28.51%), Postives = 102/228 (44.74%), Query Frame = 3
Query:  561 NNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCP------------ITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSK 1208
              + CCP  +  CC D   CCPE   C +K+  CT++ H+     Q L   +   + +  K   ++  F   AS+SD  CP            + +   G C  + G  CSD + CCP   +C   ++ C                   ++ TV+C +  +EC +  TCC   D  +GCC +  AVCC D++ CCP +  CD+K   CV +++N+       FP R +
Sbjct:   37 GGFSCCPFHHGECCEDHLHCCPEGMLCSVKDLTCTNATHT-----QPLADRTLAKKPDLPKSFRMI--FSMPASESDITCPDGSSCPAEFSCLLMSTSYGCCPVAQGLACSDGKHCCPNDHECSTDSSLCVKRKV--------------KVQTVLCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCV-SSTNQELPMWDKFPARLR 242          

HSP 6 Score: 100.908 bits (250), Expect = 3.817e-22
Identity = 91/357 (25.49%), Postives = 134/357 (37.54%), Query Frame = 3
Query:  228 CPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKT--NILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFY-CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNS---------------TDFDTEKSKHSPT----------------TNRLSTV----------VCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSN 1166
            CPN    C   Q+CCQ     + CC + +  CC D  HCCPEG  C  K   C     +     + +   K  D PK+   I     +E D + CP+  +   +     ++   +Y CCP    + CSD   CCP    C   +  C                          K+ ++L G       +D   C   +G+ G C      CC D   CCP+ T CD K  KC  ++                +++  K K   T                 N+++T+          V  ++   C    TCC   D  + CC L  AVCC D + CCPH +KCD+   SC + + +
Sbjct:   19 CPNNEV-CEAGQSCCQDPTGGFSCCPFHHGECCEDHLHCCPEGMLCSVKDLTCTNATHTQPLADRTL--AKKPDLPKSFRMIFSMPASESD-ITCPDGSSCPAEFSCLLMS--TSYGCCPVAQGLACSDGKHCCPNDHECSTDSSLCVK---------------------RKVKVQTVLCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGS 348          

HSP 7 Score: 99.3673 bits (246), Expect = 1.071e-21
Identity = 90/327 (27.52%), Postives = 127/327 (38.84%), Query Frame = 3
Query:  183 REQGFASNK--ETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGF-----KQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDF-DTEKSKHSPTTNRLSTVVCPDNET----ECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKC 1127
            R+Q  A+ K      ++  N    C +  TCC+ K   + CC    AVCC D  HCCP G  C+     C   + S   + K+   L+    P       KV       CP + T CK+           + CCP   AVCC+D   CCP    C++ +  C             +I    K          L LG      +   S     C ++   +G C F    CC D + CCP+  +CD +   C   +  + +  +  H  +     +VV  D +      C   ETCC  S  ++GCC    AVCC D   CCP   KC
Sbjct:  710 RKQKVANTKVSPVSSDVACNDTVACPDGSTCCKDKDGDWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVEKVPVHLRAGQRP-----SGKVKCNATHGCPESSTCCKNIA-------GEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIK--------GDVVIPWYNKIAAESTPAPKLDLGVVKCDEQSSCSADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCVKTTRLYVEITQLTHIRSNKPQPSVVVKDVQCGGGFSCHDGETCCLTSQTTWGCCPSPKAVCCDDMQHCCPAGYKC 1016          
BLAST of Granulin b vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 125.561 bits (314), Expect = 2.003e-30
Identity = 103/345 (29.86%), Postives = 143/345 (41.45%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTD---FDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNS-----NKRRHFPLTFPKRSKFRKTLNDGNHFS 1244
            N    C +  TCC+TK   + CC    AVCC D  HCCP G  CD     C      +V   + +P   +  + K  +  A     D V C N+   C D  TCC TK   + CCP   AVCC D   CCP    C++    C     S+  + +  +H       +     +   G  +    S   C    G  G C FS   CC+D   CCP H KC+  +  C         ++   ++ +P       VV  D ++ C +  TCC +S    GCC    AVCC D+  CCP   +CD++  SCV+T        +  H     P+ S   K +  G  FS
Sbjct:  465 NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCED-PSGSVPWVEKVPVRPIRKQ-KVAVTTASSASSD-VPC-NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVEKVPVHLRAGQRPSGKVKCNATHGCPE----SSTCCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKGDVVIPWYNKIAAESTPAPKLDLGVVKCDEQSSCSADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCVKTTRLYVEITQLTHIRSNKPQPSVVVKDVQCGGGFS 801          

HSP 2 Score: 120.939 bits (302), Expect = 7.669e-29
Identity = 105/355 (29.58%), Postives = 143/355 (40.28%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPA-LKVEDE------PKTNILEAKV---------------------NEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKI--ISLLLGFKQKASKSDFY--CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKC---------TLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSN 1166
            +C N  ++C    TCCQ     + CC    AVCC DK HCCPE + CD K  KCV      + M    PA L+ E E      P+T    A+                          +V C N+   C D  TCC TK   + CCP   AVCC D   CCP    CD+    C     S+  + +  +    K +    ++  +S  +     A+ +D    C    G    C      CC D   CCP+  KC+    KC          +  T   +  + +   T + S V C D    C    TCC   D  + CC L  AVCC D + CCPH +KCD+   SC + + +
Sbjct:  170 LCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVAC-NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVSWVEKVPVRPIRKQKVAVTQVSSVSSDVPCNDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPNVIGTQK-SDVPCNDT-AACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGS 521          

HSP 3 Score: 113.235 bits (282), Expect = 2.548e-26
Identity = 99/329 (30.09%), Postives = 131/329 (39.82%), Query Frame = 3
Query:  198 ASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFY--CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDF---------DTEKSKHSPTTNRLSTVVCPDNET-ECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
            A ++    ++  N    C +  TCC+TK   + CC    AVCC D  HCCP G  CD     C      +V   + +P   +  + K  + +      D V C N+   C D  TCC TK  ++ CCP   AVCC D   CCP+   C+I   KC   P    E   +          N        +     A+  D    C   +G    C      CC D   CCP   KCD     C   S               K K + TT   ++   P N+T  C    TCC   D  + CC L  AVCC D + CCPH +KC++   SC
Sbjct:  280 AEHQGVSSDVACNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCED-PSGSVSWVEKVPVRPIRKQ-KVAVTQVSSVSSD-VPC-NDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKC-EDPLCTEEPLVKQTPVQSTTTPNVIGTQKSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVPWVEKVPVRPIRKQKVAVTTASSASSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSC 603          

HSP 4 Score: 102.064 bits (253), Expect = 1.215e-22
Identity = 65/228 (28.51%), Postives = 102/228 (44.74%), Query Frame = 3
Query:  561 NNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCP------------ITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSK 1208
              + CCP  +  CC D   CCPE   C +K+  CT++ H+     Q L   +   + +  K   ++  F   AS+SD  CP            + +   G C  + G  CSD + CCP   +C   ++ C                   ++ TV+C +  +EC +  TCC   D  +GCC +  AVCC D++ CCP +  CD+K   CV +++N+       FP R +
Sbjct:   37 GGFSCCPFHHGECCEDHLHCCPEGMLCSVKDLTCTNATHT-----QPLADRTLAKKPDLPKSFRMI--FSMPASESDITCPDGSSCPAEFSCLLMSTSYGCCPVAQGLACSDGKHCCPNDHECSTDSSLCVKRKV--------------KVQTVLCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCV-SSTNQELPMWDKFPARLR 242          

HSP 5 Score: 101.679 bits (252), Expect = 1.965e-22
Identity = 87/308 (28.25%), Postives = 120/308 (38.96%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGF-----KQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDF-DTEKSKHSPTTNRLSTVVCPDNET----ECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKC 1127
            N    C +  TCC+TK   + CC    AVCC D  HCCP G  C+     C   + S   + K+   L+    P       KV       CP + T CK+           + CCP   AVCC+D   CCP    C++ +  C             +I    K          L LG      +   S     C ++   +G C F    CC D + CCP+  +CD +   C   +  + +  +  H  +     +VV  D +      C   ETCC  S  ++GCC    AVCC D   CCP   KC
Sbjct:  553 NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVEKVPVHLRAGQRP-----SGKVKCNATHGCPESSTCCKNIA-------GEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIK--------GDVVIPWYNKIAAESTPAPKLDLGVVKCDEQSSCSADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCVKTTRLYVEITQLTHIRSNKPQPSVVVKDVQCGGGFSCHDGETCCLTSQTTWGCCPSPKAVCCDDMQHCCPAGYKC 840          

HSP 6 Score: 100.908 bits (250), Expect = 2.955e-22
Identity = 91/357 (25.49%), Postives = 134/357 (37.54%), Query Frame = 3
Query:  228 CPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKT--NILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFY-CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNS---------------TDFDTEKSKHSPT----------------TNRLSTV----------VCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSN 1166
            CPN    C   Q+CCQ     + CC + +  CC D  HCCPEG  C  K   C     +     + +   K  D PK+   I     +E D + CP+  +   +     ++   +Y CCP    + CSD   CCP    C   +  C                          K+ ++L G       +D   C   +G+ G C      CC D   CCP+ T CD K  KC  ++                +++  K K   T                 N+++T+          V  ++   C    TCC   D  + CC L  AVCC D + CCPH +KCD+   SC + + +
Sbjct:   19 CPNNEV-CEAGQSCCQDPTGGFSCCPFHHGECCEDHLHCCPEGMLCSVKDLTCTNATHTQPLADRTL--AKKPDLPKSFRMIFSMPASESD-ITCPDGSSCPAEFSCLLMS--TSYGCCPVAQGLACSDGKHCCPNDHECSTDSSLCVK---------------------RKVKVQTVLCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGS 348          

HSP 7 Score: 77.0258 bits (188), Expect = 1.532e-14
Identity = 66/261 (25.29%), Postives = 100/261 (38.31%), Query Frame = 3
Query:  165 SFQLAWREQG---FASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFD 938
            S  + W E+      + +   G +  N    C E  TCC+     + CC ++ AVCC D  HCCP    C+     C+K         K+  A +    PK ++   K +E+                TCC+   +   CCP   AVCC D+  CCPE   CD++ + C  +     E+ Q L H           +  +  G        +  C  +    G C      CC D++ CCP   KC        +++ D D
Sbjct:  607 SGSVPWVEKVPVHLRAGQRPSGKVKCNATHGCPESSTCCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKGDVVIPWYNKI--AAESTPAPKLDLGVVKCDEQSSC---------SADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCVKTTRLYVEITQ-LTHIRSNKPQPSVVVKDVQCGGGFSCHDGETCCLTSQTTWGCCPSPKAVCCDDMQHCCPAGYKCGPGGT--CISAGDLD 853          

HSP 8 Score: 70.0922 bits (170), Expect = 2.517e-12
Identity = 49/161 (30.43%), Postives = 77/161 (47.83%), Query Frame = 3
Query:  159 VISFQLAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTC 641
            VI +      +   + K  +G +  ++++ C+   TCC    +   CC +  AVCCPD+ HCCPEG  CD ++  CVK  +  VE+ +L       ++P+ +++   V       C +        +TCC+T    + CCP   AVCC D   CCP    C
Sbjct:  689 VIPWYNKIAAESTPAPKLDLGVVKCDEQSSCSADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCVKTTRLYVEITQLTHIR--SNKPQPSVVVKDVQCGGGFSCHDG-------ETCCLTSQTTWGCCPSPKAVCCDDMQHCCPAGYKC 840          
BLAST of Granulin b vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 125.561 bits (314), Expect = 2.547e-30
Identity = 99/349 (28.37%), Postives = 140/349 (40.11%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEK----DEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTD---FDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNS-----NKRRHFPLTFPKRSKFRKTLNDGNHFS 1244
            N    C +  TCC+TK   + CC    AVCC D  HCCP G  CD     C      +V   + +P   +  +       + V+      D V CP+  T CKD           + CCP   AVCC D   CCP    C++    C     S+  + +  +H       +     +   G  +    S   C    G  G C FS   CC+D   CCP H KC+  +  C         ++   ++ +P       VV  D ++ C +  TCC +S    GCC    AVCC D+  CCP   +CD++  SCV+T        +  H     P+ S   K +  G  FS
Sbjct:  465 NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCED-PSGSVPWVEKVPVRPIRKQKVAVTTVSPVSSDIACNDTVACPDGSTCCKDK-------DGEWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVEKVPVHLRAGQRPSGKVKCNATHGCPE----SSTCCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKGDVVIPWYNKIAAESTPAPKLDLGVVKCDEQSSCSADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCVKTTRLYVEITQLTHIRSNKPQPSVVVKDVQCGGGFS 801          

HSP 2 Score: 120.939 bits (302), Expect = 8.031e-29
Identity = 105/355 (29.58%), Postives = 143/355 (40.28%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPA-LKVEDE------PKTNILEAKV---------------------NEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKI--ISLLLGFKQKASKSDFY--CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKC---------TLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSN 1166
            +C N  ++C    TCCQ     + CC    AVCC DK HCCPE + CD K  KCV      + M    PA L+ E E      P+T    A+                          +V C N+   C D  TCC TK   + CCP   AVCC D   CCP    CD+    C     S+  + +  +    K +    ++  +S  +     A+ +D    C    G    C      CC D   CCP+  KC+    KC          +  T   +  + +   T + S V C D    C    TCC   D  + CC L  AVCC D + CCPH +KCD+   SC + + +
Sbjct:  170 LCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVAC-NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVSWVEKVPVRPIRKQKVAVTQVSSVSSDVPCNDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPNVIGTQK-SDVPCNDT-AACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGS 521          

HSP 3 Score: 114.005 bits (284), Expect = 1.444e-26
Identity = 96/329 (29.18%), Postives = 131/329 (39.82%), Query Frame = 3
Query:  198 ASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFY--CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFD-TEKSKHSP---------TTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
            A ++    ++  N    C +  TCC+TK   + CC    AVCC D  HCCP G  CD     C      +V   + +P   +    K  +   +V+     +  N+   C D  TCC TK  ++ CCP   AVCC D   CCP+   C+I   KC   P    E   +          N        +     A+  D    C   +G    C      CC D   CCP   KCD     C   S      EK    P         T + +S+ +  ++   C    TCC   D  +GCC L  AVCC D + CCPH +KC++   SC
Sbjct:  280 AEHQGVSSDVACNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCED-PSGSVSWVEKVPVRPIR---KQKVAVTQVSSVSSDVPCNDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKC-EDPLCTEEPLVKQTPVQSTTTPNVIGTQKSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVPWVEKVPVRPIRKQKVAVTTVSPVSSDIACNDTVACPDGSTCCKDKDGEWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSC 603          

HSP 4 Score: 102.064 bits (253), Expect = 1.271e-22
Identity = 65/228 (28.51%), Postives = 102/228 (44.74%), Query Frame = 3
Query:  561 NNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCP------------ITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSK 1208
              + CCP  +  CC D   CCPE   C +K+  CT++ H+     Q L   +   + +  K   ++  F   AS+SD  CP            + +   G C  + G  CSD + CCP   +C   ++ C                   ++ TV+C +  +EC +  TCC   D  +GCC +  AVCC D++ CCP +  CD+K   CV +++N+       FP R +
Sbjct:   37 GGFSCCPFHHGECCEDHLHCCPEGMLCSVKDLTCTNATHT-----QPLADRTLAKKPDLPKSFRMI--FSMPASESDITCPDGSSCPAEFSCLLMSTSYGCCPVAQGLACSDGKHCCPNDHECSTDSSLCVKRKV--------------KVQTVLCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCV-SSTNQELPMWDKFPARLR 242          

HSP 5 Score: 100.908 bits (250), Expect = 3.036e-22
Identity = 91/357 (25.49%), Postives = 134/357 (37.54%), Query Frame = 3
Query:  228 CPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKT--NILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFY-CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNS---------------TDFDTEKSKHSPT----------------TNRLSTV----------VCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSN 1166
            CPN    C   Q+CCQ     + CC + +  CC D  HCCPEG  C  K   C     +     + +   K  D PK+   I     +E D + CP+  +   +     ++   +Y CCP    + CSD   CCP    C   +  C                          K+ ++L G       +D   C   +G+ G C      CC D   CCP+ T CD K  KC  ++                +++  K K   T                 N+++T+          V  ++   C    TCC   D  + CC L  AVCC D + CCPH +KCD+   SC + + +
Sbjct:   19 CPNNEV-CEAGQSCCQDPTGGFSCCPFHHGECCEDHLHCCPEGMLCSVKDLTCTNATHTQPLADRTL--AKKPDLPKSFRMIFSMPASESD-ITCPDGSSCPAEFSCLLMS--TSYGCCPVAQGLACSDGKHCCPNDHECSTDSSLCVK---------------------RKVKVQTVLCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGS 348          

HSP 6 Score: 99.3673 bits (246), Expect = 1.128e-21
Identity = 86/308 (27.92%), Postives = 119/308 (38.64%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGF-----KQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDF-DTEKSKHSPTTNRLSTVVCPDNET----ECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKC 1127
            N    C +  TCC+ K   + CC    AVCC D  HCCP G  C+     C   + S   + K+   L+    P       KV       CP + T CK+           + CCP   AVCC+D   CCP    C++ +  C             +I    K          L LG      +   S     C ++   +G C F    CC D + CCP+  +CD +   C   +  + +  +  H  +     +VV  D +      C   ETCC  S  ++GCC    AVCC D   CCP   KC
Sbjct:  553 NDTVACPDGSTCCKDKDGEWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVEKVPVHLRAGQRP-----SGKVKCNATHGCPESSTCCKNIA-------GEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIK--------GDVVIPWYNKIAAESTPAPKLDLGVVKCDEQSSCSADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCVKTTRLYVEITQLTHIRSNKPQPSVVVKDVQCGGGFSCHDGETCCLTSQTTWGCCPSPKAVCCDDMQHCCPAGYKC 840          

HSP 7 Score: 77.0258 bits (188), Expect = 1.518e-14
Identity = 66/261 (25.29%), Postives = 100/261 (38.31%), Query Frame = 3
Query:  165 SFQLAWREQG---FASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFD 938
            S  + W E+      + +   G +  N    C E  TCC+     + CC ++ AVCC D  HCCP    C+     C+K         K+  A +    PK ++   K +E+                TCC+   +   CCP   AVCC D+  CCPE   CD++ + C  +     E+ Q L H           +  +  G        +  C  +    G C      CC D++ CCP   KC        +++ D D
Sbjct:  607 SGSVPWVEKVPVHLRAGQRPSGKVKCNATHGCPESSTCCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKGDVVIPWYNKI--AAESTPAPKLDLGVVKCDEQSSC---------SADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCVKTTRLYVEITQ-LTHIRSNKPQPSVVVKDVQCGGGFSCHDGETCCLTSQTTWGCCPSPKAVCCDDMQHCCPAGYKCGPGGT--CISAGDLD 853          

HSP 8 Score: 70.0922 bits (170), Expect = 2.517e-12
Identity = 49/161 (30.43%), Postives = 77/161 (47.83%), Query Frame = 3
Query:  159 VISFQLAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTC 641
            VI +      +   + K  +G +  ++++ C+   TCC    +   CC +  AVCCPD+ HCCPEG  CD ++  CVK  +  VE+ +L       ++P+ +++   V       C +        +TCC+T    + CCP   AVCC D   CCP    C
Sbjct:  689 VIPWYNKIAAESTPAPKLDLGVVKCDEQSSCSADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCVKTTRLYVEITQLTHIR--SNKPQPSVVVKDVQCGGGFSCHDG-------ETCCLTSQTTWGCCPSPKAVCCDDMQHCCPAGYKC 840          
BLAST of Granulin b vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 77.0258 bits (188), Expect = 2.809e-15
Identity = 68/231 (29.44%), Postives = 92/231 (39.83%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFK--QKASKSDFY--CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKC 914
            N    C +  TCC+TK   + CC    AVCC D  HCCP+G  C+    KC     +   + K  P   V+     N++     +K +V C N+   C D  TCC TK   + CCP   AVCC D   CCP    C++    C     S+  M +  +    K +    +  S          A+  D    C   +G    C      CC D   CCP   KC+     C
Sbjct:   46 NDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTP---VQSTTTPNVIG---TQKSDVPC-NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWMDKVPVRPIKKQKVAVTQASSASSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSC 269          

HSP 2 Score: 76.2554 bits (186), Expect = 3.867e-15
Identity = 60/209 (28.71%), Postives = 79/209 (37.80%), Query Frame = 3
Query:  558 HNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFY--CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFD---------TEKSKHSPTTNRLSTVVCPDNETE-CFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
              ++ CCP   AVCC D   CCP+   C+I   KC   P    E   +          N        +     A+  D    C   +G    C      CC D   CCP   KC+     C   S              +K K + T    ++   P N+T  C    TCC   D  + CC L  AVCC D + CCPH +KC++   SC
Sbjct:   62 EGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKC-EDPLCTEEPLVKQTPVQSTTTPNVIGTQKSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWMDKVPVRPIKKQKVAVTQASSASSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSC 269          

HSP 3 Score: 67.0106 bits (162), Expect = 6.534e-12
Identity = 52/150 (34.67%), Postives = 68/150 (45.33%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSI 683
            N    C +  TCC+TK   + CC    AVCC D  HCCP G  C+     C   + S   M K +P   ++ + K  + +A     D V C N+   C D  TCC TK   + CCP   AVCC D   CCP    C++    C     S+
Sbjct:  131 NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWMDK-VPVRPIKKQ-KVAVTQASSASSD-VPC-NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSV 276          

HSP 4 Score: 57.7658 bits (138), Expect = 5.876e-9
Identity = 47/173 (27.17%), Postives = 67/173 (38.73%), Query Frame = 3
Query:  798 CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKC---------TLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNK--RRHFPLTFPKRSKFRKTLNDGNHFSIL*NSTSTKQNHS 1283
            C    G    C      CC D   CCP+  KC+    KC          +  T   +  + +   T + S V C D    C    TCC   D  + CC L  AVCC D + CCPH +KC++   SC + + +       P+   K+ K   T        +  N T+   + S
Sbjct:   58 CKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPNVIGTQK-SDVPCNDTAA-CPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWMDKVPVRPIKKQKVAVTQASSASSDVPCNDTAACPDGS 228          
BLAST of Granulin b vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 120.168 bits (300), Expect = 1.984e-28
Identity = 102/350 (29.14%), Postives = 148/350 (42.29%), Query Frame = 3
Query:  198 ASNKETVGNICPNKRTKCTERQTCCQ-TKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKAS---------KSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRK 1217
            ASN+  V  +CP+ R++C    TCC  +  +S+ CC    AVCC D  HCCP  S CD +Q +C+        M KL   +K E +      E +V   D   CP+         TCC    + Y CC   +AVCCSD   CCP  TTCD+ +KKC S                   +T    ++  +   +++++         K +  C + +G+ G C      CC+D   CCP+   C +       +S  + T   K    T+    V C D+   C   +TCC ++   +GCC +  AVCC D   CCP          +C      K  H    F K    R+
Sbjct:  113 ASNQSAV--VCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGDE-----ERRVPCLDGTFCPDG-------STCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVS-------------------QTGEGPLLPQMPAIREESANQVPCDATTKKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCSQGECSKMEHSIPWFT---KTPALTHEARDVEC-DDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGY-------TCSGGQCQKGEHSIPLFSKTPALRQ 418          

HSP 2 Score: 109.768 bits (273), Expect = 4.676e-25
Identity = 85/297 (28.62%), Postives = 116/297 (39.06%), Query Frame = 3
Query:  243 TKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQ--ELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKC 1127
            T C +  TCC+   ++Y CC   +AVCC D  HCCP G+TCD    KCV    S    G L+P +    E   N +      K E  C                    + CCP   AVCC+D   CCPE  TC     +C+   HSI    +   L H++   E +                     C + +G  G C  +   CC D   CCP    C     +C     +        +P   + +  V  D+   C   +TCC ++   +GCC +  AVCC D   CCP    C
Sbjct:  207 TFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCV----SQTGEGPLLPQMPAIREESANQVPCDATTKKETCC--------------RLVSGKWGCCPVVKAVCCNDHLHCCPEGYTC--SQGECSKMEHSIPWFTKTPALTHEARDVECDDM----------YSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC--SGGQC--QKGEHSIPLFSKTPALRQETKYVKCDDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC 469          

HSP 3 Score: 105.916 bits (263), Expect = 1.023e-23
Identity = 93/329 (28.27%), Postives = 132/329 (40.12%), Query Frame = 3
Query:  252 TERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGNH 1238
            T+++TCC+     + CC    AVCC D  HCCPEG TC   Q +C K  + ++      PAL  E           V   D   CP+ +T C+           ++ CCP   AVCC D   CCP   TC     +C    HSI   ++     + + ET + K            +     C + +G  G C  +   CC D   CCP    C    ++C +         SK      +   V C D+   C   +TCC ++   +GCC +  AVCC+D   CCP    CD +  +CV            + P  +K      DG H
Sbjct:  284 TKKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTC--SQGECSK-MEHSIPWFTKTPALTHEAR--------DVECDDMYSCPDGQTCCRLAS-------GDWGCCPIAQAVCCDDHEHCCPPGYTC--SGGQCQKGEHSIPLFSKT---PALRQETKYVKCDD-----THSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC--SGSQCMIGEHSI-PWFSKTPALKQKAKDVQC-DDMYSCADGQTCCRLASGDWGCCPIAQAVCCSDHWHCCPQGFTCDAR-GTCVLGQ--------FSIPWLTKVPALPFDGTH 571          

HSP 4 Score: 83.5741 bits (205), Expect = 1.499e-16
Identity = 89/322 (27.64%), Postives = 118/322 (36.65%), Query Frame = 3
Query:  246 KCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRC--------------KFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNK 1169
             C + QTCC+     + CC  A AVCC D  HCCP G TC   Q       + ++      PALK               +  +V C ++   C D +TCC     ++ CCP   AVCCSD + CCP+  TCD +   C     SI  +         K     F     +             CP   G   RC                 A  C   L +     + C +      L     +T  S  S    RL  V C D++  CF  +TCC      + CC     VCC D V CCP+   C     SC  + S +
Sbjct:  430 SCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGSQ---CMIGEHSIPWFSKTPALK--------------QKAKDVQC-DDMYSCADGQTCCRLASGDWGCCPIAQAVCCSDHWHCCPQGFTCDARG-TCVLGQFSIPWLT--------KVPALPFDGTHSICDDTHTCPSGTTCCP-GEGGGWRCCPVEEVSKMVKRTVILLATACIVTLVS----FSFCPDIIIYYALQKEAIETSPSDTSVQGLRLDYVWC-DSQYACFDGQTCCRGLGGVWNCCVYTQGVCCPDMVHCCPYGYVCLNHGTSCSRSGSPR 718          

HSP 5 Score: 81.2629 bits (199), Expect = 8.217e-16
Identity = 86/293 (29.35%), Postives = 110/293 (37.54%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASK---SDFY--------CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENA 1079
            +    C + QTCC+     + CC  A AVCC D  HCCP G TC   Q  C K  + ++ +    PAL+ E +         V   D   C + +T C+           ++ CCP   AVCC D   CCP   TC     +C    HSI                 F K  +L    KQKA      D Y        C + +G  G C  +   CCSD   CCPQ   CD +   C L    F        P      T    D+   C S  TCC      + CC +E  
Sbjct:  352 DDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQ--CQK-GEHSIPLFSKTPALRQETK--------YVKCDDTHSCADGQTCCRLAS-------GDWGCCPIAQAVCCDDHEHCCPPGYTC--SGSQCMIGEHSI---------------PWFSKTPAL----KQKAKDVQCDDMYSCADGQTCCRLASGDWGCCPIAQAVCCSDHWHCCPQGFTCDARGT-CVLGQ--FSIPWLTKVPALPFDGTHSICDDTHTCPSGTTCCPGEGGGWRCCPVEEV 602          

HSP 6 Score: 72.7886 bits (177), Expect = 4.161e-13
Identity = 46/136 (33.82%), Postives = 65/136 (47.79%), Query Frame = 3
Query:  810 NGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSD-KSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLT--FPKRSK 1208
             G +  C  + G  C D   CC   + C +  + C               P +N+ S VVCPD  +EC +  TCC +SD  S+GCC +  AVCC D + CCPHN +CD++   C+    + + H P     P R K
Sbjct:   76 EGGTACCPLAEGKSCQDGHHCCSVGSYCSDDGHYCI--------------PASNQ-SAVVCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCI----SNQDHIPWMSKLPARVK 192          
BLAST of Granulin b vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 119.783 bits (299), Expect = 2.319e-28
Identity = 102/350 (29.14%), Postives = 148/350 (42.29%), Query Frame = 3
Query:  198 ASNKETVGNICPNKRTKCTERQTCCQ-TKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKAS---------KSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRK 1217
            ASN+  V  +CP+ R++C    TCC  +  +S+ CC    AVCC D  HCCP  S CD +Q +C+        M KL   +K E +      E +V   D   CP+         TCC    + Y CC   +AVCCSD   CCP  TTCD+ +KKC S                   +T    ++  +   +++++         K +  C + +G+ G C      CC+D   CCP+   C +       +S  + T   K    T+    V C D+   C   +TCC ++   +GCC +  AVCC D   CCP          +C      K  H    F K    R+
Sbjct:  133 ASNQSAV--VCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGDE-----ERRVPCLDGTFCPDG-------STCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVS-------------------QTGEGPLLPQMPAIREESANQVPCDATTKKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCSQGECSKMEHSIPWFT---KTPALTHEARDVEC-DDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGY-------TCSGGQCQKGEHSIPLFSKTPALRQ 438          

HSP 2 Score: 109.768 bits (273), Expect = 4.442e-25
Identity = 85/297 (28.62%), Postives = 118/297 (39.73%), Query Frame = 3
Query:  243 TKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQ--ELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKC 1127
            T C +  TCC+   ++Y CC   +AVCC D  HCCP G+TCD    KCV    S    G L+P +    E   N +      K E  C                    + CCP   AVCC+D   CCPE  TC     +C+   HSI    +   L H++   E +                     C + +G  G C  +   CC D   CCP    C     +   +S    ++    +P   + +  V  D+   C   +TCC ++   +GCC +  AVCC D   CCP    C
Sbjct:  227 TFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCV----SQTGEGPLLPQMPAIREESANQVPCDATTKKETCC--------------RLVSGKWGCCPVVKAVCCNDHLHCCPEGYTC--SQGECSKMEHSIPWFTKTPALTHEARDVECDDM----------YSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQCQKGEHSIPLFSK----TPALRQETKYVKCDDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC 489          

HSP 3 Score: 105.531 bits (262), Expect = 1.134e-23
Identity = 93/329 (28.27%), Postives = 132/329 (40.12%), Query Frame = 3
Query:  252 TERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGNH 1238
            T+++TCC+     + CC    AVCC D  HCCPEG TC   Q +C K  + ++      PAL  E           V   D   CP+ +T C+           ++ CCP   AVCC D   CCP   TC     +C    HSI   ++     + + ET + K            +     C + +G  G C  +   CC D   CCP    C    ++C +         SK      +   V C D+   C   +TCC ++   +GCC +  AVCC+D   CCP    CD +  +CV            + P  +K      DG H
Sbjct:  304 TKKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTC--SQGECSK-MEHSIPWFTKTPALTHEAR--------DVECDDMYSCPDGQTCCRLAS-------GDWGCCPIAQAVCCDDHEHCCPPGYTC--SGGQCQKGEHSIPLFSKT---PALRQETKYVKCDD-----THSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC--SGSQCMIGEHSI-PWFSKTPALKQKAKDVQC-DDMYSCADGQTCCRLASGDWGCCPIAQAVCCSDHWHCCPQGFTCDAR-GTCVLGQ--------FSIPWLTKVPALPFDGTH 591          

HSP 4 Score: 83.5741 bits (205), Expect = 1.727e-16
Identity = 89/321 (27.73%), Postives = 118/321 (36.76%), Query Frame = 3
Query:  249 CTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRC--------------KFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNK 1169
            C + QTCC+     + CC  A AVCC D  HCCP G TC   Q       + ++      PALK               +  +V C ++   C D +TCC     ++ CCP   AVCCSD + CCP+  TCD +   C     SI  +         K     F     +             CP   G   RC                 A  C   L +     + C +      L     +T  S  S    RL  V C D++  CF  +TCC      + CC     VCC D V CCP+   C     SC  + S +
Sbjct:  451 CADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGSQ---CMIGEHSIPWFSKTPALK--------------QKAKDVQC-DDMYSCADGQTCCRLASGDWGCCPIAQAVCCSDHWHCCPQGFTCDARG-TCVLGQFSIPWLT--------KVPALPFDGTHSICDDTHTCPSGTTCCP-GEGGGWRCCPVEEVSKMVKRTVILLATACIVTLVS----FSFCPDIIIYYALQKEAIETSPSDTSVQGLRLDYVWC-DSQYACFDGQTCCRGLGGVWNCCVYTQGVCCPDMVHCCPYGYVCLNHGTSCSRSGSPR 738          

HSP 5 Score: 81.2629 bits (199), Expect = 9.375e-16
Identity = 86/288 (29.86%), Postives = 109/288 (37.85%), Query Frame = 3
Query:  249 CTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASK---SDFY--------CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENA 1079
            C + QTCC+     + CC  A AVCC D  HCCP G TC   Q  C K  + ++ +    PAL+ E +         V   D   C + +T C+           ++ CCP   AVCC D   CCP   TC     +C    HSI                 F K  +L    KQKA      D Y        C + +G  G C  +   CCSD   CCPQ   CD +   C L    F        P      T    D+   C S  TCC      + CC +E  
Sbjct:  377 CPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQ--CQK-GEHSIPLFSKTPALRQETK--------YVKCDDTHSCADGQTCCRLAS-------GDWGCCPIAQAVCCDDHEHCCPPGYTC--SGSQCMIGEHSI---------------PWFSKTPAL----KQKAKDVQCDDMYSCADGQTCCRLASGDWGCCPIAQAVCCSDHWHCCPQGFTCDARGT-CVLGQ--FSIPWLTKVPALPFDGTHSICDDTHTCPSGTTCCPGEGGGWRCCPVEEV 622          

HSP 6 Score: 72.7886 bits (177), Expect = 4.334e-13
Identity = 46/136 (33.82%), Postives = 65/136 (47.79%), Query Frame = 3
Query:  810 NGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSD-KSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLT--FPKRSK 1208
             G +  C  + G  C D   CC   + C +  + C               P +N+ S VVCPD  +EC +  TCC +SD  S+GCC +  AVCC D + CCPHN +CD++   C+    + + H P     P R K
Sbjct:   96 EGGTACCPLAEGKSCQDGHHCCSVGSYCSDDGHYCI--------------PASNQ-SAVVCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCI----SNQDHIPWMSKLPARVK 212          
BLAST of Granulin b vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 117.087 bits (292), Expect = 2.029e-27
Identity = 98/347 (28.24%), Postives = 146/347 (42.07%), Query Frame = 3
Query:  198 ASNKETVGNICPNKRTKCTERQTCCQ-TKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNIL--EAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKAS-----KSDFYCP-------ITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTF 1193
            ASN+  V  +CP+ R++C    TCC  +  +S+ CC    AVCC D  HCCP  S CD +Q +C+        M KL   +K E      +   E +V   D   CP+         TCC    + Y CC   +AVCCSD   CCP  TTCD+ +KKC S                   +T    ++  +   +++++      +   CP       +++ + G C ++   CC D   CCP    C   +     +S  +  +       T R+      D+   C   ETCC +    +GCC +  AVCC D + CCP    C     S +E +       P+ F
Sbjct:  113 ASNQSAV--VCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGLKLVGLGDEERRVPCLDGTFCPDG-------STCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVS-------------------QTGEGPLLPQMPAIREESANQVPCDATTSCPDKNTCCHLSSEKWGCCPYAQAVCCDDHIHCCPSGFTCSGGSCVLAEHSIPWMRKTLAQGLKTTRVQC----DDTASCPEKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCSQGECSKMEHSIPWFTKTPMVF 427          

HSP 2 Score: 107.842 bits (268), Expect = 2.332e-24
Identity = 92/335 (27.46%), Postives = 128/335 (38.21%), Query Frame = 3
Query:  243 TKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSK----------HSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRK 1217
            T C +  TCC+   ++Y CC   +AVCC D  HCCP G+TCD    KCV    S    G L+P +    E   N +           CP+  T C  +          + CCP+  AVCC D   CCP   TC      C  + HSI  M + L            K   +         + +  C + +G+ G C      CC+D   CCP+   C +       +S  + T+               P  +    V C D+   C   +TCC ++   +GCC +  AVCC D   CCP          +C      K  H    F K    R+
Sbjct:  214 TFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCV----SQTGEGPLLPQMPAIREESANQVPCDATTS----CPDKNTCCHLSS-------EKWGCCPYAQAVCCDDHIHCCPSGFTC--SGGSCVLAEHSIPWMRKTLAQG--------LKTTRVQCDDTASCPEKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCSQGECSKMEHSIPWFTKTPMVFFLSLSLLSILPVVSVARDVEC-DDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGY-------TCSGGQCQKGEHSIPLFSKTPALRQ 515          

HSP 3 Score: 93.5893 bits (231), Expect = 9.943e-20
Identity = 89/346 (25.72%), Postives = 126/346 (36.42%), Query Frame = 3
Query:  189 QGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFY--------CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHS----------------PTTNRLSTVVCP---------DNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKC 1127
            Q  A  +E+   +  +  T C ++ TCC      + CC YA AVCC D  HCCP G TC      CV    S   M K +            +   +V   D   CP  +T C+            + CCP   AVCC+D   CCPE  TC     +C+   HSI    +  +     + +     I  ++   +     D Y        C + +G  G C  +   CC D   CCP    C     +   +S    ++                     P     S  +CP         D+   C   +TCC ++   +GCC +  AVCC D   CCP    C
Sbjct:  273 QMPAIREESANQVPCDATTSCPDKNTCCHLSSEKWGCCPYAQAVCCDDHIHCCPSGFTCSGG--SCVLAEHSIPWMRKTL---------AQGLKTTRVQCDDTASCPEKETCCRLVS-------GKWGCCPVVKAVCCNDHLHCCPEGYTC--SQGECSKMEHSIPWFTKTPM---VFFLSLSLLSILPVVSVARDVECDDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQCQKGEHSIPLFSKTPALRQETACARRCGDDEYPFPLCLLFSPFICPFSVAKYVKCDDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC 595          

HSP 4 Score: 92.4337 bits (228), Expect = 2.400e-19
Identity = 83/311 (26.69%), Postives = 125/311 (40.19%), Query Frame = 3
Query:  243 TKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXX-XXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCP-------ITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCV 1151
            + C +  +C  T      CC  A    C D  HCC  GS C    H C+                     P +N        +  V+CP+ +++C    TC  ++  +++ CCP   AVCC D   CCP  + CD++  +C S+   I  M++       + ++   K++ L    ++       +CP         +   G C   +  CCSD   CCP  T CD  + KC   + +        +      + V C D  T C    TCC +S + +GCC    AVCC D + CCP    C     SCV
Sbjct:   63 SGCPDEYSCVNTPEGGTACCPLAEGKSCQDGHHCCSVGSYCSDDGHYCI---------------------PASN--------QSAVVCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKL----PARVKSEGLKLVGLGDEERRVPCLDGTFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPLLPQMPAIREESANQVPC-DATTSCPDKNTCCHLSSEKWGCCPYAQAVCCDDHIHCCPSGFTC--SGGSCV 337          

HSP 5 Score: 92.0485 bits (227), Expect = 3.345e-19
Identity = 103/371 (27.76%), Postives = 142/371 (38.27%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVE---------DE---PKTNILEAKV---NEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASK---SDFY--------CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSK----------HSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGNH 1238
            +    C + QTCC+     + CC  A AVCC D  HCCP G TC   Q  C K  + ++ +    PAL+ E         DE   P   +    +   +    V C ++   C D +TCC     ++ CCP   AVCC D   CCP   TC     +C    HSI                 F K  +L    KQKA      D Y        C + +G  G C  +   CC D   CCP    C     +   +S  + ++             ++P       +V  D+   C    TCC +    +GCC +E AVCC+D   CCP    CD +  +CV            + P  +K      DG H
Sbjct:  449 DDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQ--CQK-GEHSIPLFSKTPALRQETACARRCGDDEYPFPLCLLFSPFICPFSVAKYVKC-DDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC--SGSQCMIGEHSI---------------PWFSKTPAL----KQKAKDVQCDDMYSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQCQKGEHSIPWYSKTPALKQEGKCNLANTPVNVFAGNIVKCDDSFACKDGYTCCRMVSGVWGCCPIEKAVCCSDHWHCCPQGFTCDAR-GTCVLGQ--------FSIPWLTKVPALPFDGTH 785          

HSP 6 Score: 90.1225 bits (222), Expect = 1.308e-18
Identity = 103/366 (28.14%), Postives = 131/366 (35.79%), Query Frame = 3
Query:  249 CTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSI------HEMAQELIHDSFKYETNFFK--IISLLLGFKQKASKSDFY--CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLN-----------STDFD--------------------------------------TEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNK 1169
            C + QTCC+     + CC  A AVCC D  HCCP G TC   Q       + ++      PALK               +  +V C ++   C D +TCC     ++ CCP   AVCC D   CCP   TC     +C    HSI        + QE   +      N F   I+     F  K    D Y  C + +G  G C      CCSD   CCPQ   CD +   C L            +  FD                                      T  S  S    RL  V C D++  CF  +TCC      + CC     VCC D V CCP+   C     SC  + S +
Sbjct:  557 CADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGSQ---CMIGEHSIPWFSKTPALK--------------QKAKDVQC-DDMYSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC--SGGQCQKGEHSIPWYSKTPALKQEGKCNLANTPVNVFAGNIVKCDDSFACK----DGYTCCRMVSGVWGCCPIEKAVCCSDHWHCCPQGFTCDARGT-CVLGQFSIPWLTKVPALPFDGTHSICDDTHTCPSGTTCCPGEGGGWRCCPVEEKEAIETSPSDTSVQGLRLDYVWC-DSQYACFDGQTCCRGLGGVWNCCVYTQGVCCPDMVHCCPYGYVCLNHGTSCSRSGSPR 896          

HSP 7 Score: 72.7886 bits (177), Expect = 5.736e-13
Identity = 45/142 (31.69%), Postives = 67/142 (47.18%), Query Frame = 3
Query:  813 GRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSD-KSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGN 1235
            G +  C  + G  C D   CC   + C +  + C               P +N+ S VVCPD  +EC +  TCC +SD  S+GCC +  AVCC D + CCPHN +CD++   C+    +      L    +S+  K +  G+
Sbjct:   77 GGTACCPLAEGKSCQDGHHCCSVGSYCSDDGHYCI--------------PASNQ-SAVVCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGLKLVGLGD 203          
BLAST of Granulin b vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 115.546 bits (288), Expect = 6.262e-27
Identity = 94/325 (28.92%), Postives = 139/325 (42.77%), Query Frame = 3
Query:  198 ASNKETVGNICPNKRTKCTERQTCCQ-TKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNIL--EAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKAS-----KSDFYCP-------ITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKC 1127
            ASN+  V  +CP+ R++C    TCC  +  +S+ CC    AVCC D  HCCP  S CD +Q +C+        M KL   +K E      +   E +V   D   CP+         TCC    + Y CC   +AVCCSD   CCP  TTCD+ +KKC S                   +T    ++  +   +++++      +   CP       +++ + G C ++   CC D   CCP    C   +     +S  +  +       T R+      D+   C   ETCC +    +GCC +  AVCC D + CCP    C
Sbjct:  113 ASNQSAV--VCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGLKLVGLGDEERRVPCLDGTFCPDG-------STCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVS-------------------QTGEGPLLPQMPAIREESANQVPCDATTSCPDKNTCCHLSSEKWGCCPYAQAVCCDDHIHCCPSGFTCSGGSCVLAEHSIPWMRKTLAQGLKTTRVQC----DDTASCPEKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTC 405          

HSP 2 Score: 110.538 bits (275), Expect = 2.984e-25
Identity = 93/325 (28.62%), Postives = 128/325 (39.38%), Query Frame = 3
Query:  243 TKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRK 1217
            T C +  TCC+   ++Y CC   +AVCC D  HCCP G+TCD    KCV    S    G L+P +    E   N +           CP+  T C  +          + CCP+  AVCC D   CCP   TC      C  + HSI  M + L            K   +         + +  C + +G+ G C      CC+D   CCP+   C +       +S  + T   K    T+    V C D+   C   +TCC ++   +GCC +  AVCC D   CCP          +C      K  H    F K    R+
Sbjct:  214 TFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCV----SQTGEGPLLPQMPAIREESANQVPCDATTS----CPDKNTCCHLSS-------EKWGCCPYAQAVCCDDHIHCCPSGFTC--SGGSCVLAEHSIPWMRKTL--------AQGLKTTRVQCDDTASCPEKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCSQGECSKMEHSIPWFT---KTPALTHEARDVEC-DDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGY-------TCSGGQCQKGEHSIPLFSKTPALRQ 502          

HSP 3 Score: 98.9821 bits (245), Expect = 2.088e-21
Identity = 87/315 (27.62%), Postives = 123/315 (39.05%), Query Frame = 3
Query:  189 QGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQ--ELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKC 1127
            Q  A  +E+   +  +  T C ++ TCC      + CC YA AVCC D  HCCP G TC      CV    S   M K +            +   +V   D   CP  +T C+            + CCP   AVCC+D   CCPE  TC     +C+   HSI    +   L H++   E +                     C + +G  G C  +   CC D   CCP    C     +   +S    ++    +P   + +  V  D+   C   +TCC ++   +GCC +  AVCC D   CCP    C
Sbjct:  273 QMPAIREESANQVPCDATTSCPDKNTCCHLSSEKWGCCPYAQAVCCDDHIHCCPSGFTCSGG--SCVLAEHSIPWMRKTL---------AQGLKTTRVQCDDTASCPEKETCCRLVS-------GKWGCCPVVKAVCCNDHLHCCPEGYTC--SQGECSKMEHSIPWFTKTPALTHEARDVECDDM----------YSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQCQKGEHSIPLFSK----TPALRQETKYVKCDDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC 553          

HSP 4 Score: 92.4337 bits (228), Expect = 2.663e-19
Identity = 89/338 (26.33%), Postives = 131/338 (38.76%), Query Frame = 3
Query:  243 TKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXX-XXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCP-------ITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDG 1232
            + C +  +C  T      CC  A    C D  HCC  GS C    H C+                     P +N        +  V+CP+ +++C    TC  ++  +++ CCP   AVCC D   CCP  + CD++  +C S+   I  M++       + ++   K++ L    ++       +CP         +   G C   +  CCSD   CCP  T CD  + KC   + +        +      + V C D  T C    TCC +S + +GCC    AVCC D + CCP    C     SCV           L        RKTL  G
Sbjct:   63 SGCPDEYSCVNTPEGGTACCPLAEGKSCQDGHHCCSVGSYCSDDGHYCI---------------------PASN--------QSAVVCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKL----PARVKSEGLKLVGLGDEERRVPCLDGTFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPLLPQMPAIREESANQVPC-DATTSCPDKNTCCHLSSEKWGCCPYAQAVCCDDHIHCCPSGFTC--SGGSCV-----------LAEHSIPWMRKTLAQG 353          

HSP 5 Score: 72.7886 bits (177), Expect = 5.039e-13
Identity = 45/143 (31.47%), Postives = 67/143 (46.85%), Query Frame = 3
Query:  810 NGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSD-KSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGN 1235
             G +  C  + G  C D   CC   + C +  + C               P +N+ S VVCPD  +EC +  TCC +SD  S+GCC +  AVCC D + CCPHN +CD++   C+    +      L    +S+  K +  G+
Sbjct:   76 EGGTACCPLAEGKSCQDGHHCCSVGSYCSDDGHYCI--------------PASNQ-SAVVCPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGLKLVGLGD 203          

HSP 6 Score: 65.855 bits (159), Expect = 8.665e-11
Identity = 87/330 (26.36%), Postives = 119/330 (36.06%), Query Frame = 3
Query:  249 CTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGNH 1238
            C + QTCC+     + CC  A AVCC D  HCCP G TC   Q       + ++      PALK               +  +V C ++   C D +TCC     ++ CCP   AVCC D   CCP   TC     +C    HSI   ++     + K E N  K           A K  + C         C+  +G     +  CCP    C        L          K  P+   L+   C   +    S +  C     ++ C     AVCC+D   CCP    CD +  +CV            + P  +K      DG H
Sbjct:  515 CADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGSQ---CMIGEHSIPWFSKTPALK--------------QKAKDVQC-DDMYSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC--SGGQCQKGEHSIPWYSKT---PALKQEGNIVKCDDSF------ACKDGYTC---------CRMVSG-----VWGCCPIEKCCQTHTPLLPLQ---------KCCPSLPILALATCHVQD----SVQDSCTRLQSTHWC---RTAVCCSDHWHCCPQGFTCDAR-GTCVLGQ--------FSIPWLTKVPALPFDGTH 776          
BLAST of Granulin b vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 122.865 bits (307), Expect = 9.793e-30
Identity = 99/325 (30.46%), Postives = 139/325 (42.77%), Query Frame = 3
Query:  195 FASNKETVGNI-CPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFY---------CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPT----TNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKC 1127
            F  +   +G + CP  + +C +  TCC     S+ CC    A CC D+ HCCP G++CD    +CV    ++  + K  PA K             V+    V+CP+ KT+C D  TCC      Y CCP  NA+CCSD   CCP+ T CD+   KC S                  Y T+   +++ L G+  K  K D           C +  G  G C F+   CC D   CCP   +C  +   C +        K   +P        L +    D+ T C +  TCC ++   +GCC +  AVCC+D   CCP    C
Sbjct:  126 FQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLLKKF-PAQKT---------NRAVSLPFSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSK----------------NYTTD---LLTKLPGYPVKEVKCDMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQVPWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTC 421          

HSP 2 Score: 119.398 bits (298), Expect = 1.416e-28
Identity = 91/308 (29.55%), Postives = 131/308 (42.53%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
            +CP+ +T+C +  TCC+     Y CC   NA+CC D  HCCP+ + CD  Q KC+    +   + KL         P   + E K +   EV CP   T C+            + CCP   AVCC D   CCP    C  +   C      +  M +++I      +    K  +    F  +   ++  C + +G  G C      CCSD + CCPQ   C  +      ++     EK     TT      +  D  T C   +TCC     S+ CC+L +AVCC DR  CCP    C++K  +C
Sbjct:  219 VCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDLLTKL---------PGYPVKEVKCDM--EVSCPEGYTCCRLNT-------GAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQVPWM-KKVIAPLRLPDPQILKSDTPCDDFT-RCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTCLAQGYCQKGDTMVAGLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTC 506          

HSP 3 Score: 107.071 bits (266), Expect = 2.305e-24
Identity = 89/327 (27.22%), Postives = 133/327 (40.67%), Query Frame = 3
Query:  249 CTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNF-FKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC----VETNSNKRRHFPLTFPKRSKFR 1214
            C    +C  T   +  CC ++  V C D +HCCP+G  C A    C                            +   N    V CP ++ +C D+ TCCI    ++ CCP   A CC D+  CCP   +CD+ + +C  SP   H + ++          +  F ++      K +       C +  G+ G C      CCSD   CCPQ T CD   +KC   S ++ T+     P    +  V C D E  C    TCC ++  ++GCC    AVCC D + CCP   +C  +  +C    ++    K+   PL  P     +
Sbjct:   80 CPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSC---------------------------FQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCV-SPTGTHTLLKKFPAQKTNRAVSLPFSVVC--PDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCL--SKNYTTDLLTKLP-GYPVKEVKC-DMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQVPWMKKVIAPLRLPDPQILK 372          

HSP 4 Score: 100.138 bits (248), Expect = 3.887e-22
Identity = 85/316 (26.90%), Postives = 119/316 (37.66%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHF 1181
            +    C E  TCC+    ++ CC +A AVCC D  HCCP G  C  ++  C         M K+I  L++ D     IL++     D   CP N T CK           ++ CCP   AVCCSD   CCP+  TC +    C      +  + +         +T   +I  +              CP   G    C+     CC D + CCP    C+ K   C     DF  +         ++  V C +    C   +TCC  S   + CC     VCC D   CCP    C  +   C+     +   F
Sbjct:  296 DMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQVPWMKKVIAPLRLPDP---QILKSDTPCDDFTRCPTNNTCCKLNS-------GDWGCCPIPEAVCCSDNQHCCPQGFTC-LAQGYCQKGDTMVAGLEKIPAR-----QTTPLQIGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCE-KDVDF-IQPPVLLTLGPKVGNVECGEGHF-CHDNQTCCKDSAGVWACCPYLKGVCCRDGRHCCPGGFHCSARGTKCLRKKIPRWDMF 592          

HSP 5 Score: 67.781 bits (164), Expect = 1.268e-11
Identity = 49/149 (32.89%), Postives = 71/149 (47.65%), Query Frame = 3
Query:  216 VGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKC 662
            +G+I  ++ T C   QTCC +   S+ CC+  +AVCC D+ HCCP G TC+ K   C K      ++  + P + +   PK   +E          C +N+T CKD+          + CCP+   VCC D   CCP    C  +  KC
Sbjct:  450 IGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEK------DVDFIQPPVLLTLGPKVGNVECGEGH----FCHDNQTCCKDSA-------GVWACCPYLKGVCCRDGRHCCPGGFHCSARGTKC 581          
BLAST of Granulin b vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 75.485 bits (184), Expect = 3.345e-15
Identity = 48/136 (35.29%), Postives = 59/136 (43.38%), Query Frame = 3
Query:  786 SDFYCPIT-NGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNK--RRHFP 1184
            + + C +T +G S  C FS G  C D   CCPQ   C      C   S              N L  V CP ++ EC    TCC + D S+GCC +  A CC DRV CCPH   CD+    CV         + FP
Sbjct:   69 AGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSCFQMSD-------------NPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLLKKFP 191          

HSP 2 Score: 57.3806 bits (137), Expect = 4.955e-9
Identity = 43/152 (28.29%), Postives = 65/152 (42.76%), Query Frame = 3
Query:  249 CTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQEL 704
            C    +C  T   +  CC ++  V C D +HCCP+G  C A    C                 ++ D P              V CP ++ +C D+ TCCI    ++ CCP   A CC D+  CCP   +CD+ + +C  SP   H + ++ 
Sbjct:   67 CPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSC----------------FQMSDNPL-----------GAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCV-SPTGTHTLLKKF 190          

HSP 3 Score: 53.9138 bits (128), Expect = 7.499e-8
Identity = 41/151 (27.15%), Postives = 56/151 (37.09%), Query Frame = 3
Query:  573 CCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLS----TVVCPDNETEC 1013
            CCP    V C D Y CCP+   C    K C                  F+   N    +    G + +   S   C + +G  G C     +CC D   CCP    CD  + +C   +      K   +  TNR      +VVCPD +T+C
Sbjct:   83 CCPFSKGVSCGDGYHCCPQGFHCSADGKSC------------------FQMSDNPLGAVQCP-GSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLLKKFPAQKTNRAVSLPFSVVCPDAKTQC 214          

HSP 4 Score: 53.1434 bits (126), Expect = 1.314e-7
Identity = 32/107 (29.91%), Postives = 49/107 (45.79%), Query Frame = 3
Query:  195 FASNKETVGNI-CPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPN 512
            F  +   +G + CP  + +C +  TCC     S+ CC    A CC D+ HCCP G++CD    +CV    ++  + K  PA K             V+    V+CP+
Sbjct:  113 FQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLLKKF-PAQKTNR---------AVSLPFSVVCPD 209          
BLAST of Granulin b vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 67.781 bits (164), Expect = 2.544e-12
Identity = 49/149 (32.89%), Postives = 71/149 (47.65%), Query Frame = 3
Query:  216 VGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKC 662
            +G+I  ++ T C   QTCC +   S+ CC+  +AVCC D+ HCCP G TC+ K   C K      ++  + P + +   PK   +E          C +N+T CKD+          + CCP+   VCC D   CCP    C  +  KC
Sbjct:   95 IGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEK------DVDFIQPPVLLTLGPKVGNVECGEGH----FCHDNQTCCKDSA-------GVWACCPYLKGVCCRDGRHCCPGGFHCSARGTKC 226          

HSP 2 Score: 50.447 bits (119), Expect = 1.525e-6
Identity = 36/112 (32.14%), Postives = 46/112 (41.07%), Query Frame = 3
Query:  867 TCCPQHTKCDEKNNKCTLNSTDFD------------------TEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
            T C   T+C   N  C LNS D+                    EK     TT      +  D  T C   +TCC     S+ CC+L +AVCC DR  CCP    C++K  +C
Sbjct:   40 TPCDDFTRCPTNNTCCKLNSGDWGCCPIPEGYCQKGDTMVAGLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTC 151          

HSP 3 Score: 48.1358 bits (113), Expect = 8.290e-6
Identity = 24/59 (40.68%), Postives = 32/59 (54.24%), Query Frame = 3
Query:  216 VGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVK 392
            VGN+   +   C + QTCC+     + CC Y   VCC D  HCCP G  C A+  KC++
Sbjct:  170 VGNVECGEGHFCHDNQTCCKDSAGVWACCPYLKGVCCRDGRHCCPGGFHCSARGTKCLR 228          
BLAST of Granulin b vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 63.5438 bits (153), Expect = 1.404e-10
Identity = 46/142 (32.39%), Postives = 65/142 (45.77%), Query Frame = 3
Query:  243 TKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKL--IPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKC 662
            T+C    TCC+     + CC    AVCC D  HCCP+G TC A+ +    C K +  +  L  IPA +      T +    +       CP  +T C   K        ++ CC   +AVCC D+  CCP   TC++K + C
Sbjct:    3 TRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTCLAQGY----CQKGDTMVAGLEKIPARQT-----TPLQIGDIGCDQHTSCPVGQTCCPSLK-------GSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTC 128          

HSP 2 Score: 62.3882 bits (150), Expect = 3.315e-10
Identity = 40/118 (33.90%), Postives = 56/118 (47.46%), Query Frame = 3
Query:  798 CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTN-RLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
            C + +G  G C      CCSD + CCPQ   C  +      ++     EK     TT  ++  + C D  T C   +TCC     S+ CC+L +AVCC DR  CCP    C++K  +C
Sbjct:   12 CKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTCLAQGYCQKGDTMVAGLEKIPARQTTPLQIGDIGC-DQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTC 128          

HSP 3 Score: 54.6842 bits (130), Expect = 1.048e-7
Identity = 30/86 (34.88%), Postives = 46/86 (53.49%), Query Frame = 3
Query:  216 VGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILE 473
            +G+I  ++ T C   QTCC +   S+ CC+  +AVCC D+ HCCP G TC+ K   C K      ++  + P + +   PK   +E
Sbjct:   72 IGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEK------DVDFIQPPVLLTLGPKVGNVE 151          
BLAST of Granulin b vs. UniProt/SwissProt
Match: sp|P28799|GRN_HUMAN (Progranulin OS=Homo sapiens OX=9606 GN=GRN PE=1 SV=2)

HSP 1 Score: 144.05 bits (362), Expect = 3.504e-36
Identity = 101/327 (30.89%), Postives = 138/327 (42.20%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRS 1205
            +CP+ R++C +  TCC+     Y CC   NA CC D  HCCP+ + CD  Q KC+    +  ++   +PA  V D          V    EV CP+  T C+            + CCP   AVCC D   CCP   TCD +   C   PH +  M +   H S        + +            SD  C +T+G  G C      CCSD + CCPQ   C  +      +      EK      +      +  D  T C   +TCC     S+ CC+L +AVCC DR  CCP    C++K  SC +   + +   P TF  RS
Sbjct:  207 MCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGD----------VKCDMEVSCPDGYTCCRLQS-------GAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVP--CDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQ---PATFLARS 511          

HSP 2 Score: 128.642 bits (322), Expect = 8.150e-31
Identity = 98/317 (30.91%), Postives = 138/317 (43.53%), Query Frame = 3
Query:  201 SNKETVGNI-CPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQEL-IHDSFKYETNFFKIISLLLGFKQKASKSDFY--CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHS----PTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKC 1127
            S   +VG I CP+ + +C +  TCC     S+ CC    A CC D+ HCCP G+ CD    +C+        + K +PA +             V     VMCP+ +++C D  TCC      Y CCP  NA CCSD   CCP+ T CD+   KC S  ++  ++  +L  H     + +             + S  D Y  C + +G  G C F+   CC D   CCP    CD +   C          +   +    P    L   V  DN + C S +TCC ++   +GCC +  AVCC+D   CCP    C
Sbjct:  116 SGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCIT-PTGTHPLAKKLPAQRTNR---------AVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDM------------EVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTC 410          

HSP 3 Score: 103.99 bits (258), Expect = 1.506e-22
Identity = 90/336 (26.79%), Postives = 131/336 (38.99%), Query Frame = 3
Query:  213 TVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLL-LGFKQKAS--KSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKF 1211
            TVG++  +    C +  TCC+ +  ++ CC +  AVCC D  HCCP G TCD ++  C +       M K    L +   P    L+  V   +   CP++ T C+ T          + CCP   AVCCSD   CCP+  TC +   +C        +   E++    K       +     +G  Q  S       CP   G    C+     CC D + CCP    C+ K   C                    +  V C +    C   +TCC  + + + CC     VCCADR  CCP   +C  +   C+   +  R   PL  P   + 
Sbjct:  278 TVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSL---PDPQALKRDVPCDNVSSCPSSDTCCQLTS-------GEWGCCPIPEAVCCSDHQHCCPQGYTC-VAEGQC--------QRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHF-CHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREA-PRWDAPLRDPALRQL 592          

HSP 4 Score: 84.7297 bits (208), Expect = 2.714e-16
Identity = 55/199 (27.64%), Postives = 81/199 (40.70%), Query Frame = 3
Query:  573 CCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFY--CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRL----STVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCV 1151
            CCP   AV C D + CCP    C    + C                    ++ +    +  +     +    DF   C + +G  G C     +CC D   CCP    CD  + +C   +      K   +  TNR     S+V+CPD  + C    TCC +    YGCC + NA CC+D + CCP +  CD+  + C+
Sbjct:   83 CCPFPEAVACGDGHHCCPRGFHCSADGRSC--------------------FQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCL 261          

HSP 5 Score: 72.0182 bits (175), Expect = 3.752e-12
Identity = 39/115 (33.91%), Postives = 52/115 (45.22%), Query Frame = 3
Query:  807 TNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCV 1151
             +G S  C F     C D   CCP+   C      C   S +            N +  + CPD++ EC  + TCC + D S+GCC +  A CC DRV CCPH   CD+    C+
Sbjct:   77 VSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGN------------NSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCI 179          
BLAST of Granulin b vs. UniProt/SwissProt
Match: sp|P23785|GRN_RAT (Progranulin OS=Rattus norvegicus OX=10116 GN=Grn PE=1 SV=3)

HSP 1 Score: 128.257 bits (321), Expect = 8.860e-31
Identity = 102/306 (33.33%), Postives = 134/306 (43.79%), Query Frame = 3
Query:  228 CPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFY--CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEK----SKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKC 1127
            CP  + +C +  TCC     S+ CC    A CC D+ HCCP G++CD    +C+    ++       P LK     +TN   A  +    V+CP+ KT+C D  TCC      Y CCP  NA+CCSD   CCP+ T CD+   KC S      +   +L+     Y  N  K          + S  D Y  C +  G  G C F+   CC D   CCP   +C  +   C L        K    S   P    L   V  D+ + C S  TCC +S   +GCC +  AVCC D   CCP   KC
Sbjct:  125 CPGSQFECPDSATCCIMIDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCISPTGTH-------PLLKKFPAQRTNRAVASFS----VVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCISK-----DYTTDLMTKLPGYPVNEVKC-------DLEVSCPDGYTCCRLNTGAWGCCPFTKAVCCEDHIHCCPAGFQCHTETGTCELGVLQVPWMKKVTASLSLPDPQILKNDVPCDDFSSCPSNNTCCRLSSGDWGCCPMPEAVCCLDHQHCCPQGFKC 407          

HSP 2 Score: 124.79 bits (312), Expect = 1.693e-29
Identity = 100/339 (29.50%), Postives = 140/339 (41.30%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGNHF 1241
            +CP+ +T+C +  TCC+     Y CC   NA+CC D  HCCP+ + CD  Q KC+    +   M KL         P   + E K +   EV CP+  T C+            + CCP   AVCC D   CCP    C  +   C      +  M +     S   +    K       F    S ++  C +++G  G C      CC D + CCPQ  KC ++      +      EK     TT      +  D  T C   +TCC     S+ CC+L +AVCC DR  CCP    C++K  +C +   + +    LTF   SK         HF
Sbjct:  205 VCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCISKDYTTDLMTKL---------PGYPVNEVKCDL--EVSCPDGYTCCRLNT-------GAWGCCPFTKAVCCEDHIHCCPAGFQCHTETGTCELGVLQVPWMKKVTASLSLP-DPQILKNDVPCDDFSSCPS-NNTCCRLSSGDWGCCPMPEAVCCLDHQHCCPQGFKCMDEGYCQKGDRMVAGLEKMPVRQTTLLQHGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDAGSVQPSMDLTF--GSKVGNVECGAGHF 521          

HSP 3 Score: 108.997 bits (271), Expect = 3.132e-24
Identity = 93/332 (28.01%), Postives = 139/332 (41.87%), Query Frame = 3
Query:  240 RTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC----VETNSNKRRHFPLTFPKRSKFRKTL 1223
            R  C +  +C  T   +  CC ++  V C D  HCCP G  C A    C + + S                    +L A       V CP ++ +C D+ TCCI    ++ CCP   A CC D+  CCP   +CD+ + +C S P   H + ++            F ++      K +       C +  G+ G C      CCSD   CCPQ T CD   +KC   S D+ T+     P    ++ V C D E  C    TCC ++  ++GCC    AVCC D + CCP   +C  +T +C    ++    K+    L+ P     +  +
Sbjct:   64 RDHCPDGYSCLLTVSGTSSCCPFSEGVSCDDGQHCCPRGFHCSADGKSCSQISDS--------------------LLGA-------VQCPGSQFECPDSATCCIMIDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCIS-PTGTHPLLKKFPAQRTNRAVASFSVVCP--DAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCI--SKDYTTDLMTKLPGYP-VNEVKC-DLEVSCPDGYTCCRLNTGAWGCCPFTKAVCCEDHIHCCPAGFQCHTETGTCELGVLQVPWMKKVTASLSLPDPQILKNDV 361          

HSP 4 Score: 90.8929 bits (224), Expect = 3.500e-18
Identity = 77/312 (24.68%), Postives = 117/312 (37.50%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNK 1169
            +    C +  TCC+    ++ CC +  AVCC D  HCCP G  C  +   C         M K+  +L +   P   IL+  V   D   CP+N T C+ +         ++ CCP   AVCC D   CCP+   C +    C      +  + +  +      +T   +   +              CP   G    C+     CC D + CCP    C+ K   C  ++     + S      +++  V C      C   ++CC  S   + CC     VCC D   CCP    C  K   C+   + +
Sbjct:  282 DLEVSCPDGYTCCRLNTGAWGCCPFTKAVCCEDHIHCCPAGFQCHTETGTCELGVLQVPWMKKVTASLSL---PDPQILKNDVPCDDFSSCPSNNTCCRLSS-------GDWGCCPMPEAVCCLDHQHCCPQGFKC-MDEGYCQKGDRMVAGLEKMPVR-----QTTLLQHGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDAGS--VQPSMDLTFGSKVGNVECGAGHF-CHDNQSCCKDSQGGWACCPYVKGVCCRDGRHCCPIGFHCSAKGTKCLRKKTPR 574          

HSP 5 Score: 75.0998 bits (183), Expect = 4.444e-13
Identity = 68/260 (26.15%), Postives = 108/260 (41.54%), Query Frame = 3
Query:  168 FQLAWREQGFAS----NKETVGNICP-NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILE-AKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNST 929
             Q+ W ++  AS    + + + N  P +  + C    TCC+     + CC    AVCC D  HCCP+G  C  + +    C K +    +++  L+     +T +L+   +       CP  +T C   K        ++ CC   +AVCC D+  CCP   TC++K + C     S+ + + +L   S        K+ ++  G       +   C  + G    C +  G CC D R CCP    C  K  KC    T
Sbjct:  337 LQVPWMKKVTASLSLPDPQILKNDVPCDDFSSCPSNNTCCRLSSGDWGCCPMPEAVCCLDHQHCCPQGFKCMDEGY----CQKGD----RMVAGLEKMPVRQTTLLQHGDIGCDQHTSCPVGQTCCPSLK-------GSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDAGSV-QPSMDLTFGS--------KVGNVECGAGHFCHDNQSCCKDSQGGWACCPYVKGVCCRDGRHCCPIGFHCSAKGTKCLRKKT 572          
BLAST of Granulin b vs. UniProt/SwissProt
Match: sp|P28798|GRN_MOUSE (Progranulin OS=Mus musculus OX=10090 GN=Grn PE=1 SV=2)

HSP 1 Score: 122.479 bits (306), Expect = 8.678e-29
Identity = 99/325 (30.46%), Postives = 139/325 (42.77%), Query Frame = 3
Query:  195 FASNKETVGNI-CPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFY---------CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPT----TNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKC 1127
            F  +   +G + CP  + +C +  TCC     S+ CC    A CC D+ HCCP G++CD    +CV    ++  + K  PA K             V+    V+CP+ KT+C D  TCC      Y CCP  NA+CCSD   CCP+ T CD+   KC S                  Y T+   +++ L G+  K  K D           C +  G  G C F+   CC D   CCP   +C  +   C +        K   +P        L +    D+ T C +  TCC ++   +GCC +  AVCC+D   CCP    C
Sbjct:  113 FQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLLKKF-PAQKT---------NRAVSLPFSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSK----------------NYTTD---LLTKLPGYPVKEVKCDMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQVPWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTC 408          

HSP 2 Score: 119.398 bits (298), Expect = 1.138e-27
Identity = 91/308 (29.55%), Postives = 131/308 (42.53%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
            +CP+ +T+C +  TCC+     Y CC   NA+CC D  HCCP+ + CD  Q KC+    +   + KL         P   + E K +   EV CP   T C+            + CCP   AVCC D   CCP    C  +   C      +  M +++I      +    K  +    F  +   ++  C + +G  G C      CCSD + CCPQ   C  +      ++     EK     TT      +  D  T C   +TCC     S+ CC+L +AVCC DR  CCP    C++K  +C
Sbjct:  206 VCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDLLTKL---------PGYPVKEVKCDM--EVSCPEGYTCCRLNT-------GAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQVPWM-KKVIAPLRLPDPQILKSDTPCDDFT-RCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTCLAQGYCQKGDTMVAGLEKIPARQTTPLQIGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTC 493          

HSP 3 Score: 106.686 bits (265), Expect = 1.815e-23
Identity = 89/327 (27.22%), Postives = 133/327 (40.67%), Query Frame = 3
Query:  249 CTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNF-FKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC----VETNSNKRRHFPLTFPKRSKFR 1214
            C    +C  T   +  CC ++  V C D +HCCP+G  C A    C                            +   N    V CP ++ +C D+ TCCI    ++ CCP   A CC D+  CCP   +CD+ + +C  SP   H + ++          +  F ++      K +       C +  G+ G C      CCSD   CCPQ T CD   +KC   S ++ T+     P    +  V C D E  C    TCC ++  ++GCC    AVCC D + CCP   +C  +  +C    ++    K+   PL  P     +
Sbjct:   67 CPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSC---------------------------FQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCV-SPTGTHTLLKKFPAQKTNRAVSLPFSVVC--PDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCL--SKNYTTDLLTKLP-GYPVKEVKC-DMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQVPWMKKVIAPLRLPDPQILK 359          

HSP 4 Score: 100.138 bits (248), Expect = 3.282e-21
Identity = 85/316 (26.90%), Postives = 119/316 (37.66%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHF 1181
            +    C E  TCC+    ++ CC +A AVCC D  HCCP G  C  ++  C         M K+I  L++ D     IL++     D   CP N T CK           ++ CCP   AVCCSD   CCP+  TC +    C      +  + +         +T   +I  +              CP   G    C+     CC D + CCP    C+ K   C     DF  +         ++  V C +    C   +TCC  S   + CC     VCC D   CCP    C  +   C+     +   F
Sbjct:  283 DMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQVPWMKKVIAPLRLPDP---QILKSDTPCDDFTRCPTNNTCCKLNS-------GDWGCCPIPEAVCCSDNQHCCPQGFTC-LAQGYCQKGDTMVAGLEKIPAR-----QTTPLQIGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCE-KDVDF-IQPPVLLTLGPKVGNVECGEGHF-CHDNQTCCKDSAGVWACCPYLKGVCCRDGRHCCPGGFHCSARGTKCLRKKIPRWDMF 579          

HSP 5 Score: 67.781 bits (164), Expect = 9.291e-11
Identity = 49/149 (32.89%), Postives = 71/149 (47.65%), Query Frame = 3
Query:  216 VGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKC 662
            +G+I  ++ T C   QTCC +   S+ CC+  +AVCC D+ HCCP G TC+ K   C K      ++  + P + +   PK   +E          C +N+T CKD+          + CCP+   VCC D   CCP    C  +  KC
Sbjct:  437 IGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEK------DVDFIQPPVLLTLGPKVGNVECGEGH----FCHDNQTCCKDSA-------GVWACCPYLKGVCCRDGRHCCPGGFHCSARGTKC 568          
BLAST of Granulin b vs. UniProt/SwissProt
Match: sp|P28797|GRN_CAVPO (Progranulin OS=Cavia porcellus OX=10141 GN=GRN PE=1 SV=2)

HSP 1 Score: 110.538 bits (275), Expect = 1.051e-24
Identity = 93/369 (25.20%), Postives = 134/369 (36.31%), Query Frame = 3
Query:  192 GFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSS----PHSIHEMAQ---------------ELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGNHF 1241
            G          ICP+ R++C +  TCC      Y CC   NA+CC D  HCCP+ + CD +Q +C+   K+   + KL P+  V D          V    EV CP  +T C+            + CCP   AVCC D   CCPE   C  +   C       P +    AQ                      + E +  +++S   G        +  C + +G  G C  S G  C                  +C +       + + H  + ++ + V C D    C   +TCC      + CC+L +AVCC D   CCP    C++K  SC +         PL                HF
Sbjct:  210 GLLPAALPTSVICPDSRSQCPDDTTCCLLASGEYGCCPMPNAICCSDHLHCCPQDTVCDLRQSRCLSQNKAKTLLTKL-PSWTVWD----------VECDQEVSCPEGQTCCRLQS-------GKWGCCPFPKAVCCEDHVHCCPEGFRCHTEKDTCEQGLLQVPWAQKTPAQPSRPSQPSPPGPPGPPSPPGPLRSEISCDEVVSCAPG--------NICCRLASGEWGCCPSSEGYLCM--------------AGERCQVGDRLAPEKMAAHLMSLSQTTDVGC-DQHASCPVGQTCCPKLGGGWACCQLPHAVCCEDGQHCCPAGYTCNVKARSCEKAADGAHLAAPLAVGSTGGVMDVACGDRHF 537          

HSP 2 Score: 106.301 bits (264), Expect = 3.009e-23
Identity = 86/314 (27.39%), Postives = 125/314 (39.81%), Query Frame = 3
Query:  249 CTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCP--------------ITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
            C    +C  T   +  CC ++ A+ C D  HCCP G  C      C++                    P  ++L A      E  CP++ T C            ++ CCP   A CC D+  CCP   +CD+ + +C ++  S H +  +L      Y T       +  G    A  +   CP              + +G  G C      CCSD   CCPQ T CD + ++C L+     T  +K    T  +  V C D E  C   +TCC +    +GCC    AVCC D V CCP   +C  + ++C
Sbjct:   67 CPIGHSCVLTAAGTAACCPFSQAMACGDGHHCCPYGFHCSTDGGTCIQ-------------------RPDIHLLGAVQCPGGEFECPDSSTCCHMLD-------GSWGCCPMPQASCCEDRVHCCPHGASCDLVHIRCVTALGS-HPLTTKLPAQRTNY-TGAEGTPVVSPGLLPAALPTSVICPDSRSQCPDDTTCCLLASGEYGCCPMPNAICCSDHLHCCPQDTVCDLRQSRC-LSQNKAKTLLTKLPSWT--VWDVEC-DQEVSCPEGQTCCRLQSGKWGCCPFPKAVCCEDHVHCCPEGFRCHTEKDTC 348          

HSP 3 Score: 99.7525 bits (247), Expect = 3.869e-21
Identity = 70/234 (29.91%), Postives = 107/234 (45.73%), Query Frame = 3
Query:  228 CPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALK-----VEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKC 914
            CP    +C +  TCC     S+ CC    A CC D+ HCCP G++CD    +CV    S+    KL PA +      E  P  +           V+CP+++++C D  TCC+     Y CCP  NA+CCSD   CCP+ T CD++  +C S        A+ L+      +   + +  +    +    +    C + +G+ G C F    CC D   CCP+  +C  + + C
Sbjct:  126 CPGGEFECPDSSTCCHMLDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHIRCVTALGSHPLTTKL-PAQRTNYTGAEGTPVVSPGLLPAALPTSVICPDSRSQCPDDTTCCLLASGEYGCCPMPNAICCSDHLHCCPQDTVCDLRQSRCLS-----QNKAKTLL-----TKLPSWTVWDVECDQEVSCPEGQTCCRLQSGKWGCCPFPKAVCCEDHVHCCPEGFRCHTEKDTC 348          

HSP 4 Score: 86.6557 bits (213), Expect = 8.326e-17
Identity = 62/228 (27.19%), Postives = 92/228 (40.35%), Query Frame = 3
Query:  561 NNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCP-------ITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCT--LNSTDFDTE---------KSKHSPTTN-------RLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNK 1169
                CCP   A+ C D + CCP    C      C   P  IH                       LLG  Q     +F CP       + +G  G C     +CC D   CCP    CD  + +C   L S    T+          ++ +P  +         ++V+CPD+ ++C    TCC ++   YGCC + NA+CC+D + CCP +  CD++ + C+  N  K
Sbjct:   79 GTAACCPFSQAMACGDGHHCCPYGFHCSTDGGTCIQRP-DIH-----------------------LLGAVQ-CPGGEFECPDSSTCCHMLDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHIRCVTALGSHPLTTKLPAQRTNYTGAEGTPVVSPGLLPAALPTSVICPDSRSQCPDDTTCCLLASGEYGCCPMPNAICCSDHLHCCPQDTVCDLRQSRCLSQNKAK 281          

HSP 5 Score: 79.337 bits (194), Expect = 1.907e-14
Identity = 82/347 (23.63%), Postives = 122/347 (35.16%), Query Frame = 3
Query:  213 TVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKK--CTSSPHSIHEMAQEL--IHDSFKYETNFFKIISLL----LGFKQKAS--KSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTL 1223
            TV ++  ++   C E QTCC+ +   + CC +  AVCC D  HCCPEG  C  ++  C +     V   +  PA        +             +                           ++ + C +   C P    C + + +  C  S      MA E   + D    E     ++SL     +G  Q AS       CP   G    C+     CC D + CCP    C+ K   C   +            +T  +  V C D    C   +TCC  S   + CC     VCC D+  CCP    C+ +   CV   S    H+  + P+ +  R  L
Sbjct:  291 TVWDVECDQEVSCPEGQTCCRLQSGKWGCCPFPKAVCCEDHVHCCPEGFRCHTEKDTCEQ-GLLQVPWAQKTPAQPSRPSQPSPPGPPGPPSPPGPL---------------------------RSEISCDEVVSCAPGNICCRLASGEWGCCPSSEGYLCMAGERCQVGDRLAPEKMAAHLMSLSQTTDVGCDQHASCPVGQTCCPKLGGGWACCQLPHAVCCEDGQHCCPAGYTCNVKARSCEKAADGAHLAAPLAVGSTGGVMDVACGDRHF-CHDEQTCCRDSRGGWACCPFHQGVCCKDQRHCCPAGFHCESQGTRCVHKKS--LLHWD-SLPRPAAPRPRL 605          
BLAST of Granulin b vs. UniProt/SwissProt
Match: sp|Q54QR7|GRN_DICDI (Granulin OS=Dictyostelium discoideum OX=44689 GN=grn PE=3 SV=1)

HSP 1 Score: 50.447 bits (119), Expect = 1.989e-6
Identity = 29/70 (41.43%), Postives = 36/70 (51.43%), Query Frame = 3
Query:  939 TEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
            T+KS     T    +V CPD    C +  TCC+ SD SY CC   NA CC+D+  CCP+   C    N C
Sbjct:   50 TKKSLELTETQDFGSVKCPDGSL-CPNSNTCCSASDGSYACCPTPNAQCCSDKQHCCPYQFTCGNGGNIC 118          
BLAST of Granulin b vs. TrEMBL
Match: A0A2B4SIQ6 (Granulin OS=Stylophora pistillata OX=50429 GN=GRN PE=4 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 1.048e-47
Identity = 122/369 (33.06%), Postives = 173/369 (46.88%), Query Frame = 3
Query:  153 KGVISFQLAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNR---LSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGNHFSIL 1250
            +G  S  +  +       K     +CP+ +++C +  TCC+     Y CC Y NAVCC D  HCCP G TCD     C +   S++ M + +PAL  E                 V+CP+ +++C D  TCC      Y CCP+ NAVCCSD   CCP   TCD+    CT    S+  M Q+L   +   E N   ++    G + +    +  C +++G+ G C +    CCSD   CCP    CD     CT  S+    E  +  P   R    S VVCPD E+EC    TCC +S   YGCC L NAVCC+D V CCP+   CD+   +C + +S        + P   K    + + N  +++
Sbjct:  455 QGSSSIPMVQKLPALMREKSASNVVCPDGQSECPDGNTCCKLSSGQYGCCPYPNAVCCSDGEHCCPNGYTCDVSAGTCTQ-GSSSIPMVQKLPALMRE------------KNGSNVVCPDGQSECPDGNTCCKLSSGQYGCCPYPNAVCCSDGEHCCPNGYTCDVSAGTCTQESSSM-PMMQKL--PALIRERNASNVV--CPGGQSECPDGNTCCKLSSGQYGCCPYPNAVCCSDREHCCPSGYTCDVSAGTCTQGSSSI--EMFQKMPAMKRESAASYVVCPDGESECPDGTTCCKLSTGQYGCCPLPNAVCCSDGVHCCPNGYTCDVSAGTCTQGSS--------SIPMVQKLAALMREKNGSNVV 795          

HSP 2 Score: 176.407 bits (446), Expect = 4.034e-44
Identity = 114/337 (33.83%), Postives = 161/337 (47.77%), Query Frame = 3
Query:  165 SFQLAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNR---LSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSN 1166
            S  +  +       +     +CP  +++C +  TCC+     Y CC Y NAVCC D+ HCCP G TCD     C +   S++EM + +PA+K E            +    V+CP+ +++C D  TCC      Y CCP  NAVCCSD   CCP   TCD+    CT    SI  M Q+L   +   E N   ++      + +    +  C +++G+ G C +    CCSD   CCP    CD     CT  S+       +  P   R    S VVCP  ++EC    TCC +S   YGCC L NAVCC+D   CCP+   CD+   +C + +S+
Sbjct:  617 SMPMMQKLPALIRERNASNVVCPGGQSECPDGNTCCKLSSGQYGCCPYPNAVCCSDREHCCPSGYTCDVSAGTCTQ-GSSSIEMFQKMPAMKRE------------SAASYVVCPDGESECPDGTTCCKLSTGQYGCCPLPNAVCCSDGVHCCPNGYTCDVSAGTCTQGSSSI-PMVQKLA--ALMREKNGSNVV--CPDGQSECPDGNTCCKLSSGQYGCCPYPNAVCCSDGEHCCPNGYTCDVSAGTCTQGSSSM--PMVQRLPALKREKDASNVVCPGGQSECPDGNTCCRLSSGQYGCCPLPNAVCCSDGKHCCPNGYTCDVSAGTCKQGSSS 933          

HSP 3 Score: 175.637 bits (444), Expect = 7.385e-44
Identity = 115/358 (32.12%), Postives = 163/358 (45.53%), Query Frame = 3
Query:  132 IGSKVAAKGVISFQLAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNR-LSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKR 1202
            + +   +KG  S     +        +    +CP+  ++C +  TCC+     Y CC   NAVCC D  HCCP G TCD     C +   S++ M + +PAL  E                 V+CP+ +++C D  TCC      Y CCP+ NAVCCSD   CCP   TCD+    CT    SI  M Q+L   +   E N   ++      + +    +  C +++G+ G C +    CCSD   CCP    CD     CT  S+     +   +    R  S VVCP  ++EC    TCC +S   YGCC   NAVCC+DR  CCP    CD+   +C + +S+      +   KR
Sbjct:  369 VSAGTCSKGTTSITFLQKLPAVQRKSDANSVVCPDGESQCPDGTTCCKLSTGQYGCCPLPNAVCCSDGEHCCPNGYTCDVSAGSCTQ-GSSSIPMVQKLPALMRE------------KSASNVVCPDGQSECPDGNTCCKLSSGQYGCCPYPNAVCCSDGEHCCPNGYTCDVSAGTCTQGSSSI-PMVQKL--PALMREKNGSNVV--CPDGQSECPDGNTCCKLSSGQYGCCPYPNAVCCSDGEHCCPNGYTCDVSAGTCTQESSSMPMMQKLPALIRERNASNVVCPGGQSECPDGNTCCKLSSGQYGCCPYPNAVCCSDREHCCPSGYTCDVSAGTCTQGSSSIEMFQKMPAMKR 708          

HSP 4 Score: 175.252 bits (443), Expect = 9.441e-44
Identity = 118/360 (32.78%), Postives = 165/360 (45.83%), Query Frame = 3
Query:  132 IGSKVAAKGVISFQLAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFD-TEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSK 1208
            + +    +G  S  +  +       K     +CP+ +++C +  TCC+     Y CC Y NAVCC D  HCCP G TCD     C +   S++ M + +PAL  E                 V+CP  +++C D  TCC      Y CCP+ NAVCCSD+  CCP   TCD+    CT    SI EM Q++   + K E+    ++      + +       C ++ G+ G C      CCSD   CCP    CD     CT  S+     +K          S VVCPD ++EC    TCC +S   YGCC   NAVCC+D   CCP+   CD+   +C + +S+      L   KR K
Sbjct:  527 VSAGTCTQGSSSIPMVQKLPALMREKNGSNVVCPDGQSECPDGNTCCKLSSGQYGCCPYPNAVCCSDGEHCCPNGYTCDVSAGTCTQ-ESSSMPMMQKLPALIRE------------RNASNVVCPGGQSECPDGNTCCKLSSGQYGCCPYPNAVCCSDREHCCPSGYTCDVSAGTCTQGSSSI-EMFQKM--PAMKRESAASYVV--CPDGESECPDGTTCCKLSTGQYGCCPLPNAVCCSDGVHCCPNGYTCDVSAGTCTQGSSSIPMVQKLAALMREKNGSNVVCPDGQSECPDGNTCCKLSSGQYGCCPYPNAVCCSDGEHCCPNGYTCDVSAGTCTQGSSSMPMVQRLPALKREK 868          

HSP 5 Score: 170.629 bits (431), Expect = 3.473e-42
Identity = 114/367 (31.06%), Postives = 160/367 (43.60%), Query Frame = 3
Query:  132 IGSKVAAKGVISFQLAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQ-KASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDT---EKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKT 1220
            + +    +G  S  +  +       K     +CP+ +++C +  TCC+     Y CC Y NAVCC D  HCCP G TCD     C +   S++ M + +PALK E             +   V+CP  +++C D  TCC      Y CCP  NAVCCSD   CCP   TCD+    C     SI  +    +H + +  T    +  +L   K+ +       C + +G  G C      CCSD   CCP    CD +  KC  N+          S  S        + CPD    C  +ETCC +SD  +GCC L +AVCC D   CCP   +CD+    CV  N        +  P++ K  + 
Sbjct:  764 VSAGTCTQGSSSIPMVQKLAALMREKNGSNVVCPDGQSECPDGNTCCKLSSGQYGCCPYPNAVCCSDGEHCCPNGYTCDVSAGTCTQ-GSSSMPMVQRLPALKRE------------KDASNVVCPGGQSECPDGNTCCRLSSGQYGCCPLPNAVCCSDGKHCCPNGYTCDVSAGTCKQGSSSIASLQ---MHAALQAVTYIKAVDGVLCPDKKYQCPNGSTCCRVPSGTYGCCPIKNAVCCSDHIHCCPNGYTCDVEGGKCIKNAEHIKMIANVPSSRSSVDTEQKYIKCPDG-CSCLDYETCCVLSDGRFGCCPLPHAVCCEDHEHCCPSGYRCDLAAEMCVTGNVRLPMLQKIRSPRKQKTPRV 1113          

HSP 6 Score: 166.007 bits (419), Expect = 1.319e-40
Identity = 117/393 (29.77%), Postives = 177/393 (45.04%), Query Frame = 3
Query:   69 VIFI*MKYSYSIFAVLVGLAVIGSKVAAKGVISFQLAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLS---TVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSN--KRRHFPLTFPKRSKFRKTLNDG 1232
            +IF+ +    +   ++V         ++  +   + A + +  ASN      +CP+  ++C +  TCC+     Y CC    AVCC D  HCCP G TCD     C K   + + + KL PA++            + ++ + V+CP+ +++C D  TCC      Y CCP   AVCCSD   CCP+  TCD+    CT    SI    ++        E+N      +    + +       C +++G+ G C      CCSD   CCP    CD     C+  +T     +    P   R S   +VVCPD E++C    TCC +S   YGCC L NAVCC+D   CCP+   CD+   SC + +S+    +  P    ++S       DG
Sbjct:  116 IIFMILILCLTCIIIVVNAGTCTQGSSSIAMFQKKPAKKRESAASNI-----VCPDGESECPDDTTCCKLSSGQYGCCPLPKAVCCSDGEHCCPNGYTCDISAGTCSKGTTTLILLQKL-PAVQ------------RKSDANSVVCPDGESQCPDGNTCCKLFSGQYGCCPLPKAVCCSDGKHCCPDGYTCDVSAGTCTQGSSSIAMFQKKPAMKRESAESNI-----VCPDGESECPDDTTCCKLSSGQYGCCPLPKAVCCSDGEHCCPNGYTCDVSAGTCSKGTTSITFLQKL--PAVQRKSDANSVVCPDGESQCPDGTTCCKLSTGQYGCCPLPNAVCCSDGEHCCPNGYTCDVSAGSCTQGSSSIPMVQKLPALMREKSASNVVCPDG 483          

HSP 7 Score: 164.851 bits (416), Expect = 3.256e-40
Identity = 105/345 (30.43%), Postives = 161/345 (46.67%), Query Frame = 3
Query:  132 IGSKVAAKGVISFQLAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTT----NRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVE 1154
            + +    +G  S ++  +             +CP+  ++C +  TCC+     Y CC   NAVCC D  HCCP G TCD     C +   S++ M + + AL  E                 V+CP+ +++C D  TCC      Y CCP+ NAVCCSD   CCP   TCD+    CT    S+  M Q L   + K E +   ++    G + +    +  C +++G+ G C      CCSD + CCP    CD     C   S+   + +   +         +  V+CPD + +C +  TCC V   +YGCC ++NAVCC+D + CCP+   CD++   C++
Sbjct:  685 VSAGTCTQGSSSIEMFQKMPAMKRESAASYVVCPDGESECPDGTTCCKLSTGQYGCCPLPNAVCCSDGVHCCPNGYTCDVSAGTCTQ-GSSSIPMVQKLAALMRE------------KNGSNVVCPDGQSECPDGNTCCKLSSGQYGCCPYPNAVCCSDGEHCCPNGYTCDVSAGTCTQGSSSM-PMVQRL--PALKREKDASNVV--CPGGQSECPDGNTCCRLSSGQYGCCPLPNAVCCSDGKHCCPNGYTCDVSAGTCKQGSSSIASLQMHAALQAVTYIKAVDGVLCPDKKYQCPNGSTCCRVPSGTYGCCPIKNAVCCSDHIHCCPNGYTCDVEGGKCIK 1011          
BLAST of Granulin b vs. TrEMBL
Match: V4ARK5 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_146967 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 7.880e-44
Identity = 109/326 (33.44%), Postives = 158/326 (48.47%), Query Frame = 3
Query:  174 LAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQ-KASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
            + W ++  + + +    +CP+++++C +  TCC+     Y CC   NAVCC D+ HCCP G+TCD    KC +   ++V   K           KT+    KV   + V+CP+ +++C D  TCC      Y CCP  NAVCCSD+  CCP  TTCD    KC       +      +  S K  +   K+ +++   +Q +       C ++ G+ G C      CCSD   CCP  T CD    KC            K S  + ++  VVCPD +++C    TCC +S   YGCC L NAVCC+D++ CCP    CD     C
Sbjct:   54 VMWSKKTSSQSLKVENVVCPDQQSQCPDGSTCCKLSTGQYGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKCNRQDGTSVMWSK-----------KTSSQSLKV---ENVVCPDQQSQCPDGSTCCKLSTGQYGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKC-------NRQDGTSVMWSKKTSSQSLKVENVVCPDQQSQCPDGSTCCKLSTGQYGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKCNRQDGTSVMWSKKTSSQSLKVENVVCPDQQSQCPDGSTCCKLSTGQYGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKC 358          

HSP 2 Score: 157.918 bits (398), Expect = 3.784e-40
Identity = 108/323 (33.44%), Postives = 152/323 (47.06%), Query Frame = 3
Query:  249 CTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQ-KASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFR 1214
            C +  TCC+     Y CC   NAVCC D+ HCCP G+TCD    KC +   ++V   K           KT+    KV   + V+CP+ +++C D  TCC      Y CCP  NAVCCSD+  CCP  TTCD    KC       +      +  S K  +   K+ +++   +Q +       C ++ G+ G C      CCSD   CCP  T CD    KC            K S  + ++  VVCPD +++C    TCC +S   YGCC L NAVCC+D++ CCP    CD     C     N++    + + K++  +
Sbjct:    1 CPDGSTCCKLSTGQYGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKCNRQDGTSVMWSK-----------KTSSQSLKV---ENVVCPDQQSQCPDGSTCCKLSTGQYGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKC-------NRQDGTSVMWSKKTSSQSLKVENVVCPDQQSQCPDGSTCCKLSTGQYGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKCNRQDGTSVMWSKKTSSQSLKVENVVCPDQQSQCPDGSTCCKLSTGQYGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKC-----NRQDGTSVMWSKKTSSQ 297          

HSP 3 Score: 108.997 bits (271), Expect = 2.498e-22
Identity = 81/276 (29.35%), Postives = 128/276 (46.38%), Query Frame = 3
Query:  174 LAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQ-KASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQH-------TKCDEKNNKCTLNSTDFDTEKSKHSPTTNRL 977
            + W ++  + + +    +CP+++++C +  TCC+     Y CC   NAVCC D+ HCCP G+TCD    KC +   ++V   K           KT+    KV   + V+CP+ +++C D  TCC      Y CCP  NAVCCSD+  CCP  TTCD    KC       +      +  S K  +   K+ +++   +Q +       C ++ G+ G C      CCSD   CCP          KCD ++    + S    ++  K +  + R+
Sbjct:  132 VMWSKKTSSQSLKVENVVCPDQQSQCPDGSTCCKLSTGQYGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKCNRQDGTSVMWSK-----------KTSSQSLKV---ENVVCPDQQSQCPDGSTCCKLSTGQYGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKC-------NRQDGTSVMWSKKTSSQSLKVENVVCPDQQSQCPDGSTCCKLSTGQYGCCPLPNAVCCSDQIHCCPSGTTCDTGAGKCDRQDGTSVMWSKKTSSQSLKSADVSYRI 386          
BLAST of Granulin b vs. TrEMBL
Match: A0A1A7X3H3 (Granulin b OS=Iconisemion striatum OX=60296 GN=GRNB PE=4 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.878e-43
Identity = 109/314 (34.71%), Postives = 160/314 (50.96%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSN 1166
            +CP+    C +++TCC+     Y CC   +A CC D  HCC EG+ CD    KCV      V +   +  L  +  P  + L  +V     V+CP+ +++C D  TCC    +++ CCP   AVCC DK  CCPE TTCD+ + KC S       + ++L     +   N   +  +  G K     +   CP+T+G  G C +   TCCSD   CCP +T CD ++  C          +   + +T+    VVCPD ++ C    TCC +S+ +YGCC L  AVCC+D V CCP + +CD+K ++CV    N
Sbjct:   20 VCPDGGM-CEDKETCCKNNSGGYGCCPLPHAECCSDHLHCCYEGTLCDLIHQKCVN---KTVSL-PWVRRLPTQQTPPVSQLGGRVKA---VLCPDQESECPDDTTCCQLPDSSWGCCPLPKAVCCEDKRHCCPEGTTCDLVHSKCASLSFQSFPLLEKL---PARRLGNKPAVAVICPGGKSSCPDAFTCCPLTSGEYGCCPYPDATCCSDHSHCCPSNTVCDLEHGVCRSAEILIPLMEKISAVSTD----VVCPDRKSACPDQTTCCLMSNGTYGCCPLPYAVCCSDYVHCCPADTQCDLKHSTCVPAQDN 318          

HSP 2 Score: 86.2705 bits (212), Expect = 9.146e-15
Identity = 63/182 (34.62%), Postives = 86/182 (47.25%), Query Frame = 3
Query:  129 VIGSKVAAKGVISFQLAWREQGF-ASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSS 671
            ++ SK A+    SF L  +       NK  V  ICP  ++ C +  TCC      Y CC Y +A CC D  HCCP  + CD +   C      + E+  LIP           ++E       +V+CP+ K+ C D  TCC+  +  Y CCP   AVCCSD   CCP  T CD+K+  C  +
Sbjct:  152 LVHSKCASLSFQSFPLLEKLPARRLGNKPAVAVICPGGKSSCPDAFTCCPLTSGEYGCCPYPDATCCSDHSHCCPSNTVCDLEHGVC-----RSAEI--LIP-----------LMEKISAVSTDVVCPDRKSACPDQTTCCLMSNGTYGCCPLPYAVCCSDYVHCCPADTQCDLKHSTCVPA 315          
BLAST of Granulin b vs. TrEMBL
Match: A0A3P8VPE0 (Granulin b OS=Cynoglossus semilaevis OX=244447 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 4.781e-43
Identity = 113/314 (35.99%), Postives = 152/314 (48.41%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSN 1166
            +CP+    C +R TCC+     Y CC   +A CC D  HCC EG+ CD    KCV    S   + +L           +  L+  V   D+  CP+N        TCC     N+ CCP   AVCC DK+ CCPEATTCDI  +KC S+      M ++L     K  ++   +     G K     S   C +T+G  G C ++   CCSD   CCP HT+CD K   C    T     K   +   +    V CPD +T C    TCC +++ SYGCC + NAVCC+D + CCP    CD++ ++CV T  N
Sbjct:   49 VCPDGGM-CEDRNTCCKNTVGGYGCCPLPHAECCADHLHCCYEGTLCDLVHKKCVNKTVSLPWLRRLPAKQAFSVSQLSESLKVVVCPGDDATCPDN-------STCCQLHGGNWGCCPLPKAVCCGDKHHCCPEATTCDITKQKCVSASLESFPMLEKLPALQNKDNSDEGVVSVTCPGGKSSCPDSYTCCLLTSGDYGCCPYTEAVCCSDQLHCCPSHTECDVKRGVCRSAQTIVPLLKKVPAVPND----VKCPDKKTACPDQTTCCQMTNGSYGCCPMPNAVCCSDHMHCCPEGTMCDLRHSTCVSTQGN 350          

HSP 2 Score: 148.673 bits (374), Expect = 7.263e-35
Identity = 114/362 (31.49%), Postives = 159/362 (43.92%), Query Frame = 3
Query:  165 SFQLAWREQGFASNKETVGN--------ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCP--------------ITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTN-----RLSTVVCPDNET-ECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSN 1166
            +  L W  +  A    +V          +CP     C +  TCCQ    ++ CC    AVCC DK HCCPE +TCD  + KCV  +  +  M + +PAL+ +D     ++         V CP  K+ C D+ TCC+    +Y CCP+  AVCCSD+  CCP  T CD+K   C S+                        I+ LL   K  A  +D  CP              +TNG  G C      CCSD   CCP+ T CD +++ C     +  T  S+ +         +LS    P NE+  C   +TCC      +GCC L  AVCC D + CCPH   C++  ++C +   N
Sbjct:  105 TVSLPWLRRLPAKQAFSVSQLSESLKVVVCPGDDATCPDNSTCCQLHGGNWGCCPLPKAVCCGDKHHCCPEATTCDITKQKCVSASLESFPMLEKLPALQNKDNSDEGVV--------SVTCPGGKSSCPDSYTCCLLTSGDYGCCPYTEAVCCSDQLHCCPSHTECDVKRGVCRSA----------------------QTIVPLL--KKVPAVPNDVKCPDKKTACPDQTTCCQMTNGSYGCCPMPNAVCCSDHMHCCPEGTMCDLRHSTCVSTQGNTVTMASEVNAAVTELVLPQLSDASVPCNESVACADGKTCCKKKQGDWGCCPLPEAVCCEDHLHCCPHGTICNLAASTCDDPTYN 434          

HSP 3 Score: 135.576 bits (340), Expect = 2.357e-30
Identity = 101/318 (31.76%), Postives = 143/318 (44.97%), Query Frame = 3
Query:  201 SNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKC---TLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNS 1145
            S++  V   CP  ++ C +  TCC      Y CC Y  AVCC D+ HCCP  + CD K+  C + A++ V + K +PA+                  ++V CP+ KT C D  TCC   + +Y CCP  NAVCCSD   CCPE T CD+++  C S+  +   MA E+     +         S+        +     C    G  G C      CC D   CCP  T C+   + C   T N+    T   ++ P  +  S     D  T C    TCC  +   + CC L  AVCC D + CCP++  C++K  +
Sbjct:  209 SDEGVVSVTCPGGKSSCPDSYTCCLLTSGDYGCCPYTEAVCCSDQLHCCPSHTECDVKRGVC-RSAQTIVPLLKKVPAV-----------------PNDVKCPDKKTACPDQTTCCQMTNGSYGCCPMPNAVCCSDHMHCCPEGTMCDLRHSTCVSTQGNTVTMASEVNAAVTELVLPQLSDASVPCNESVACADGKTCCKKKQGDWGCCPLPEAVCCEDHLHCCPHGTICNLAASTCDDPTYNTA--VTPWLRNEPAFSLQSDNNKCDETTSCPGNSTCCGAAGGEWACCPLAEAVCCDDHIHCCPYDTTCNLKAQT 506          

HSP 4 Score: 120.939 bits (302), Expect = 1.427e-25
Identity = 98/330 (29.70%), Postives = 135/330 (40.91%), Query Frame = 3
Query:  252 TERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKC----------TLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKF 1211
            T   TCC+     + CC    AVCC D+ HCCP+G  C+  Q  C K     +     +PAL+ E   +   L A++  K   MC +N +  KDT  C + +   + CCP   AVCCSD   CCP   TC+     C+  PH I    +          +    +  +    K   +     C +  G  G C      CC D + CCPQ   C+ K   C          TL+       +S+ S   + +        + +C   ETCC  S   + CC    AVCC+D   CCP    CD +T SC   NSN+         KR  F
Sbjct:  506 TWGTTCCKKTSGLWACCPLPQAVCCSDQEHCCPKGYKCNVAQQTCDKPGGLTLPWLLKVPALQREPT-RAVSLPAQLARK---MCDSNTSCPKDTTCCFMEQTQKWGCCPLPTAVCCSDGVHCCPNGHTCEPHKWSCSRGPHVIPWFTK------LSAYSEPDSVTDVKCDNKSSCAAGTTCCKLPTGEWGCCPLVKAVCCEDHQHCCPQGYTCNMKTGTCDKKDKNVLTHTLHQIKVVQPQSQFS--EDDVGVPCDSTGDLQCSKSETCCKTSPSGWACCPSPQAVCCSDSKYCCPAGFTCDSRTASCSRINSNQLSWDTFFGDKRRDF 823          

HSP 5 Score: 71.633 bits (174), Expect = 1.934e-9
Identity = 68/245 (27.76%), Postives = 101/245 (41.22%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNS-YHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSS-----PHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTL---NSTDFDT 941
            +  T C +  TCC  +    + CC    AVCC D  HCCP G TC+  +  C +       +      L    EP         +   +V C +NK+ C    TCC      + CCP   AVCC D   CCP+  TC++K   C         H++H++  +++    ++  +   +     G  Q  SKS+  C  +      C      CCSD + CCP    CD +   C+    N   +DT
Sbjct:  587 DSNTSCPKDTTCCFMEQTQKWGCCPLPTAVCCSDGVHCCPNGHTCEPHKWSCSR----GPHVIPWFTKLSAYSEP---------DSVTDVKC-DNKSSCAAGTTCCKLPTGEWGCCPLVKAVCCEDHQHCCPQGYTCNMKTGTCDKKDKNVLTHTLHQI--KVVQPQSQFSEDDVGVPCDSTGDLQ-CSKSETCCKTSPSGWACCPSPQAVCCSDSKYCCPAGFTCDSRTASCSRINSNQLSWDT 814          

HSP 6 Score: 64.6994 bits (156), Expect = 3.185e-7
Identity = 49/158 (31.01%), Postives = 72/158 (45.57%), Query Frame = 3
Query:  201 SNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXX---XXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCT 665
            S  ++V ++  + ++ C    TCC+     + CC    AVCC D  HCCP+G TC+ K   C K  K    +   +  +KV  +P++   E      D+V  P + T             T  + + CCP   AVCCSD   CCP   TCD +   C+
Sbjct:  655 SEPDSVTDVKCDNKSSCAAGTTCCKLPTGEWGCCPLVKAVCCEDHQHCCPQGYTCNMKTGTCDK--KDKNVLTHTLHQIKVV-QPQSQFSE------DDVGVPCDSTGDLQCSKSETCCKTSPSGWACCPSPQAVCCSDSKYCCPAGFTCDSRTASCS 803          
BLAST of Granulin b vs. TrEMBL
Match: A0A3P8VL47 (Granulin b OS=Cynoglossus semilaevis OX=244447 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 5.489e-43
Identity = 113/314 (35.99%), Postives = 152/314 (48.41%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSN 1166
            +CP+    C +R TCC+     Y CC   +A CC D  HCC EG+ CD    KCV    S   + +L           +  L+  V   D+  CP+N        TCC     N+ CCP   AVCC DK+ CCPEATTCDI  +KC S+      M ++L     K  ++   +     G K     S   C +T+G  G C ++   CCSD   CCP HT+CD K   C    T     K   +   +    V CPD +T C    TCC +++ SYGCC + NAVCC+D + CCP    CD++ ++CV T  N
Sbjct:   49 VCPDGGM-CEDRNTCCKNTVGGYGCCPLPHAECCADHLHCCYEGTLCDLVHKKCVNKTVSLPWLRRLPAKQAFSVSQLSESLKVVVCPGDDATCPDN-------STCCQLHGGNWGCCPLPKAVCCGDKHHCCPEATTCDITKQKCVSASLESFPMLEKLPALQNKDNSDEGVVSVTCPGGKSSCPDSYTCCLLTSGDYGCCPYTEAVCCSDQLHCCPSHTECDVKRGVCRSAQTIVPLLKKVPAVPND----VKCPDKKTACPDQTTCCQMTNGSYGCCPMPNAVCCSDHMHCCPEGTMCDLRHSTCVSTQGN 350          

HSP 2 Score: 148.673 bits (374), Expect = 7.516e-35
Identity = 110/334 (32.93%), Postives = 152/334 (45.51%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCP--------------ITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTN-----RLSTVVCPDNET-ECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSN 1166
            +CP     C +  TCCQ    ++ CC    AVCC DK HCCPE +TCD  + KCV  +  +  M + +PAL+ +D     ++         V CP  K+ C D+ TCC+    +Y CCP+  AVCCSD+  CCP  T CD+K   C S+                        I+ LL   K  A  +D  CP              +TNG  G C      CCSD   CCP+ T CD +++ C     +  T  S+ +         +LS    P NE+  C   +TCC      +GCC L  AVCC D + CCPH   C++  ++C +   N
Sbjct:  133 VCPGDDATCPDNSTCCQLHGGNWGCCPLPKAVCCGDKHHCCPEATTCDITKQKCVSASLESFPMLEKLPALQNKDNSDEGVV--------SVTCPGGKSSCPDSYTCCLLTSGDYGCCPYTEAVCCSDQLHCCPSHTECDVKRGVCRSA----------------------QTIVPLLK--KVPAVPNDVKCPDKKTACPDQTTCCQMTNGSYGCCPMPNAVCCSDHMHCCPEGTMCDLRHSTCVSTQGNTVTMASEVNAAVTELVLPQLSDASVPCNESVACADGKTCCKKKQGDWGCCPLPEAVCCEDHLHCCPHGTICNLAASTCDDPTYN 434          

HSP 3 Score: 139.813 bits (351), Expect = 8.311e-32
Identity = 107/340 (31.47%), Postives = 152/340 (44.71%), Query Frame = 3
Query:  201 SNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKC---TLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC------VETNSNKRRHFPLTF 1193
            S++  V   CP  ++ C +  TCC      Y CC Y  AVCC D+ HCCP  + CD K+  C + A++ V + K +PA+                  ++V CP+ KT C D  TCC   + +Y CCP  NAVCCSD   CCPE T CD+++  C S+  +   MA E+     +         S+        +     C    G  G C      CC D   CCP  T C+   + C   T N+    T   ++ P  +  S     D  T C    TCC  +   + CC L  AVCC D + CCP++  C++K  +C      V + S  ++  PLT 
Sbjct:  209 SDEGVVSVTCPGGKSSCPDSYTCCLLTSGDYGCCPYTEAVCCSDQLHCCPSHTECDVKRGVC-RSAQTIVPLLKKVPAV-----------------PNDVKCPDKKTACPDQTTCCQMTNGSYGCCPMPNAVCCSDHMHCCPEGTMCDLRHSTCVSTQGNTVTMASEVNAAVTELVLPQLSDASVPCNESVACADGKTCCKKKQGDWGCCPLPEAVCCEDHLHCCPHGTICNLAASTCDDPTYNTA--VTPWLRNEPAFSLQSDNNKCDETTSCPGNSTCCGAAGGEWACCPLAEAVCCDDHIHCCPYDTTCNLKAQTCKDPFGFVPSISWMKKLSPLTI 528          

HSP 4 Score: 130.183 bits (326), Expect = 1.319e-28
Identity = 96/309 (31.07%), Postives = 134/309 (43.37%), Query Frame = 3
Query:  228 CPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKC--TLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
            CP+K+T C ++ TCCQ  + SY CC   NAVCC D  HCCPEG+ CD +   CV    + V M   + A  V +     + +A V   + V C +        KTCC  K  ++ CCP   AVCC D   CCP  T C++    C    ++           +F  +++  K              +   C    G    C  +   CC D   CCP  T C+ K   C          +   K SP T ++    C D +T C    TCC  +   + CC L  AVCC+D+  CCP   KC++   +C
Sbjct:  292 CPDKKTACPDQTTCCQMTNGSYGCCPMPNAVCCSDHMHCCPEGTMCDLRHSTCVSTQGNTVTMASEVNA-AVTELVLPQLSDASVPCNESVACADG-------KTCCKKKQGDWGCCPLPEAVCCEDHLHCCPHGTICNLAASTCDDPTYNTAVTPWLRNEPAFSLQSDNNKCDE-----TTSCPGNSTCCGAAGGEWACCPLAEAVCCDDHIHCCPYDTTCNLKAQTCKDPFGFVPSISWMKKLSPLTIKVGNENC-DGQTMCPGGTTCCKKTSGLWACCPLPQAVCCSDQEHCCPKGYKCNVAQQTC 586          

HSP 5 Score: 125.176 bits (313), Expect = 5.981e-27
Identity = 103/356 (28.93%), Postives = 147/356 (41.29%), Query Frame = 3
Query:  174 LAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKC----------TLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKF 1211
            ++W ++  +     VGN   + +T C    TCC+     + CC    AVCC D+ HCCP+G  C+  Q  C K     +     +PAL+ E   +   L A++  K   MC +N +  KDT  C + +   + CCP   AVCCSD   CCP   TC+     C+  PH I    +          +    +  +    K   +     C +  G  G C      CC D + CCPQ   C+ K   C          TL+       +S+ S   + +        + +C   ETCC  S   + CC    AVCC+D   CCP    CD +T SC   NSN+         KR  F
Sbjct:  517 ISWMKK-LSPLTIKVGNENCDGQTMCPGGTTCCKKTSGLWACCPLPQAVCCSDQEHCCPKGYKCNVAQQTCDKPGGLTLPWLLKVPALQREPT-RAVSLPAQLARK---MCDSNTSCPKDTTCCFMEQTQKWGCCPLPTAVCCSDGVHCCPNGHTCEPHKWSCSRGPHVIPWFTK------LSAYSEPDSVTDVKCDNKSSCAAGTTCCKLPTGEWGCCPLVKAVCCEDHQHCCPQGYTCNMKTGTCDKKDKNVLTHTLHQIKVVQPQSQFS--EDDVGVPCDSTGDLQCSKSETCCKTSPSGWACCPSPQAVCCSDSKYCCPAGFTCDSRTASCSRINSNQLSWDTFFGDKRRDF 859          

HSP 6 Score: 115.161 bits (287), Expect = 1.499e-23
Identity = 104/347 (29.97%), Postives = 148/347 (42.65%), Query Frame = 3
Query:  180 WREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKC---VKCAKSNVEMGKLIP-ALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPI--------TNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNS--TDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRH 1178
            W     A + ++  N C ++ T C    TCC      + CC  A AVCC D  HCCP  +TC+ K   C        S   M KL P  +KV +E          N   + MCP   T CK T          + CCP   AVCCSD+  CCP+   C++  + C   P  +  +   L   + + E    + +SL     +K   S+  CP            + G C      CCSD   CCP    C+     C+       + T+ S +S   + ++ V C DN++ C +  TCC +    +GCC L  AVCC D   CCP    C++KT +C + + N   H
Sbjct:  440 WLRNEPAFSLQSDNNKC-DETTSCPGNSTCCGAAGGEWACCPLAEAVCCDDHIHCCPYDTTCNLKAQTCKDPFGFVPSISWMKKLSPLTIKVGNE----------NCDGQTMCPGGTTCCKKTS-------GLWACCPLPQAVCCSDQEHCCPKGYKCNVAQQTC-DKPGGL-TLPWLLKVPALQREPT--RAVSLPAQLARKMCDSNTSCPKDTTCCFMEQTQKWGCCPLPTAVCCSDGVHCCPNGHTCEPHKWSCSRGPHVIPWFTKLSAYS-EPDSVTDVKC-DNKSSCAAGTTCCKLPTGEWGCCPLVKAVCCEDHQHCCPQGYTCNMKTGTCDKKDKNVLTH 762          
BLAST of Granulin b vs. Ensembl Cavefish
Match: grnb (granulins-like [Source:NCBI gene;Acc:103046308])

HSP 1 Score: 150.984 bits (380), Expect = 4.279e-39
Identity = 106/335 (31.64%), Postives = 156/335 (46.57%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALK-VEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDT--EKSKHSPTTNRLSTVVCPDNE-----TECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRS 1205
            +CP++ ++C +  TCCQ    S+ CC   NAVCC DK HCCP+G+TCD    KCV     +V + +  PA K  E + + +     + + ++V CP+  + C D  TCC   + +Y CCP   AVCCSD   CCP+ T+CD+ + KC SS  ++ E     +    + +     + S+              C   +G    C      CC D   CCPQ T C        + S D  T     +  PT NR+     P NE     T C    TCC +   ++GCC L  AVCC D + CCP N  C++   +C    S       + + +++
Sbjct:   96 VCPDQESECPDDTTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSMLGSVPLRRKFPAYKRAEWKARKDSNGLDLADSNDVDCPDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSS--NVLEPVTTNLSPVVRVKVT---VESVPCNESVACESGSTCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVCARST---CVASADLLTLVRWVEKKPTINRVPQ---PANEKCDPTTTCPKGATCCKMESGTWGCCPLPQAVCCEDHLHCCPRNTVCNVAAGTCDSAFSGTAGQLSVPWVRKT 419          

HSP 2 Score: 134.42 bits (337), Expect = 1.784e-33
Identity = 109/316 (34.49%), Postives = 143/316 (45.25%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSS-----PHSIHEMAQELIHDSFKYETNFFKII-SLLLGFKQKAS---KSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTV-VCPDNET-ECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKT 1139
            ICP+    C +  TCCQT    Y CC   NA CC D  HCC EG+ CD +  KCV      ++    +P        + ++ +A V    E  CP++        TCC     ++ CCP  NAVCC DK  CCP+ TTCD+ + KC SS     P      A +      + ++N   +  S  +    K S        CP+ NG  G C      CCSD   CCPQ T CD  ++KC ++S   +   +  SP      TV   P NE+  C S  TCC   D  + CC L  AVCC D + CCP    C   T
Sbjct:   19 ICPDGGM-CDDGNTCCQTPSGGYGCCPLPNAECCSDHLHCCHEGTLCDLEHSKCVN-KTHTLDWVMRVPIR------QPSLPQAVVCPDQESECPDD-------TTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSMLGSVPLRRKFPAYKRAEWKARKDSNGLDLADSNDVDCPDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKC-VSSNVLEPVTTNLSPVVRVKVTVESVPCNESVACESGSTCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVCARST 318          

HSP 3 Score: 107.842 bits (268), Expect = 1.155e-24
Identity = 99/350 (28.29%), Postives = 132/350 (37.71%), Query Frame = 3
Query:  168 FQLAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPAL-----------KVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCP-------ITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNS 1163
              + W  +  A++     + C ++ + C    TCC+ K  ++ CC    AVCC D  HCCP+G  CD     C      ++   K  PAL           K   E     +E+K     +  CP + T C   K       N + CCP   AVCC D   CCP + TCD     C      I            K E    +   +  G       S   CP       +T G+ G C      CC D   CCP    CD +   C   ST      +     T+    V+C D  + C   +TCC +SD  + CC  + AVCC D   CCP    CD K   C    S
Sbjct:  411 LSVPWVRKTPATSLPPANDQC-DETSACPTGTTCCRQKSGAWACCPLPQAVCCDDHEHCCPQGYKCDIIHESCDHPFLPSMLWFKKQPALQSMTQQSNANAKAIAESAVADVESKHKCDAQTSCPRDNTCCYMKK------FNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCLKGHLEIPWFK--------KQEAKVTQGSEVAHGVADVQCDSTARCPTGSTCCRLTTGQWGCCPHVQAVCCDDHVHCCPAGYTCDLQAGTCLRTSTLHTVALTLVH--THTKEQVMC-DATSHCTESQTCCKLSDTEWACCPFKQAVCCKDMKHCCPVGYVCDPKAKGCARATS 742          

HSP 4 Score: 105.531 bits (262), Expect = 7.093e-24
Identity = 89/329 (27.05%), Postives = 132/329 (40.12%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSS--PHSIHEMAQELIHDSFKYETNFFKII--SLLLGFKQKAS-KSDFYCPITN--------GRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDF------DTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNS 1163
            +  T C +  TCC+ +  ++ CC    AVCC D  HCCP  + C+     C   A S       +P   V   P T++  A     +   CP   T C+            + CCP   AVCC D   CCP+   CDI ++ C     P  +    Q  +    +      K I  S +   + K    +   CP  N         + G C      CC D   CCP    CD   N C     +       + + ++ S   + ++ V C D+   C +  TCC ++   +GCC    AVCC D V CCP    CD++  +C+ T++
Sbjct:  350 DPTTTCPKGATCCKMESGTWGCCPLPQAVCCEDHLHCCPRNTVCNVAAGTCDS-AFSGTAGQLSVPW--VRKTPATSLPPANDQCDETSACPTGTTCCRQKS-------GAWACCPLPQAVCCDDHEHCCPQGYKCDIIHESCDHPFLPSMLWFKKQPALQSMTQQSNANAKAIAESAVADVESKHKCDAQTSCPRDNTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCLKGHLEIPWFKKQEAKVTQGSEVAHGVADVQC-DSTARCPTGSTCCRLTTGQWGCCPHVQAVCCDDHVHCCPAGYTCDLQAGTCLRTST 667          

HSP 5 Score: 99.3673 bits (246), Expect = 6.600e-22
Identity = 68/217 (31.34%), Postives = 97/217 (44.70%), Query Frame = 3
Query:  561 NNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFY--CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCT---LNST------------DFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETN 1160
              Y CCP  NA CCSD   CC E T CD+++ KC +  H++  + +  I            +   ++   Q++   D    C + +G  G C      CC D   CCPQ T CD  ++KC    L S             ++   K  +       + V CPD  + C    TCC + + SYGCC +  AVCC+D V CCP    CD+  + CV +N
Sbjct:   38 GGYGCCPLPNAECCSDHLHCCHEGTLCDLEHSKCVNKTHTLDWVMRVPIRQP--------SLPQAVVCPDQESECPDDTTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSMLGSVPLRRKFPAYKRAEWKARKDSNGLDLADSNDVDCPDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSSN 246          

HSP 6 Score: 97.4413 bits (241), Expect = 3.245e-21
Identity = 97/359 (27.02%), Postives = 139/359 (38.72%), Query Frame = 3
Query:  207 KETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEK--DEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKC---------------TLNSTDFDTEKSKHSPTTNRLSTVVCP---DNETECFSWETCCAVSD-KSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKT 1220
            K TV ++  N+   C    TCC+TK   + CC    AVCC D  HCCP+G+ C   +  CV    ++ ++  L+    VE +P  N +    NEK      CP   T CK            + CCP   AVCC D   CCP  T C++    C S+        Q  +    K         +               C   +G    C      CC D   CCPQ  KCD  +  C                L S    +  +  +   + ++ V      D +T C    TCC +     +GCC L  AVCC D   CCP++  CD   N+C+      + H  + + K+ + + T
Sbjct:  262 KVTVESVPCNESVACESGSTCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVC--ARSTCV----ASADLLTLV--RWVEKKPTINRVPQPANEKCDPTTTCPKGATCCKMES-------GTWGCCPLPQAVCCEDHLHCCPRNTVCNVAAGTCDSAFSGT--AGQLSVPWVRKTPATSLPPANDQCDETSACPTGTTCCRQKSGAWACCPLPQAVCCDDHEHCCPQGYKCDIIHESCDHPFLPSMLWFKKQPALQSMTQQSNANAKAIAESAVADVESKHKCDAQTSCPRDNTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCL------KGHLEIPWFKKQEAKVT 597          

HSP 7 Score: 85.8853 bits (211), Expect = 1.898e-17
Identity = 53/146 (36.30%), Postives = 69/146 (47.26%), Query Frame = 3
Query:  798 CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNK---RRHFPLTFPKRSKFRKTLN 1226
            C   +G  G C      CCSD   CC + T CD +++KC   +   D          +    VVCPD E+EC    TCC + D S+GCC + NAVCC D++ CCP    CD+  + CV +       RR FP       K RK  N
Sbjct:   33 CQTPSGGYGCCPLPNAECCSDHLHCCHEGTLCDLEHSKCVNKTHTLDWVMRVPIRQPSLPQAVVCPDQESECPDDTTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSMLGSVPLRRKFPAYKRAEWKARKDSN 178          
BLAST of Granulin b vs. Ensembl Cavefish
Match: grnb (granulins-like [Source:NCBI gene;Acc:103046308])

HSP 1 Score: 150.984 bits (380), Expect = 4.279e-39
Identity = 106/335 (31.64%), Postives = 156/335 (46.57%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALK-VEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDT--EKSKHSPTTNRLSTVVCPDNE-----TECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRS 1205
            +CP++ ++C +  TCCQ    S+ CC   NAVCC DK HCCP+G+TCD    KCV     +V + +  PA K  E + + +     + + ++V CP+  + C D  TCC   + +Y CCP   AVCCSD   CCP+ T+CD+ + KC SS  ++ E     +    + +     + S+              C   +G    C      CC D   CCPQ T C        + S D  T     +  PT NR+     P NE     T C    TCC +   ++GCC L  AVCC D + CCP N  C++   +C    S       + + +++
Sbjct:   96 VCPDQESECPDDTTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSMLGSVPLRRKFPAYKRAEWKARKDSNGLDLADSNDVDCPDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSS--NVLEPVTTNLSPVVRVKVT---VESVPCNESVACESGSTCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVCARST---CVASADLLTLVRWVEKKPTINRVPQ---PANEKCDPTTTCPKGATCCKMESGTWGCCPLPQAVCCEDHLHCCPRNTVCNVAAGTCDSAFSGTAGQLSVPWVRKT 419          

HSP 2 Score: 134.42 bits (337), Expect = 1.784e-33
Identity = 109/316 (34.49%), Postives = 143/316 (45.25%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSS-----PHSIHEMAQELIHDSFKYETNFFKII-SLLLGFKQKAS---KSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTV-VCPDNET-ECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKT 1139
            ICP+    C +  TCCQT    Y CC   NA CC D  HCC EG+ CD +  KCV      ++    +P        + ++ +A V    E  CP++        TCC     ++ CCP  NAVCC DK  CCP+ TTCD+ + KC SS     P      A +      + ++N   +  S  +    K S        CP+ NG  G C      CCSD   CCPQ T CD  ++KC ++S   +   +  SP      TV   P NE+  C S  TCC   D  + CC L  AVCC D + CCP    C   T
Sbjct:   19 ICPDGGM-CDDGNTCCQTPSGGYGCCPLPNAECCSDHLHCCHEGTLCDLEHSKCVN-KTHTLDWVMRVPIR------QPSLPQAVVCPDQESECPDD-------TTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSMLGSVPLRRKFPAYKRAEWKARKDSNGLDLADSNDVDCPDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKC-VSSNVLEPVTTNLSPVVRVKVTVESVPCNESVACESGSTCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVCARST 318          

HSP 3 Score: 107.842 bits (268), Expect = 1.155e-24
Identity = 99/350 (28.29%), Postives = 132/350 (37.71%), Query Frame = 3
Query:  168 FQLAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPAL-----------KVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCP-------ITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNS 1163
              + W  +  A++     + C ++ + C    TCC+ K  ++ CC    AVCC D  HCCP+G  CD     C      ++   K  PAL           K   E     +E+K     +  CP + T C   K       N + CCP   AVCC D   CCP + TCD     C      I            K E    +   +  G       S   CP       +T G+ G C      CC D   CCP    CD +   C   ST      +     T+    V+C D  + C   +TCC +SD  + CC  + AVCC D   CCP    CD K   C    S
Sbjct:  411 LSVPWVRKTPATSLPPANDQC-DETSACPTGTTCCRQKSGAWACCPLPQAVCCDDHEHCCPQGYKCDIIHESCDHPFLPSMLWFKKQPALQSMTQQSNANAKAIAESAVADVESKHKCDAQTSCPRDNTCCYMKK------FNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCLKGHLEIPWFK--------KQEAKVTQGSEVAHGVADVQCDSTARCPTGSTCCRLTTGQWGCCPHVQAVCCDDHVHCCPAGYTCDLQAGTCLRTSTLHTVALTLVH--THTKEQVMC-DATSHCTESQTCCKLSDTEWACCPFKQAVCCKDMKHCCPVGYVCDPKAKGCARATS 742          

HSP 4 Score: 105.531 bits (262), Expect = 7.093e-24
Identity = 89/329 (27.05%), Postives = 132/329 (40.12%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSS--PHSIHEMAQELIHDSFKYETNFFKII--SLLLGFKQKAS-KSDFYCPITN--------GRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDF------DTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNS 1163
            +  T C +  TCC+ +  ++ CC    AVCC D  HCCP  + C+     C   A S       +P   V   P T++  A     +   CP   T C+            + CCP   AVCC D   CCP+   CDI ++ C     P  +    Q  +    +      K I  S +   + K    +   CP  N         + G C      CC D   CCP    CD   N C     +       + + ++ S   + ++ V C D+   C +  TCC ++   +GCC    AVCC D V CCP    CD++  +C+ T++
Sbjct:  350 DPTTTCPKGATCCKMESGTWGCCPLPQAVCCEDHLHCCPRNTVCNVAAGTCDS-AFSGTAGQLSVPW--VRKTPATSLPPANDQCDETSACPTGTTCCRQKS-------GAWACCPLPQAVCCDDHEHCCPQGYKCDIIHESCDHPFLPSMLWFKKQPALQSMTQQSNANAKAIAESAVADVESKHKCDAQTSCPRDNTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCLKGHLEIPWFKKQEAKVTQGSEVAHGVADVQC-DSTARCPTGSTCCRLTTGQWGCCPHVQAVCCDDHVHCCPAGYTCDLQAGTCLRTST 667          

HSP 5 Score: 99.3673 bits (246), Expect = 6.600e-22
Identity = 68/217 (31.34%), Postives = 97/217 (44.70%), Query Frame = 3
Query:  561 NNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFY--CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCT---LNST------------DFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETN 1160
              Y CCP  NA CCSD   CC E T CD+++ KC +  H++  + +  I            +   ++   Q++   D    C + +G  G C      CC D   CCPQ T CD  ++KC    L S             ++   K  +       + V CPD  + C    TCC + + SYGCC +  AVCC+D V CCP    CD+  + CV +N
Sbjct:   38 GGYGCCPLPNAECCSDHLHCCHEGTLCDLEHSKCVNKTHTLDWVMRVPIRQP--------SLPQAVVCPDQESECPDDTTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSMLGSVPLRRKFPAYKRAEWKARKDSNGLDLADSNDVDCPDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSSN 246          

HSP 6 Score: 97.4413 bits (241), Expect = 3.245e-21
Identity = 97/359 (27.02%), Postives = 139/359 (38.72%), Query Frame = 3
Query:  207 KETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEK--DEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKC---------------TLNSTDFDTEKSKHSPTTNRLSTVVCP---DNETECFSWETCCAVSD-KSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKT 1220
            K TV ++  N+   C    TCC+TK   + CC    AVCC D  HCCP+G+ C   +  CV    ++ ++  L+    VE +P  N +    NEK      CP   T CK            + CCP   AVCC D   CCP  T C++    C S+        Q  +    K         +               C   +G    C      CC D   CCPQ  KCD  +  C                L S    +  +  +   + ++ V      D +T C    TCC +     +GCC L  AVCC D   CCP++  CD   N+C+      + H  + + K+ + + T
Sbjct:  262 KVTVESVPCNESVACESGSTCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVC--ARSTCV----ASADLLTLV--RWVEKKPTINRVPQPANEKCDPTTTCPKGATCCKMES-------GTWGCCPLPQAVCCEDHLHCCPRNTVCNVAAGTCDSAFSGT--AGQLSVPWVRKTPATSLPPANDQCDETSACPTGTTCCRQKSGAWACCPLPQAVCCDDHEHCCPQGYKCDIIHESCDHPFLPSMLWFKKQPALQSMTQQSNANAKAIAESAVADVESKHKCDAQTSCPRDNTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCL------KGHLEIPWFKKQEAKVT 597          

HSP 7 Score: 85.8853 bits (211), Expect = 1.898e-17
Identity = 53/146 (36.30%), Postives = 69/146 (47.26%), Query Frame = 3
Query:  798 CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNK---RRHFPLTFPKRSKFRKTLN 1226
            C   +G  G C      CCSD   CC + T CD +++KC   +   D          +    VVCPD E+EC    TCC + D S+GCC + NAVCC D++ CCP    CD+  + CV +       RR FP       K RK  N
Sbjct:   33 CQTPSGGYGCCPLPNAECCSDHLHCCHEGTLCDLEHSKCVNKTHTLDWVMRVPIRQPSLPQAVVCPDQESECPDDTTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSMLGSVPLRRKFPAYKRAEWKARKDSN 178          
BLAST of Granulin b vs. Ensembl Cavefish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 111.694 bits (278), Expect = 7.052e-26
Identity = 102/369 (27.64%), Postives = 143/369 (38.75%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVED------------EPKTN--ILEAKVNEKDEVMCP------------NNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKC---TSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFY--CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSN-----KRRHFPLTFPKRSKFRKTL 1223
            +CP+  ++C  + TCC T    + CC    AVCC DK HCCPE S C     KCV      + M    PA    D            +PKT+  +     N+   + C             ++   C D  TCC      + CCP   AVCC D   CCP    C++   KC   + S   + ++    I +    ET  F I    +     A+  D    C  + G    C      CC D   CCP   KC+     C   S      K K  P    L + V  ++   C    TCC      + CC L  AVCC D   CCPH +KC++   +C + + +     K    P++  K  K +  +
Sbjct:  104 MCPDGVSECPVQTTCCPTTDGGWGCCPMPRAVCCADKVHCCPENSVCHVNSSKCVSSTNKELPMWAKFPARLRADWENHRRKDLTNKQPKTSTALKSTTTNKTRNLPCALFSVCTVYNVPCDDTVACADGTTCCKNGEGGWSCCPLPQAVCCDDFLHCCPHGKKCNLIAGKCEDPSGSVPWLKKVPSRPIREKKLPETKGFDIPFYNVPCNDTAACPDETTCCKDSEGEWKCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCEDPSGSVPWMK-KTLPLPPALGSDVPCNDTVACPDETTCCKNVKGGWNCCPLPQAVCCDDFQHCCPHGKKCNVAAGTCEDPSGSVPWIKKVPSRPISGKKLPKVKAGV 471          

HSP 2 Score: 100.523 bits (249), Expect = 3.199e-22
Identity = 98/385 (25.45%), Postives = 133/385 (34.55%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKAS----KSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNST------------------------------------------DFDTEKSKHS--------PTTNRLSTVVCPD-----------NETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTF 1193
            N    C +  TCC+     + CC    AVCC D  HCCP G  C+     C   + S   M K +P            L + V   D V CP+         TCC      + CCP   AVCC D   CCP    C++    C     S+       I        +  K+  +  G    A+         C    G    C    G CC D   CCP    C+ +   C  N+T                                           +  +K++ S        P  N+L+    PD           ++T C +  TCC +S   +GCC L  A CC DR  CCP    CD+ + SCV+T   +    PLT+
Sbjct:  314 NDTAACPDETTCCKDSEGEWKCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCEDPSGSVPWMKKTLPLPPA--------LGSDVPCNDTVACPDE-------TTCCKNVKGGWNCCPLPQAVCCDDFQHCCPHGKKCNVAAGTCEDPSGSV-----PWIKKVPSRPISGKKLPKVKAGVPCNATFACEDESTCCKNDKGGWSCCPLPEGVCCEDRIHCCPHDATCNLRTLTCDKNTTSVPMAGPVKASGPPPPEKKKPKENKANEPAVCCEDGEHCCPAQYKCDKTQTSCIKGDVVIPWYNKLAAESSPDHSVDQSAVKCDSQTSCPAGTTCCEISTGKWGCCPLPEATCCPDREHCCPKGYSCDVNSQSCVKTILLQVETIPLTY 678          

HSP 3 Score: 99.7525 bits (247), Expect = 6.143e-22
Identity = 100/399 (25.06%), Postives = 148/399 (37.09%), Query Frame = 3
Query:  159 VISFQLAWREQGFASNKETVGNICPNKRTKCTERQTCCQT-KHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSS-------------------------------PHSIHEMAQELIHDSFKYETNFFKIISLL-LGFKQKASKSDFYCPITNGRSGR--CKFSAGTCCSDLRTCCPQHTKCDEKNNKC--------TLNSTDFDTEKSKHSPTTNRL----------STVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSN---KRRHFPL 1187
            ++   +A    G  +     G  CPN++  C ++ TCCQ      Y+CC +    CC D  HCCP G  C      C       + +    P     D   +    + V + + VMCP+  ++C    TCC T    + CCP   AVCC+DK  CCPE + C + + KC SS                               P +   +     + +       F + ++  +      + +D      NG  G   C      CC D   CCP   KC+    KC         L        + K  P T              T  CPD         TCC  S+  + CC L  AVCC D + CCPH +KC++   +C + + +    ++  PL
Sbjct:    1 MLKLMVALALLGLVT-----GTQCPNQQL-CGDKHTCCQVLSSGEYNCCPFPQGECCEDHLHCCPAGMLCQTLICSCF--VNDLLFLNHCCP----NDHECSADSISCVKKAEPVMCPDGVSECPVQTTCCPTTDGGWGCCPMPRAVCCADKVHCCPENSVCHVNSSKCVSSTNKELPMWAKFPARLRADWENHRRKDLTNKQPKTSTALKSTTTNKTRNLPCALFSVCTVYNVPCDDTVACADGTTCCKNGEGGWSCCPLPQAVCCDDFLHCCPHGKKCNLIAGKCEDPSGSVPWLKKVPSRPIREKKLPETKGFDIPFYNVPCNDTAACPDE-------TTCCKDSEGEWKCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCEDPSGSVPWMKKTLPL 380          

HSP 4 Score: 85.5001 bits (210), Expect = 2.169e-17
Identity = 93/408 (22.79%), Postives = 143/408 (35.05%), Query Frame = 3
Query:  165 SFQLAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDE--PKTNI---LEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIK----NKKCTSSPHSIHEMAQELI-----------------------------HDSFKYETNFFKIISLLLGFKQKASKSD----------------------FYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSK 1208
            S  + W ++          ++  N    C +  TCC+     ++CC    AVCC D  HCCP G  C+     C      +V   K +P+  +  +  PK        A    +DE  C  N                 + CCP    VCC D+  CCP   TC+++    +K  TS P +    A                                 +   K +T+  K   ++  + + A++S                         C I+ G+ G C     TCC D   CCP+   CD  +  C + +     E      T  R   + C      C   ETCC  S  ++GCC    AVCC+D   CCP    C+    SC +       ++ + F ++ +
Sbjct:  368 SGSVPWMKKTLPLPPALGSDVPCNDTVACPDETTCCKNVKGGWNCCPLPQAVCCDDFQHCCPHGKKCNVAAGTCED-PSGSVPWIKKVPSRPISGKKLPKVKAGVPCNATFACEDESTCCKND-------------KGGWSCCPLPEGVCCEDRIHCCPHDATCNLRTLTCDKNTTSVPMAGPVKASGPPPPEKKKPKENKANEPAVCCEDGEHCCPAQYKCDKTQTSCIKGDVVIPWYNKLAAESSPDHSVDQSAVKCDSQTSCPAGTTCCEISTGKWGCCPLPEATCCPDREHCCPKGYSCDVNSQSC-VKTILLQVETIPL--TYIRHLQIPC-GGGISCSDTETCCKTSKTTWGCCPSPKAVCCSDMKHCCPAGYTCE-ANGSCTQATGFNWDNWSVFFSRKKR 756          

HSP 5 Score: 79.337 bits (194), Expect = 2.609e-15
Identity = 50/143 (34.97%), Postives = 69/143 (48.25%), Query Frame = 3
Query:  804 ITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDF-------DTEKSKHSPT-TNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSK 1208
            +++G    C F  G CC D   CCP    C      C +N   F       D E S  S +   +   V+CPD  +EC    TCC  +D  +GCC +  AVCCAD+V CCP N  C + ++ CV +++NK       FP R +
Sbjct:   35 LSSGEYNCCPFPQGECCEDHLHCCPAGMLCQTLICSCFVNDLLFLNHCCPNDHECSADSISCVKKAEPVMCPDGVSECPVQTTCCPTTDGGWGCCPMPRAVCCADKVHCCPENSVCHVNSSKCV-SSTNKELPMWAKFPARLR 176          
BLAST of Granulin b vs. Ensembl Cavefish
Match: ENSAMXT00000029960.1 (pep primary_assembly:Astyanax_mexicanus-2.0:23:26786284:26792241:-1 gene:ENSAMXG00000014237.2 transcript:ENSAMXT00000029960.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.686 bits (265), Expect = 6.231e-25
Identity = 101/368 (27.45%), Postives = 147/368 (39.95%), Query Frame = 3
Query:  174 LAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALK-----VEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQE---LIHDSFK-YETNFFKIISLLLGFKQKASK-----SDFYCP-------ITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDT---------------EKSKHSPTTNRL------STVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCV 1151
            L     G  S+  T    CP+  T C +  TCC T    Y CC   NAVCCP + +CCP+G  CD    +   C K  +    +   L+      E++P T+++E   +    V C ++   C D  TCC T +  + CCP+    CC D   CCP    CD  + +C     SI   + +   LI +  K  E    K  + ++     +S      S + CP          GR   C ++ G CC D   CCP    CD  + +CTL +    +               E+++  P    +      S +V  D+   C    TCC      + CC      CC D + CCPH   CD  +  C 
Sbjct:    5 LVLLMAGLVSSDIT----CPDGHT-CPDNNTCCLTDQG-YACCPAPNAVCCPGQEYCCPQGYKCDPSSPQ--GCVKQGLPWYDIFMPLQKAVEETEEKPSTSVVELSDDSSPMVHC-DSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQGALSIRSSSPQPAMLIQNKQKAVEETEEKPSATVVELSDDSSPMVHCDSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCTLGALSIRSSSQQPAMLIQEQKAVEETEEKPLATLVELSDDSSPMVHCDSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCT 363          

HSP 2 Score: 97.0561 bits (240), Expect = 1.114e-21
Identity = 74/260 (28.46%), Postives = 112/260 (43.08%), Query Frame = 3
Query:  249 CTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKV----------EDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQE---LIHDSFKYETNFFKIISLLLGFKQKASK-----SDFYCP-------ITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSK 953
            C +  TCC+T +  + CC Y    CC D  HCCP G  CD+   +C++ A S +      PA+ +          E++P   ++E   +    V C ++   C D  TCC T +  + CCP+    CC D   CCP    CD  + +CT    SI   +Q+   LI +    E    K ++ L+     +S      S + CP          GR   C ++ G CC D   CCP    CD  + +CTL +    +   +
Sbjct:  118 CPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQGALS-IRSSSPQPAMLIQNKQKAVEETEEKPSATVVELSDDSSPMVHC-DSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCTLGALSIRSSSQQPAMLIQEQKAVEETEEKPLATLVELSDDSSPMVHCDSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCTLGALSIRSSSQQ 375          

HSP 3 Score: 49.6766 bits (117), Expect = 4.266e-6
Identity = 35/133 (26.32%), Postives = 58/133 (43.61%), Query Frame = 3
Query:   93 SYSIFAVLVGLAVIGSKVAAKGVISFQLAWRE---QGFASNKETVGNICP----NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNIL 470
            S S    L  L++  S      +I  Q A  E   +  A+  E   +  P    +    C +  TCC+T +  + CC Y    CC D  HCCP G  CD+   +C   A S +      PA+ ++++  ++++
Sbjct:  258 STSTRCTLGALSIRSSSQQPAMLIQEQKAVEETEEKPLATLVELSDDSSPMVHCDSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCTLGALS-IRSSSQQPAMLIQEQVHSSVM 389          

HSP 4 Score: 48.9062 bits (115), Expect = 6.070e-6
Identity = 42/175 (24.00%), Postives = 64/175 (36.57%), Query Frame = 3
Query:  744 IISLLLGFKQKASKSDFYCP------------ITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNK-CTLNSTDF---------DTEKSKHSPTTNRL------STVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFP 1184
            +I +L+        SD  CP            +T+     C      CC     CCPQ  KCD  + + C      +           E+++  P+T+ +      S +V  D+   C    TCC      + CC      CC D + CCPH   CD  +  C++   + R   P
Sbjct:    1 MIVVLVLLMAGLVSSDITCPDGHTCPDNNTCCLTDQGYACCPAPNAVCCPGQEYCCPQGYKCDPSSPQGCVKQGLPWYDIFMPLQKAVEETEEKPSTSVVELSDDSSPMVHCDSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQGALSIRSSSP 175          
BLAST of Granulin b vs. Ensembl Cavefish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 107.071 bits (266), Expect = 2.373e-24
Identity = 96/348 (27.59%), Postives = 133/348 (38.22%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVED----------------EPKTNIL----------EAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCT--------LNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSN 1166
            +CP+  ++C  + TCC T    + CC    AVCC DK HCCPE S C     KCV      + M    PA    D                +PKT+             A V+    V C ++   C D  TCC      + CCP   AVCC D   CCP    C++   KC     S+  + +       + +    K+ ++              C  + G    C      CC D   CCP   KC+     C         +        K K  P T ++  V C D    C    TCC  S+  + CC L  AVCC D   CCPH +KC++   +C + + +
Sbjct:  171 MCPDGVSECPVQTTCCPTTDGGWGCCPMPRAVCCADKVHCCPENSVCHVNSSKCVSSTNKELPMWAKFPARLRADWENHRPVAVTPKLTNKQPKTSTALKSTTTNKTRNATVSTVYNVPC-DDTVACADGTTCCKNGEGGWSCCPLPQAVCCDDFLHCCPHGKKCNLIAGKCEDPSGSVPWLKKVPSRPIREKKLPETKVYNVPCNDTAACPDETTCCKDSEGEWKCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCEDPSGSVPWMKKLPSQPIKGKKLPET-KVYNVPCNDTAA-CPDETTCCKDSEGEWKCCPLPQAVCCDDFQHCCPHGKKCNVAAGTCEDPSGS 515          

HSP 2 Score: 103.99 bits (258), Expect = 2.075e-23
Identity = 93/360 (25.83%), Postives = 138/360 (38.33%), Query Frame = 3
Query:  213 TVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDE--PKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFD-TEKSKHSPTTN----RLSTVVCPDNET-ECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSN-----KRRHFPLTFPKRSKFRKTLN----DGNHF 1241
            TV N+  +    C +  TCC+     + CC    AVCC D  HCCP G  C+    KC      +V   K +P+  + ++  P+T +     N  D   CP+         TCC      + CCP   AVCC D   CCP    C++    C     S+  M +         +    K+ ++              C  + G    C      CC D + CCP   KC+     C   S      +K    P +     ++     P N T  C    TCC      + CC L  AVCC D + CCPH +KC++   +C + + +     K+   P+    + K +        D +HF
Sbjct:  284 TVYNVPCDDTVACADGTTCCKNGEGGWSCCPLPQAVCCDDFLHCCPHGKKCNLIAGKCED-PSGSVPWLKKVPSRPIREKKLPETKVYNVPCN--DTAACPDE-------TTCCKDSEGEWKCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCEDPSGSVPWMKKLPSQPIKGKKLPETKVYNVPCNDTAACPDETTCCKDSEGEWKCCPLPQAVCCDDFQHCCPHGKKCNVAAGTCEDPSGSVPWIKKVPSRPISGKKLPKVKGAGVPCNATFACEDESTCCKNDKGGWSCCPLPEAVCCEDFLHCCPHGKKCNLAAMTCDDPSGSIPWLEKKPSRPIGGQNKEKGKAAAANVSCDSSHF 633          

HSP 3 Score: 102.064 bits (253), Expect = 9.466e-23
Identity = 70/255 (27.45%), Postives = 104/255 (40.78%), Query Frame = 3
Query:  456 KTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSI----HEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSK 1208
            K  +  A +       CPN +        C +     Y CCP     CC D   CCP    C     KC +S HS+     + AQ  +  SF+  ++       ++     +   +F C     + G C  + G  C+D   CCP   +C   +  C                   +   V+CPD  +EC    TCC  +D  +GCC +  AVCCAD+V CCP N  C + ++ CV +++NK       FP R +
Sbjct:    7 KLMVALALLGLVTGTQCPNQQLCGDKHTCCQVLSSGEYNCCPFPQGECCEDHLHCCPAGMLCQTAESKCQNSTHSLSWTERKPAQAYLAKSFRMISSSTANKDNIICPDNSSCPPEFSCLKLTDKYGCCPVTQGIVCADRNHCCPNDHECSADSISCV-----------------KKAEPVMCPDGVSECPVQTTCCPTTDGGWGCCPMPRAVCCADKVHCCPENSVCHVNSSKCV-SSTNKELPMWAKFPARLR 243          

HSP 4 Score: 101.293 bits (251), Expect = 1.617e-22
Identity = 97/361 (26.87%), Postives = 136/361 (37.67%), Query Frame = 3
Query:  135 GSKVAAKGVISFQLAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIP-ALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFD-TEKSKHSPTTNR--------LSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPL 1187
            GS    K V S  +  RE+     K  V N+  N    C +  TCC+     + CC    AVCC D  HCCP G  C+     C   + S   M KL    +K +  P+T +     N  D   CP+  T CKD+          + CCP   AVCC D   CCP    C++    C     S+  + +         +    K   +              C    G    C      CC D   CCP   KC+     C   S      EK    P   +         + V C D+   C +  TCC   +  + CC     VCC DR+ CCPH+  C+++T +C +  ++     P+
Sbjct:  346 GSVPWLKKVPSRPI--REKKLPETK--VYNVPCNDTAACPDETTCCKDSEGEWKCCPLPQAVCCDDFIHCCPHGKKCNLAAGTCEDPSGSVPWMKKLPSQPIKGKKLPETKVYNVPCN--DTAACPDETTCCKDS-------EGEWKCCPLPQAVCCDDFQHCCPHGKKCNVAAGTCEDPSGSVPWIKKVPSRPISGKKLPKVKGAGVPCNATFACEDESTCCKNDKGGWSCCPLPEAVCCEDFLHCCPHGKKCNLAAMTCDDPSGSIPWLEKKPSRPIGGQNKEKGKAAAANVSC-DSSHFCPASSTCCKDVNAEWSCCPFPQGVCCEDRIHCCPHDATCNLRTLTCDKNTTSVPMAGPV 692          

HSP 5 Score: 97.0561 bits (240), Expect = 3.747e-21
Identity = 98/409 (23.96%), Postives = 157/409 (38.39%), Query Frame = 3
Query:  159 VISFQLAWREQGFASNKETVGNICPNKRTKCTERQTCCQT-KHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCT--------------------------------LNSTDFDTEKSKHSPTTNR-----LSTV--VCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGNHFSIL*NSTS 1265
            ++   +A    G  +     G  CPN++  C ++ TCCQ      Y+CC +    CC D  HCCP G  C   + KC     S +   +  PA     +    ++ +    KD ++CP+N +   +     +T  + Y CCP    + C+D+  CCP    C   +  C      +  M  + + +     T                      CP T+G  G C      CC+D   CCP+++ C   ++KC                                 L +    T  +  S TTN+     +STV  V  D+   C    TCC   +  + CC L  AVCC D + CCPH +KC++    C + + +    +    P R    K L +   +++  N T+
Sbjct:    5 MLKLMVALALLGLVT-----GTQCPNQQL-CGDKHTCCQVLSSGEYNCCPFPQGECCEDHLHCCPAGMLCQTAESKCQNSTHS-LSWTERKPAQAYLAK-SFRMISSSTANKDNIICPDNSSCPPEFSCLKLT--DKYGCCPVTQGIVCADRNHCCPNDHECSADSISCVKKAEPV--MCPDGVSECPVQTT---------------------CCPTTDGGWGCCPMPRAVCCADKVHCCPENSVCHVNSSKCVSSTNKELPMWAKFPARLRADWENHRPVAVTPKLTNKQPKTSTALKSTTTNKTRNATVSTVYNVPCDDTVACADGTTCCKNGEGGWSCCPLPQAVCCDDFLHCCPHGKKCNLIAGKCEDPSGSVP--WLKKVPSRPIREKKLPETKVYNVPCNDTA 378          
BLAST of Granulin b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009302.1 (pep scaffold:Pmarinus_7.0:GL483232:1183:11161:1 gene:ENSPMAG00000008413.1 transcript:ENSPMAT00000009302.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.487 bits (319), Expect = 8.679e-32
Identity = 98/371 (26.42%), Postives = 150/371 (40.43%), Query Frame = 3
Query:  132 IGSKVAAKGVISFQLAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIIS----LLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFD-TEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLT--FPKRSKFRKTL 1223
            + ++   +G +S   + +        E    IC + ++ C +  TCC+     + CC    AVCC D  HCCPEG+TC+    +C K    ++      PAL+V  EP   I +      D+  CP+         TCC     ++ CCP   AVCC D   CCP+ TTC++  + C           Q  +   +  +T   ++      ++   +      D  C + +G  G C      CC D   CCPQ T C+     C   +     + K+         + V C D++  C    TCC      +GCC L  AVCC D   CCP    C++   SC       +   P +   P R++    L
Sbjct:  338 LPAQTCDQGTLSLPWSTKTPALRVAGEPNVVIC-DDQSSCPDGNTCCKMPSGDWGCCPLPKAVCCDDHQHCCPEGTTCNLPVERCDK-GTLSLPWSTKTPALRVAGEPNVVICD------DQFSCPDG-------NTCCKLPSGDWGCCPLVKAVCCDDHEHCCPQGTTCNLPAQTCD----------QGTLSLPWSTKTPALRVAGEPNVVICDDQFSCPDGDTCCKMPSGDWGCCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDKGALSLPWSTKTPALRVAGEPNDVKC-DDQVSCPDQTTCCKTGTGDWGCCPLVKAVCCDDHEHCCPEGTTCNVPAGSC----DQGQLSLPWSSKTPARTRLTALL 678          

HSP 2 Score: 124.405 bits (311), Expect = 9.077e-31
Identity = 102/361 (28.25%), Postives = 144/361 (39.89%), Query Frame = 3
Query:  153 KGVISFQLAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCP------------DNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPK 1199
            KG +S   + +        E    IC + +  C +  TCC+     + CC    AVCC D  HCCP+G+TC+     C +    ++      PAL+V  EP   I +      D+  CP+  T CK           ++ CCP   AVCC D   CCP+ TTC++  + C     S+   + +        E N  K    +    Q        C    G  G C      CC D   CCP+ T C+     C  +        S  +P   RL+ ++ P            D+   C    TCC +    +GCC L  A CC+D V CCP    CD+   SC+     K+ HF    PK
Sbjct:  423 KGTLSLPWSTKTPALRVAGEPNVVIC-DDQFSCPDGNTCCKLPSGDWGCCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQ-GTLSLPWSTKTPALRVAGEPNVVICD------DQFSCPDGDTCCKMPS-------GDWGCCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDKGALSL-PWSTKTPALRVAGEPNDVKCDDQVSCPDQTTC-----CKTGTGDWGCCPLVKAVCCDDHEHCCPEGTTCNVPAGSC--DQGQLSLPWSSKTPARTRLTALL-PASAAARGGSVRCDSAYACPDGTTCCQLPQGQWGCCPLPLATCCSDFVHCCPSGYTCDLAQASCI-----KKPHFLTWAPK 754          

HSP 3 Score: 119.398 bits (298), Expect = 3.979e-29
Identity = 90/320 (28.12%), Postives = 133/320 (41.56%), Query Frame = 3
Query:  204 NKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIIS----LLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFD-TEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
            +K+   ++  +  T C+++ TCC      + CC    AVCC DK HCCPEG+ C+     C   A S +      PAL++  EP        V   D V CP+         TCC T   ++ CCP   AVCC D   CCP+ TTC++  + C           Q  +   +  +T   ++      ++   +      +  C    G    C      CC D   CCPQ T C+     C   +     + K+         + V+C D+++ C    TCC +    +GCC L  AVCC D   CCP    C++    C
Sbjct:  127 SKQAASDVQCDAFTSCSDQNTCCILPSGQWGCCPLPKAVCCDDKEHCCPEGTICNVTSQTCNHAALS-LPWSTKTPALRMTGEPN------DVQCDDLVGCPDG-------NTCCKTPGGDWACCPLVKAVCCDDHEHCCPQGTTCNLPAQTCD----------QGTLSLPWSTKTPALRVAGEPNVVICDDQSSCPDGNTCCKTPGGDWACCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQGTLSLPWSTKTPALRVAGEPNVVIC-DDQSSCPDGNTCCKMPSGDWGCCPLPKAVCCDDHQHCCPEGTTCNLPVERC 421          

HSP 4 Score: 111.309 bits (277), Expect = 1.842e-26
Identity = 85/324 (26.23%), Postives = 129/324 (39.81%), Query Frame = 3
Query:  180 WREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFD-TEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
            WR +  A +       CP+  T C +  TCC      Y CC   +AVCC D  HCCP+ + CD K  KCV   K ++      P+ +   + + +   +  ++    + P+                  + CCP   AVCC DK  CCPE T C++ ++ C  +  S+   + +        E N  +   L+          +  C    G    C      CC D   CCPQ T C+     C   +     + K+         + V+C D+++ C    TCC      + CC L  AVCC D   CCP    C++   +C
Sbjct:   46 WRWR-LARSLAVRPPQCPDG-TSCGDDATCCPLASGQYGCCSLEDAVCCSDYLHCCPKNTMCDLKLGKCVH-GKLSIPWVSKYPSKQAASDVQCDAFTSCSDQNTCCILPS----------------GQWGCCPLPKAVCCDDKEHCCPEGTICNVTSQTCNHAALSL-PWSTKTPALRMTGEPNDVQCDDLV-----GCPDGNTCCKTPGGDWACCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQGTLSLPWSTKTPALRVAGEPNVVIC-DDQSSCPDGNTCCKTPGGDWACCPLVKAVCCDDHEHCCPQGTTCNLPAQTC 343          

HSP 5 Score: 90.1225 bits (222), Expect = 1.435e-19
Identity = 67/213 (31.46%), Postives = 93/213 (43.66%), Query Frame = 3
Query:  588 NAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKII-SLLLGFKQ-----KASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSK 1208
             AVCCSD   CCP  T CD+ +  C     S+  + +     +F   T  +++  SL +   Q             CP+ +G+ G C      CCSD   CCP++T CD K  KC           SK+ P+    S V C D  T C    TCC +    +GCC L  AVCC D+  CCP    C++ + +C         H  L+ P  +K
Sbjct:    1 QAVCCSDGLHCCPSGTVCDLAHGMCQKGKISVPWLEKT---PTFTPRTWRWRLARSLAVRPPQCPDGTSCGDDATCCPLASGQYGCCSLEDAVCCSDYLHCCPKNTMCDLKLGKCVHGKLSI-PWVSKY-PSKQAASDVQC-DAFTSCSDQNTCCILPSGQWGCCPLPKAVCCDDKEHCCPEGTICNVTSQTC--------NHAALSLPWSTK 199          

HSP 6 Score: 69.3218 bits (168), Expect = 8.118e-13
Identity = 50/132 (37.88%), Postives = 62/132 (46.97%), Query Frame = 3
Query:  846 TCCSDLRTCCPQHTKCDEKNNKCTLN--STDFDTEKSKHSPTTNRL----STVV----CPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKF 1211
             CCSD   CCP  T CD  +  C     S  +  +    +P T R     S  V    CPD  T C    TCC ++   YGCC LE+AVCC+D + CCP N  CD+K   CV        H  L+ P  SK+
Sbjct:    3 VCCSDGLHCCPSGTVCDLAHGMCQKGKISVPWLEKTPTFTPRTWRWRLARSLAVRPPQCPDG-TSCGDDATCCPLASGQYGCCSLEDAVCCSDYLHCCPKNTMCDLKLGKCV--------HGKLSIPWVSKY 125          
BLAST of Granulin b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001039.1 (pep scaffold:Pmarinus_7.0:GL484091:11570:24665:-1 gene:ENSPMAG00000000936.1 transcript:ENSPMAT00000001039.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 1.147e-22
Identity = 89/304 (29.28%), Postives = 123/304 (40.46%), Query Frame = 3
Query:  249 CTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETN 1160
            C   QTCC+++   + CC    A CC D  HCCP  + C   Q          V    LIP LK E       L   V   D V+       C+  +TCC ++   + CC  + A CCSD   CCP   + D+K + C +S   I  + +E    S     N         G  Q   +    C    G  G C     TCCSD   CCP  T+C      C+ +S     E       ++ LS  +  D+   C  W+TCC      +GCC    A CC+D + CCP   +C +    C  ++
Sbjct:  303 CRRWQTCCRSRCGMWGCCNGRKATCCSDGIHCCPSMTRCLVGQ---------CVNSAALIPWLKKEAA-----LSGPVG--DNVVHCGGGQYCRRWQTCCRSRRGMWGCCNGRRATCCSDGIHCCPSGASGDLKGQ-CVNSAALIPWLKKEAAL-SGPVGDNLVHC-----GGGQYCRRWQTCCRSRRGMWGCCNGRRATCCSDGIHCCPSMTRCLVPYRLCSRSS-----EALSGVAGSSTLSHALPYDSRVYCRRWQTCCRSRCGMWGCCNGRRATCCSDGIHCCPSMTRCLVPYRLCSRSS 578          

HSP 2 Score: 93.2041 bits (230), Expect = 1.372e-20
Identity = 84/297 (28.28%), Postives = 112/297 (37.71%), Query Frame = 3
Query:  249 CTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLS-TVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIK 1136
            C   QTCC+++   + CC    A CC D  HCCP  + C   Q          V    LIP LK E      + +  V+      C   +T C+            + CC  + A CCSD   CCP  T C +   +C +S   I  + +E    S     N         G  Q   +    C    G  G C     TCCSD   CCP  T+C        +NS        K +  +  +   VV       C  W+TCC      +GCC    A CC+D + CCP     D+K
Sbjct:  151 CRRWQTCCRSRRGMWGCCNGRRATCCSDGIHCCPSMTRCLVGQ---------CVNSAALIPWLKKEAALSGPVGDNVVHCGGGQYCRRWQTCCRSRC-------GMWGCCNGRRATCCSDGIHCCPSMTRCLV--GQCVNSAALIPWLKKEAAL-SGPVGDNLVHC-----GGGQYCRRWQTCCRSRCGMWGCCNGRKATCCSDGIHCCPSMTRCLVGQ---CVNSAALIPWLKKEAALSGPVGDNVVHCGGGQYCRRWQTCCRSRRGMWGCCNGRRATCCSDGIHCCPSGASGDLK 420          

HSP 3 Score: 88.1965 bits (217), Expect = 4.881e-19
Identity = 77/291 (26.46%), Postives = 116/291 (39.86%), Query Frame = 3
Query:  267 CCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAK-QHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLS-TVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDI 1133
            CC+++   + CC    A CC D  HCCP  + C    + +CV  A        LIP LK E      + +  V+      C   +T C+            + CC  + A CCSD   CCP  T C +  + C+ S  ++      ++    + + + + ++    G  Q   +    C    G  G C     TCCSD   CCP  T+C        +NS        K +  +  +   VV       C  W+TCC      +GCC    A CC+D + CCP   +C +
Sbjct:    1 CCRSRCGMWGCCNGRKATCCSDGIHCCPSMTRCLVPYRGQCVNSA-------ALIPWLKKEAALSGPVGDNLVHCGGGQYCRRWQTCCRSRC-------GMWGCCNGRKATCCSDGIHCCPSMTRCLVPYRLCSRSSEAL-----SVLDYLSREQQDGYNVVH--CGGGQYCRRWQTCCRSRRGMWGCCNGRRATCCSDGIHCCPSMTRCLVGQ---CVNSAALIPWLKKEAALSGPVGDNVVHCGGGQYCRRWQTCCRSRCGMWGCCNGRRATCCSDGIHCCPSMTRCLV 267          

HSP 4 Score: 85.5001 bits (210), Expect = 3.851e-18
Identity = 79/302 (26.16%), Postives = 114/302 (37.75%), Query Frame = 3
Query:  249 CTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNE---KDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTD----FDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDI 1133
            C   QTCC+++   + CC    A CC D  HCCP  + C      C +    + E   ++  L  E +   N++     +   + +  C +                  + CC  + A CCSD   CCP  T C +   +C +S   I  + +E    S     N         G  Q   +    C    G  G C     TCCSD   CCP  T+C        +NS         E +   P  + L  V C   +  C  W+TCC      +GCC    A CC+D + CCP   +C +
Sbjct:   74 CRRWQTCCRSRCGMWGCCNGRKATCCSDGIHCCPSMTRCLVPYRLCSR----SSEALSVLDYLSREQQDGYNVVHCGGGQYCRRWQTCCRSR--------------RGMWGCCNGRRATCCSDGIHCCPSMTRCLV--GQCVNSAALIPWLKKEAAL-SGPVGDNVVHC-----GGGQYCRRWQTCCRSRCGMWGCCNGRRATCCSDGIHCCPSMTRCLVGQ---CVNSAALIPWLKKEAALSGPVGDNL--VHCGGGQ-YCRRWQTCCRSRCGMWGCCNGRKATCCSDGIHCCPSMTRCLV 343          

HSP 5 Score: 50.447 bits (119), Expect = 5.091e-7
Identity = 37/120 (30.83%), Postives = 50/120 (41.67%), Query Frame = 3
Query:  813 GRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDF----DTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETN 1160
            G  G C     TCCSD   CCP  T+C        +NS         E +   P  + L  V C   +  C  W+TCC      +GCC    A CC+D + CCP   +C +    C  ++
Sbjct:    7 GMWGCCNGRKATCCSDGIHCCPSMTRCLVPYRGQCVNSAALIPWLKKEAALSGPVGDNL--VHCGGGQ-YCRRWQTCCRSRCGMWGCCNGRKATCCSDGIHCCPSMTRCLVPYRLCSRSS 123          
BLAST of Granulin b vs. Ensembl Nematostella
Match: EDO27824 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T870])

HSP 1 Score: 72.7886 bits (177), Expect = 1.197e-14
Identity = 71/236 (30.08%), Postives = 97/236 (41.10%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFK---IISLLLGFKQKASKS-----DFY---CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNN 908
            N  + C + +TCC+    SY CC   NAVCC D  HCCP G  CD     C   AK +  M      ++     +  + E K   KD   C   +T C             Y CCP  +AVCC+D   CCP   TC+ K+  C    H +  M Q+  H S        K   II   + F  +  +      + Y   C  ++ +   C     +CCSD   CCPQ   CD++  
Sbjct:   10 NDGSHCYDYETCCELSTGSYGCCPLPNAVCCSDGKHCCPCGYHCDISSSTCDM-AKDSTPMVSYHATVQ-----RAGVGEIKC--KDGSHCNTGETCCLVGP-------TKYGCCPLPSAVCCADMQHCCPSGYTCNDKSGHCQRGRHVL-PMFQK--HPSVHPRPAVAKTPVIIDHTIRFVPRGGRGAGCACEPYHTCCGSSSAQQNCCPLPNASCCSDGLHCCPQGFICDDQKG 227          

HSP 2 Score: 71.633 bits (174), Expect = 2.556e-14
Identity = 58/206 (28.16%), Postives = 81/206 (39.32%), Query Frame = 3
Query:  561 NNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELI-HDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNS---TDFDTEKSKHSPTTNRLSTVVCPDNETE------------CFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCD 1130
             +Y CCP  NAVCCSD   CCP    CDI +  C        +MA++     S+        +  +        +  +  C +   + G C   +  CC+D++ CCP    C++K+  C         F    S H P      T V  D+               C  + TCC  S     CC L NA CC+D + CCP    CD
Sbjct:   27 GSYGCCPLPNAVCCSDGKHCCPCGYHCDISSSTC--------DMAKDSTPMVSYHATVQRAGVGEIKCKDGSHCNTGETCCLVGPTKYGCCPLPSAVCCADMQHCCPSGYTCNDKSGHCQRGRHVLPMFQKHPSVH-PRPAVAKTPVIIDHTIRFVPRGGRGAGCACEPYHTCCGSSSAQQNCCPLPNASCCSDGLHCCPQGFICD 223          

HSP 3 Score: 66.6254 bits (161), Expect = 1.141e-12
Identity = 48/141 (34.04%), Postives = 64/141 (45.39%), Query Frame = 3
Query:  798 CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNR--LSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFR 1214
            C ++ G  G C      CCSD + CCP    CD  ++ C + + D     S H+ T  R  +  + C D  + C + ETCC V    YGCC L +AVCCAD   CCP    C+ K+  C      + RH    F K     
Sbjct:   22 CELSTGSYGCCPLPNAVCCSDGKHCCPCGYHCDISSSTCDM-AKDSTPMVSYHA-TVQRAGVGEIKCKDG-SHCNTGETCCLVGPTKYGCCPLPSAVCCADMQHCCPSGYTCNDKSGHC-----QRGRHVLPMFQKHPSVH 154          

HSP 4 Score: 59.3066 bits (142), Expect = 4.487e-10
Identity = 30/82 (36.59%), Postives = 45/82 (54.88%), Query Frame = 3
Query:  996 DNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC-VETNSNKRRHFPLTFPKRSKFRKTLNDGNH 1238
            ++ + C+ +ETCC +S  SYGCC L NAVCC+D   CCP    CDI +++C +  +S     +  T  +         DG+H
Sbjct:   10 NDGSHCYDYETCCELSTGSYGCCPLPNAVCCSDGKHCCPCGYHCDISSSTCDMAKDSTPMVSYHATVQRAGVGEIKCKDGSH 91          

HSP 5 Score: 55.4546 bits (132), Expect = 8.284e-9
Identity = 46/162 (28.40%), Postives = 63/162 (38.89%), Query Frame = 3
Query:  204 NKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEV-MCPNNXXXXXXXXXXX----XXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSP 674
             +  VG I     + C   +TCC      Y CC   +AVCC D  HCCP G TC+ K   C +  +  + M +  P++     P+  + +  V     +   P                  +      CCP  NA CCSD   CCP+   CD   K C   P
Sbjct:   77 QRAGVGEIKCKDGSHCNTGETCCLVGPTKYGCCPLPSAVCCADMQHCCPSGYTCNDKSGHCQR-GRHVLPMFQKHPSV----HPRPAVAKTPVIIDHTIRFVPRGGRGAGCACEPYHTCCGSSSAQQNCCPLPNASCCSDGLHCCPQGFICD-DQKGCVKQP 232          
BLAST of Granulin b vs. Ensembl Medaka
Match: grnb (granulin precursor [Source:NCBI gene;Acc:101166910])

HSP 1 Score: 149.058 bits (375), Expect = 2.034e-38
Identity = 120/387 (31.01%), Postives = 171/387 (44.19%), Query Frame = 3
Query:   99 SIFAVLVGLAVI----GSKVAAKGVISFQLAWREQGFA---SNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTD----FDTEKSKHSPTTNRLSTVVCPDNET-ECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLT-----FPKRSK 1208
            ++  VLVGL+         V A G   F  +    GF     +      ICP++ ++C +  TCCQ    S+ CC +  AVCC D+ HCCPEG+TCD    KC   +     M + +PA +V   P   +  A  +    V+CP  K+ C ++ TCC+    ++ CCP+  A CCSD   CCP  TTCD++   C S      E   E I        +      L    +         C + NG  G C      CCSD   CCP+ T CD  ++ C   +           S   P T+ +  +  P N +  C    TCC  S   +GCC L  AVCC D + CCPH   C++  ++C + + +     PL      FP RS+
Sbjct:    3 ALCVVLVGLSAALLCPDGAVCADGHKCFLNS--HGGFTCPLPHTRVGAVICPDQESECPDETTCCQLPDGSWGCCPFPKAVCCEDQRHCCPEGTTCDLVHSKCASPSLQAFPMLQKVPAQRVGTLP---VFAAAAS----VVCPGGKSSCPNSFTCCLLTSGDFGCCPYPQATCCSDHLHCCPGNTTCDLERGVCKSG-----EARVEPIRAVSASPEDV-----LCPDQRSMCPDGTTCCQLNNGTFGCCPLPNAVCCSDHMHCCPEGTTCDLAHSTCVSAAGGTAEAVMVPVSGTPPKTHPVRGLAVPCNASVACADGSTCCRASRGQWGCCPLPEAVCCEDHLHCCPHGTVCNLVASTCDDPSGSALT--PLLSNTPGFPYRSE 368          

HSP 2 Score: 130.954 bits (328), Expect = 2.878e-32
Identity = 100/372 (26.88%), Postives = 152/372 (40.86%), Query Frame = 3
Query:  129 VIGSKVAAKGVISFQL-----AWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLND 1229
            ++ SK A+  + +F +     A R             +CP  ++ C    TCC      + CC Y  A CC D  HCCP  +TCD ++  C    KS               E +   + A     ++V+CP+ ++ C D  TCC   +  + CCP  NAVCCSD   CCPE TTCD+ +  C S+     E     +  +   +T+  + +++        +     C  + G+ G C      CC D   CCP  T C+   + C   S    T    ++P     S     D    C    TCC      + CC L  AVCC D + CCP+   C+++  +C +  S      P    KR +    + +
Sbjct:   98 LVHSKCASPSLQAFPMLQKVPAQRVGTLPVFAAAASVVCPGGKSSCPNSFTCCLLTSGDFGCCPYPQATCCSDHLHCCPGNTTCDLERGVC----KSG--------------EARVEPIRAVSASPEDVLCPDQRSMCPDGTTCCQLNNGTFGCCPLPNAVCCSDHMHCCPEGTTCDLAHSTCVSAAGGTAEAVMVPVSGT-PPKTHPVRGLAVPCNASVACADGSTCCRASRGQWGCCPLPEAVCCEDHLHCCPHGTVCNLVASTCDDPSGSALTPLLSNTPGFPYRSENGRCDESASCPGEATCCRTRAGGWACCPLPQAVCCDDHIHCCPNATICNLEAETC-DDPSGLSPPLPW-LTKRPRLTAGMEE 448          

HSP 3 Score: 112.464 bits (280), Expect = 4.071e-26
Identity = 91/328 (27.74%), Postives = 131/328 (39.94%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETE--CFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKF 1211
             K   C  R TCC+     + CC    AVCC D  HCCP+G  C+A    C +    ++   + +PAL+ +   +T  +E K +   +  CP + T C   +T        + CCP   AVCC D   CCP   +C      C+   H +    +          T    +  +    K   +     CP+  G  G C      CC+D   CCPQ   C+ +   C   +       S+  P   + +  V  D   E  C    TCC +S  ++GCC    AVCC D   CCP    CD+K   C  T   +     L   +R+ F
Sbjct:  452 GKDAVCPGRTTCCKNSSGQWACCPLPQAVCCSDLDHCCPKGYKCNAFDRTCERPGGPSLPWRQKLPALQ-QRSGQTGPVENKCDA--QTSCPKDTTCCFMEQTL------KWGCCPLPQAVCCGDGNHCCPRGHSCQPHRSSCSRGSHVVPWFTK------VGALTEPSGVTDVKCDNKSSCASGTTCCPLQTGGWGCCPLVKAVCCADHEHCCPQSYTCNMQTGTCEKKAGQ-GLPLSRVVPAQPQDTQDVPCDGTGEFKCPKQNTCCRISATAWGCCPSPGAVCCMDSKHCCPAGYSCDLKAGGC--TLGPRLSWDSLIGGRRTDF 761          

HSP 4 Score: 108.227 bits (269), Expect = 9.378e-25
Identity = 104/361 (28.81%), Postives = 139/361 (38.50%), Query Frame = 3
Query:  153 KGVISFQLAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDS--FKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECF------SWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKF 1211
            +GV     A  E   A +      +CP++R+ C +  TCCQ  + ++ CC   NAVCC D  HCCPEG+TCD     CV  A    E   ++P       PKT+ +         V C N    C D  TCC      + CCP   AVCC D   CCP  T C++    C     S       L+ ++  F Y +   +                  C    G    C      CC D   CCP  T C+ +   C     D  +  S   P   +   +     E +C          TCC  S   + CC L  AVCC+D   CCP   KC+    +C      +R   P + P R K 
Sbjct:  185 RGVCKSGEARVEPIRAVSASPEDVLCPDQRSMCPDGTTCCQLNNGTFGCCPLPNAVCCSDHMHCCPEGTTCDLAHSTCVSAAGGTAEA-VMVPVSGT--PPKTHPVRGLA-----VPC-NASVACADGSTCCRASRGQWGCCPLPEAVCCEDHLHCCPHGTVCNLVASTCDDPSGS---ALTPLLSNTPGFPYRSENGRCDE-----SASCPGEATCCRTRAGGWACCPLPQAVCCDDHIHCCPNATICNLEAETC-----DDPSGLSPPLPWLTKRPRLTAGMEEEKCGKDAVCPGRTTCCKNSSGQWACCPLPQAVCCSDLDHCCPKGYKCNAFDRTC------ERPGGP-SLPWRQKL 516          

HSP 5 Score: 73.9442 bits (180), Expect = 1.192e-13
Identity = 48/172 (27.91%), Postives = 75/172 (43.60%), Query Frame = 3
Query:  165 SFQLAW-REQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPH 677
            S  + W  + G  +    V ++  + ++ C    TCC  +   + CC    AVCC D  HCCP+  TC+ +   C K A   + + +++PA   + +      +   +   E  CP   T C+ +          + CCP   AVCC D   CCP   +CD+K   CT  P 
Sbjct:  589 SHVVPWFTKVGALTEPSGVTDVKCDNKSSCASGTTCCPLQTGGWGCCPLVKAVCCADHEHCCPQSYTCNMQTGTCEKKAGQGLPLSRVVPAQPQDTQ------DVPCDGTGEFKCPKQNTCCRISA-------TAWGCCPSPGAVCCMDSKHCCPAGYSCDLKAGGCTLGPR 747          

HSP 6 Score: 69.707 bits (169), Expect = 2.694e-12
Identity = 70/257 (27.24%), Postives = 104/257 (40.47%), Query Frame = 3
Query:  174 LAWREQGFASNKETVGNICP-----NKRTKCTERQTCCQTKHN-SYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQEL-IHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLN 923
            L WR++   + ++  G   P     + +T C +  TCC  +    + CC    AVCC D  HCCP G +C   +  C +          ++P        K   L       D V C +NK+ C    TCC  +   + CCP   AVCC+D   CCP++ TC+++   C        +  Q L +      +    + +      + K  K +  C I+    G C      CC D + CCP    CD K   CTL 
Sbjct:  510 LPWRQK-LPALQQRSGQTGPVENKCDAQTSCPKDTTCCFMEQTLKWGCCPLPQAVCCGDGNHCCPRGHSCQPHRSSCSR-------GSHVVPWFT-----KVGALTEPSGVTD-VKC-DNKSSCASGTTCCPLQTGGWGCCPLVKAVCCADHEHCCPQSYTCNMQTGTCE------KKAGQGLPLSRVVPAQPQDTQDVPCDGTGEFKCPKQNTCCRISATAWGCCPSPGAVCCMDSKHCCPAGYSCDLKAGGCTLG 745          
BLAST of Granulin b vs. Ensembl Medaka
Match: grna (granulins [Source:NCBI gene;Acc:101162601])

HSP 1 Score: 122.479 bits (306), Expect = 2.015e-29
Identity = 91/339 (26.84%), Postives = 135/339 (39.82%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLN--STDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNS--NKRRHFPLTFPKRSKFRKTLNDGNH 1238
            +  T C ++ TCC+T+   + CC +  AVCC D  HCCP+G TC+     C      +V M + +P+       K ++    V       CP+  T CK            + CCP   AVCC D   CCP+  TC++  + C     S+      ++     +     K+  +              C    G  G C F    CC D   CCP+   C+     C  +  S     +    S  + ++  V C D  T C    TCC   D ++GCC L  AVCC D   CCP    CD+ T SC++ +      +  P +    S   + +  G  
Sbjct:  534 DGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEG-DGGSVPMLEKVPSFS-----KVSVKMEDVPCDGSTSCPDQTTCCKTQ-------EGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSV-----PMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSKVSVKMEDVPC-DGSTSCPDQTTCCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTCDLSTLSCLKASGLVPMSKKLPASTRTSSATSQLMKTGQE 853          

HSP 2 Score: 118.242 bits (295), Expect = 5.849e-28
Identity = 87/326 (26.69%), Postives = 134/326 (41.10%), Query Frame = 3
Query:  177 AWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLN--STDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
            A+ E    + + +  +I  N+   C ++ TCC+T+   + CC +  AVCC D  HCCP+G TC+     C      +V M + +P+       K ++    V       CP+         TCC T+   + CCP   AVCC D   CCP+  TC++  + C     S+      ++     +     K+  +              C    G  G C F    CC D   CCP+   C+     C  +  S     +    S  + ++  V C D  T C    TCC   +  +GCC    AVCC D + CCP  + C++   +C
Sbjct:  278 AFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEG-DGGSVPMLEKVPSFS-----KVSVKMEDVPCDGSTSCPDQ-------TTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSV-----PMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSNVSVKMEDVPC-DGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTC 584          

HSP 3 Score: 114.775 bits (286), Expect = 7.923e-27
Identity = 95/360 (26.39%), Postives = 145/360 (40.28%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNIL------------------------EAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKC-----------TLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSK 1208
            +  T C ++ TCC+TK  ++ CC    AVCC D  HCCP G+TCD     C+K A   V M K +PA        + ++                        E K +E+  + C ++    + T  C + +   + CCP   AVCC+D   CCP    C  ++  C      I    +    DS + +++F +  ++      +  +    C +  G  G C      CC D   CCP+   CD  +  C            L       ++S+H P    L+     D+   C   ETCC  S  ++GCC    AVCC D   CCP   +C  K  SC++       ++   F  + K
Sbjct:  771 DGSTSCPDQTTCCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTCDLSTLSCLK-ASGLVPMSKKLPASTRTSSATSQLMKTGQETEEGENKPDDRDGQEDFDEEDKTDEEGIISCDSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCADGEHCCPADYKCKEEDTSCVKGEVVIPWYTKIPATDSIQADSSFVQCSAV-----HQCPEHMSCCRLFTGEWGCCPLPNAVCCGDKEHCCPEGYTCDLASKSCHKLLTLQLETVPLTPVFLPDDQSQHGPVKPILNRC---DDVYSCNVDETCCRTSHTTWGCCLSPKAVCCRDMKHCCPDGYRC-TKGGSCIKNTGLHWLNWHTFFTNKRK 1120          

HSP 4 Score: 110.153 bits (274), Expect = 2.657e-25
Identity = 102/376 (27.13%), Postives = 140/376 (37.23%), Query Frame = 3
Query:  162 ISFQLAWREQGFASNKETVG----NICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNE-KDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDS-------------------------FKYETNFFKIISLLLG--FKQKASKSDFYCPIT-------------NGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLN--STDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
            +S  L    + F   +  +G    NICP+ +++C    +C +     Y CC  A  V CPD  HCCPEG  C      CVK                 ++  KT + +  V+E  DE  C  N+                + CCP   AVCC DK  CCPE TTCD++  KC SS      M  +    +                         F   T    + + L G     +AS  D  C  T              G  G C F    CC D   CCP+   C+     C  +  S     +    S  + ++  V C D  T C    TCC   +  +GCC    AVCC D + CCP  + C++   +C
Sbjct:   84 VSANLQMATKSFRMIRSYMGEDEDNICPD-QSRCPAEFSCLKA-LTRYGCCPLAQGVSCPDGKHCCPEGHQCSLDSRSCVK-----------------KESIKTVLCKDGVSECPDETTCCENQ-------------EGKWACCPMPKAVCCDDKIHCCPEETTCDVEQMKCLSSSDKALPMWAKFPARTRADWENQKEGKEVSAVAVEGNETKNFPEVTTANPVPAFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSKVSVKMEDVPC-DGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTC 426          

HSP 5 Score: 106.686 bits (265), Expect = 3.570e-24
Identity = 93/350 (26.57%), Postives = 138/350 (39.43%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIP-----ALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCT------------------------LNSTDFDTEKSKHSPT-------------TNRLSTVVCPDNETECFSWETCCAVSD-KSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVE 1154
            +  T C ++ TCC+T+   + CC +  AVCC D  HCCP+G TC+     C      +V M + +P     ++K+ED P     +   +  D+  C             C T+   + CCP   AVCC D   CCP+  TC++  + C     S+      ++     +     K+  +              C   +G  G C      CC D   CCP  T CD     C                         L  T  +TE+ ++ P              T+    + C D+ T+C    TCC +   + +GCC L  AVCCAD   CCP + KC  +  SCV+
Sbjct:  613 DGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEG-DGGSVPMLEKVPSFSNVSVKMEDVP----CDGSTSCPDQTTC-------------CKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSV-----PMLEKVPSFSKVSVKMEDVPCDGSTSCPDQTTCCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTCDLSTLSCLKASGLVPMSKKLPASTRTSSATSQLMKTGQETEEGENKPDDRDGQEDFDEEDKTDEEGIISC-DSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCADGEHCCPADYKCKEEDTSCVK 938          

HSP 6 Score: 95.9005 bits (237), Expect = 1.270e-20
Identity = 61/222 (27.48%), Postives = 98/222 (44.14%), Query Frame = 3
Query:  564 NYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLG-------FKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSK 1208
            +Y CCP   A CC D   CCP+   CD+    C ++  S+  +  E +  + +  T  F++I   +G         Q    ++F C     R G C  + G  C D + CCP+  +C   +  C    +               + TV+C D  +EC    TCC   +  + CC +  AVCC D++ CCP    CD++   C+ ++S+K       FP R++
Sbjct:   39 DYDCCPFDEAECCGDHIHCCPKDMLCDMTTSSCGNATLSMRWV--ERVSANLQMATKSFRMIRSYMGEDEDNICPDQSRCPAEFSCLKALTRYGCCPLAQGVSCPDGKHCCPEGHQCSLDSRSCVKKES---------------IKTVLCKDGVSECPDETTCCENQEGKWACCPMPKAVCCDDKIHCCPEETTCDVEQMKCL-SSSDKALPMWAKFPARTR 242          

HSP 7 Score: 93.5893 bits (231), Expect = 6.134e-20
Identity = 89/370 (24.05%), Postives = 133/370 (35.95%), Query Frame = 3
Query:  180 WREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNR-----------LSTVVCPDNETE------------------------------------CFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
            W    + S      ++CPN   KC + QTCCQ+    Y CC +  A CC D  HCCP+   CD     C     S   + ++   L++  +    ++ + + E ++ +CP+      +           Y CCP    V C D   CCPE   C + ++ C                   K E+   K +    G  +   ++   C    G+   C      CC D   CCP+ T CD +  KC L+S+D         P   R           +S V    NET+                                    C    TCC   +  +GCC    AVCC D + CCP  + C++   +C
Sbjct:    4 WVVICWVSLALVAADMCPNGG-KCEKGQTCCQSPSKDYDCCPFDEAECCGDHIHCCPKDMLCDMTTSSCGNATLSMRWVERVSANLQMATK-SFRMIRSYMGEDEDNICPDQSRCPAEFSCLKAL--TRYGCCPLAQGVSCPDGKHCCPEGHQCSLDSRSC------------------VKKES--IKTVLCKDGVSECPDET-TCCENQEGKWACCPMPKAVCCDDKIHCCPEETTCDVEQMKC-LSSSDKALPMWAKFPARTRADWENQKEGKEVSAVAVEGNETKNFPEVTTANPVPAFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTC 347          

HSP 8 Score: 68.1662 bits (165), Expect = 8.534e-12
Identity = 67/243 (27.57%), Postives = 99/243 (40.74%), Query Frame = 3
Query:  219 GNICPNKRTKCTERQTCCQTKH-NSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKY----ETNFFKIISLLLGFKQKAS--KSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNS 926
            G I  +  T+C +  TCC  K    + CC    AVCC D  HCCP    C  +   CVK  +  +     IPA        + +  + V++  E M            +CC      + CCP  NAVCC DK  CCPE  TCD+ +K C    H +  +  E +  +  +    ++    +  +L       S    +  C  ++   G C      CC D++ CCP   +C  K   C  N+
Sbjct:  880 GIISCDSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCADGEHCCPADYKCKEEDTSCVK-GEVVIPWYTKIPATDSIQADSSFVQCSAVHQCPEHM------------SCCRLFTGEWGCCPLPNAVCCGDKEHCCPEGYTCDLASKSC----HKLLTLQLETVPLTPVFLPDDQSQHGPVKPILNRCDDVYSCNVDETCCRTSHTTWGCCLSPKAVCCRDMKHCCPDGYRC-TKGGSCIKNT 1104          
BLAST of Granulin b vs. Ensembl Medaka
Match: grna (granulins [Source:NCBI gene;Acc:101162601])

HSP 1 Score: 117.857 bits (294), Expect = 7.877e-28
Identity = 87/326 (26.69%), Postives = 134/326 (41.10%), Query Frame = 3
Query:  177 AWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLN--STDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
            A+ E    + + +  +I  N+   C ++ TCC+T+   + CC +  AVCC D  HCCP+G TC+     C      +V M + +P+       K ++    V       CP+         TCC T+   + CCP   AVCC D   CCP+  TC++  + C     S+      ++     +     K+  +              C    G  G C F    CC D   CCP+   C+     C  +  S     +    S  + ++  V C D  T C    TCC   +  +GCC    AVCC D + CCP  + C++   +C
Sbjct:  278 AFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEG-DGGSVPMLEKVPSFS-----KVSVKMEDVPCDGSTSCPDQ-------TTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSV-----PMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSNVSVKMEDVPC-DGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTC 584          

HSP 2 Score: 115.161 bits (287), Expect = 5.076e-27
Identity = 84/312 (26.92%), Postives = 128/312 (41.03%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPA-----LKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLN--STDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
            +  T C ++ TCC+T+   + CC +  AVCC D  HCCP+G TC+     C      +V M + +P+     +K+ED P     +   +  D+  C             C T+   + CCP   AVCC D   CCP+  TC++  + C     S+      ++     +     K+  +              C    G  G C F    CC D   CCP+   C+     C  +  S     +    S  + ++  V C D  T C    TCC   +  +GCC    AVCC D + CCP  + C++   +C
Sbjct:  376 DGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEG-DGGSVPMLEKVPSFSNVSVKMEDVP----CDGSTSCPDQTTC-------------CKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSV-----PMLEKVPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSNVSVKMEDVPC-DGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTC 663          

HSP 3 Score: 114.39 bits (285), Expect = 9.821e-27
Identity = 95/360 (26.39%), Postives = 145/360 (40.28%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNIL------------------------EAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKC-----------TLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSK 1208
            +  T C ++ TCC+TK  ++ CC    AVCC D  HCCP G+TCD     C+K A   V M K +PA        + ++                        E K +E+  + C ++    + T  C + +   + CCP   AVCC+D   CCP    C  ++  C      I    +    DS + +++F +  ++      +  +    C +  G  G C      CC D   CCP+   CD  +  C            L       ++S+H P    L+     D+   C   ETCC  S  ++GCC    AVCC D   CCP   +C  K  SC++       ++   F  + K
Sbjct:  692 DGSTSCPDQTTCCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTCDLSTLSCLK-ASGLVPMSKKLPASTRTSSATSQLMKTGQETEEGENKPDDRDGQEDFDEEDKTDEEGIISCDSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCADGEHCCPADYKCKEEDTSCVKGEVVIPWYTKIPATDSIQADSSFVQCSAV-----HQCPEHMSCCRLFTGEWGCCPLPNAVCCGDKEHCCPEGYTCDLASKSCHKLLTLQLETVPLTPVFLPDDQSQHGPVKPILNRC---DDVYSCNVDETCCRTSHTTWGCCLSPKAVCCRDMKHCCPDGYRC-TKGGSCIKNTGLHWLNWHTFFTNKRK 1041          

HSP 4 Score: 109.768 bits (273), Expect = 3.116e-25
Identity = 102/376 (27.13%), Postives = 140/376 (37.23%), Query Frame = 3
Query:  162 ISFQLAWREQGFASNKETVG----NICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNE-KDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDS-------------------------FKYETNFFKIISLLLG--FKQKASKSDFYCPIT-------------NGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLN--STDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
            +S  L    + F   +  +G    NICP+ +++C    +C +     Y CC  A  V CPD  HCCPEG  C      CVK                 ++  KT + +  V+E  DE  C  N+                + CCP   AVCC DK  CCPE TTCD++  KC SS      M  +    +                         F   T    + + L G     +AS  D  C  T              G  G C F    CC D   CCP+   C+     C  +  S     +    S  + ++  V C D  T C    TCC   +  +GCC    AVCC D + CCP  + C++   +C
Sbjct:   84 VSANLQMATKSFRMIRSYMGEDEDNICPD-QSRCPAEFSCLKA-LTRYGCCPLAQGVSCPDGKHCCPEGHQCSLDSRSCVK-----------------KESIKTVLCKDGVSECPDETTCCENQ-------------EGKWACCPMPKAVCCDDKIHCCPEETTCDVEQMKCLSSSDKALPMWAKFPARTRADWENQKEGKEVSAVAVEGNETKNFPEVTTANPVPAFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSKVSVKMEDVPC-DGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTC 426          

HSP 5 Score: 105.916 bits (263), Expect = 6.192e-24
Identity = 97/357 (27.17%), Postives = 140/357 (39.22%), Query Frame = 3
Query:  234 NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQ-----------KASKSDF------------------YCPITNG--------RSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDT-EKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLT 1190
            +  T C ++ TCC+T+   + CC +  AVCC D  HCCP+G TC+     C      +V M + +P+       K ++    V       CP+         TCC TK   + CCP   AVCC D   CCP  TTCD+    C  +   +  M+++L        T      S L+   Q           +  + DF                   CP            + G C      CC+D   CCP   KC E++  C           K   + +    S+ V      +C    +CC +    +GCC L NAVCC D+  CCP    CD+ + SC +  + +    PLT
Sbjct:  613 DGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEG-DGGSVPMLEKVPSFS-----KVSVKMEDVPCDGSTSCPDQ-------TTCCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTCDLSTLSCLKA-SGLVPMSKKL-----PASTRTSSATSQLMKTGQETEEGENKPDDRDGQEDFDEEDKTDEEGIISCDSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCADGEHCCPADYKCKEEDTSCVKGEVVIPWYTKIPATDSIQADSSFVQCSAVHQCPEHMSCCRLFTGEWGCCPLPNAVCCGDKEHCCPEGYTCDLASKSCHKLLTLQLETVPLT 950          

HSP 6 Score: 95.9005 bits (237), Expect = 1.386e-20
Identity = 61/222 (27.48%), Postives = 98/222 (44.14%), Query Frame = 3
Query:  564 NYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLG-------FKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSK 1208
            +Y CCP   A CC D   CCP+   CD+    C ++  S+  +  E +  + +  T  F++I   +G         Q    ++F C     R G C  + G  C D + CCP+  +C   +  C    +               + TV+C D  +EC    TCC   +  + CC +  AVCC D++ CCP    CD++   C+ ++S+K       FP R++
Sbjct:   39 DYDCCPFDEAECCGDHIHCCPKDMLCDMTTSSCGNATLSMRWV--ERVSANLQMATKSFRMIRSYMGEDEDNICPDQSRCPAEFSCLKALTRYGCCPLAQGVSCPDGKHCCPEGHQCSLDSRSCVKKES---------------IKTVLCKDGVSECPDETTCCENQEGKWACCPMPKAVCCDDKIHCCPEETTCDVEQMKCL-SSSDKALPMWAKFPARTR 242          

HSP 7 Score: 93.5893 bits (231), Expect = 7.067e-20
Identity = 89/370 (24.05%), Postives = 133/370 (35.95%), Query Frame = 3
Query:  180 WREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNR-----------LSTVVCPDNETE------------------------------------CFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC 1148
            W    + S      ++CPN   KC + QTCCQ+    Y CC +  A CC D  HCCP+   CD     C     S   + ++   L++  +    ++ + + E ++ +CP+      +           Y CCP    V C D   CCPE   C + ++ C                   K E+   K +    G  +   ++   C    G+   C      CC D   CCP+ T CD +  KC L+S+D         P   R           +S V    NET+                                    C    TCC   +  +GCC    AVCC D + CCP  + C++   +C
Sbjct:    4 WVVICWVSLALVAADMCPNGG-KCEKGQTCCQSPSKDYDCCPFDEAECCGDHIHCCPKDMLCDMTTSSCGNATLSMRWVERVSANLQMATK-SFRMIRSYMGEDEDNICPDQSRCPAEFSCLKAL--TRYGCCPLAQGVSCPDGKHCCPEGHQCSLDSRSC------------------VKKES--IKTVLCKDGVSECPDET-TCCENQEGKWACCPMPKAVCCDDKIHCCPEETTCDVEQMKC-LSSSDKALPMWAKFPARTRADWENQKEGKEVSAVAVEGNETKNFPEVTTANPVPAFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTC 347          

HSP 8 Score: 68.1662 bits (165), Expect = 9.439e-12
Identity = 67/243 (27.57%), Postives = 99/243 (40.74%), Query Frame = 3
Query:  219 GNICPNKRTKCTERQTCCQTKH-NSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKY----ETNFFKIISLLLGFKQKAS--KSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNS 926
            G I  +  T+C +  TCC  K    + CC    AVCC D  HCCP    C  +   CVK  +  +     IPA        + +  + V++  E M            +CC      + CCP  NAVCC DK  CCPE  TCD+ +K C    H +  +  E +  +  +    ++    +  +L       S    +  C  ++   G C      CC D++ CCP   +C  K   C  N+
Sbjct:  801 GIISCDSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCADGEHCCPADYKCKEEDTSCVK-GEVVIPWYTKIPATDSIQADSSFVQCSAVHQCPEHM------------SCCRLFTGEWGCCPLPNAVCCGDKEHCCPEGYTCDLASKSC----HKLLTLQLETVPLTPVFLPDDQSQHGPVKPILNRCDDVYSCNVDETCCRTSHTTWGCCLSPKAVCCRDMKHCCPDGYRC-TKGGSCIKNT 1025          
BLAST of Granulin b vs. Ensembl Medaka
Match: ENSORLT00000029765.1 (granulins [Source:NCBI gene;Acc:101168633])

HSP 1 Score: 74.7146 bits (182), Expect = 1.407e-14
Identity = 72/270 (26.67%), Postives = 102/270 (37.78%), Query Frame = 3
Query:  228 CPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLI-------PALKVEDEPKTNILEAKVNEKDEV------------MCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSP--------HSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASK-------SDFYCPITN----GRSGR---CKFSAGTCCSDLRTCCPQHTKCDEKNNKC 914
            CP+ +  C +  TCC T H  + CC    AVCC DK HCCP G  C+     C K  +  V +  L        PAL +     TN++E   N+                MCP+  T C+            ++CCP+    CC D + CCP    CD+    C             ++  +   LI    +      K ++ L       S+       S F+CP       G  G+   C +  G CC+D R CC     CD  +  C
Sbjct:   24 CPDGKL-CPDLSTCCLTGHG-FSCCPLPEAVCCSDKAHCCPSGYRCNLATMMCEKTDQPWVSLPMLTKEAAEEPPALDL----STNLVEELKNDNGLAQKSTGVQCDSFYMCPDRTTCCRHP-------KGAWFCCPYYPGRCCLDGFHCCPYGYDCDLTYTHCIRDGFKYPFYYKQALTSVPAALISHPEENSIQLEKSLTALTEASDAPSEHGVIRCDSKFFCPAGTSCCKGAEGQWTCCPYPLGKCCADGRHCCQYGYTCDATSATC 280          
BLAST of Granulin b vs. Ensembl Medaka
Match: ENSORLT00000005071.2 (granulins [Source:NCBI gene;Acc:101168633])

HSP 1 Score: 74.7146 bits (182), Expect = 1.574e-14
Identity = 72/270 (26.67%), Postives = 102/270 (37.78%), Query Frame = 3
Query:  228 CPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLI-------PALKVEDEPKTNILEAKVNEKDEV------------MCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSP--------HSIHEMAQELIHDSFKYETNFFKIISLLLGFKQKASK-------SDFYCPITN----GRSGR---CKFSAGTCCSDLRTCCPQHTKCDEKNNKC 914
            CP+ +  C +  TCC T H  + CC    AVCC DK HCCP G  C+     C K  +  V +  L        PAL +     TN++E   N+                MCP+  T C+            ++CCP+    CC D + CCP    CD+    C             ++  +   LI    +      K ++ L       S+       S F+CP       G  G+   C +  G CC+D R CC     CD  +  C
Sbjct:   26 CPDGKL-CPDLSTCCLTGHG-FSCCPLPEAVCCSDKAHCCPSGYRCNLATMMCEKTDQPWVSLPMLTKEAAEEPPALDLS----TNLVEELKNDNGLAQKSTGVQCDSFYMCPDRTTCCRHP-------KGAWFCCPYYPGRCCLDGFHCCPYGYDCDLTYTHCIRDGFKYPFYYKQALTSVPAALISHPEENSIQLEKSLTALTEASDAPSEHGVIRCDSKFFCPAGTSCCKGAEGQWTCCPYPLGKCCADGRHCCQYGYTCDATSATC 282          
BLAST of Granulin b vs. Planmine SMEST
Match: SMESG000018760.1 (SMESG000018760.1)

HSP 1 Score: 630.943 bits (1626), Expect = 0.000e+0
Identity = 332/352 (94.32%), Postives = 335/352 (95.17%), Query Frame = 3
Query:  207 KETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHE----MAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGNHFSIL 1250
            K      CPN RTKC + QTCC TKH SYHCCK+ANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVE+E KTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHE    MAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSP TNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGNHFSIL
Sbjct:  284 KIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVENELKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEIAHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPNTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGNHFSIL 635          

HSP 2 Score: 263.077 bits (671), Expect = 4.239e-81
Identity = 172/343 (50.15%), Postives = 207/343 (60.35%), Query Frame = 3
Query:  207 KETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDE------VMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQ---ELIHDSFKYETNFFKIIS--LLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTT---NRLST------------VVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVET 1157
            K      CPN RTKC + QTCC TKH SYHCCK+ANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEM KLIPALKVEDEPKTNILEAKVNEKDE       +CPN +TKC + +TCC TKHN+Y+CC + NAVCC DK+ CCP  T+CD  +KKC  +  +     Q   E +      ET+  KII+       + K   S   C   +G    CKF+   CC D   CCP+ + CD K +KC +     + E  K  P     N L T            V+CP+N+T+C   +TCC     +Y CC  +NAVCC+D+  CCP    CDIK   C  +
Sbjct:   98 KIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMRKLIPALKVEDEPKTNILEAKVNEKDENKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNRNIEATKSPIQTTPEPMEMPVIEETD-VKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKC-VKCAKSNVEMGKLIPALKVENELKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSS 438          

HSP 3 Score: 214.157 bits (544), Expect = 1.340e-62
Identity = 147/343 (42.86%), Postives = 186/343 (54.23%), Query Frame = 3
Query:  198 ASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYE--TNFFK------------IISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLN-----STDFDTEKSKHSPTTNR-----LSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVE 1154
            A NKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCP G++CD+   KC +    N+E  K       E      I E  V    +  CPNN+TKC+D++TCC+TKH +Y+CC   NAVCC DK+ CCPE +TCD K  KC     S  EM + +     + E  TN  +            + ++    + K ++    C   +     CK++   CC D   CCP  T CD  + KC  N     S    T +    P         ++   CP+N T+C   +TCC     SY CC+  NAVCC D+  CCP    CD K + CV+
Sbjct:    7 APNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNR----NIEATKSPIQTTPEPMEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMRKLIPALKVEDEPKTNILEAKVNEKDENKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNRNIEATKSPIQTTPEPMEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVK 345          
BLAST of Granulin b vs. Planmine SMEST
Match: SMESG000018760.1 (SMESG000018760.1)

HSP 1 Score: 630.558 bits (1625), Expect = 0.000e+0
Identity = 332/352 (94.32%), Postives = 335/352 (95.17%), Query Frame = 3
Query:  207 KETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHE----MAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGNHFSIL 1250
            K      CPN RTKC + QTCC TKH SYHCCK+ANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVE+E KTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHE    MAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSP TNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGNHFSIL
Sbjct:  315 KIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVENELKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEIAHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPNTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGNHFSIL 666          

HSP 2 Score: 268.855 bits (686), Expect = 6.631e-83
Identity = 185/374 (49.47%), Postives = 213/374 (56.95%), Query Frame = 3
Query:  207 KETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHK-------------------------------------NAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQ---ELIHDSFKYETNFFKIIS--LLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTT---NRLST------------VVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVET 1157
            K      CPN RTKC + QTCC TKH SYHCCK+ANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEM KLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKD KTCCITKHNNYYCCPHK                                     NAVCC DK+ CCP  T+CD  +KKC  +  +     Q   E +      ET+  KII+       + K   S   C   +G    CKF+   CC D   CCP+ + CD K +KC +     + E  K  P     N L T            V+CP+N+T+C   +TCC     +Y CC  +NAVCC+D+  CCP    CDIK   C  +
Sbjct:   98 KIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMRKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDIKTCCITKHNNYYCCPHKNNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNRNIEATKSPIQTTPEPMEMPVIEETD-VKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKC-VKCAKSNVEMGKLIPALKVENELKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSS 469          

HSP 3 Score: 202.986 bits (515), Expect = 3.162e-58
Identity = 147/374 (39.30%), Postives = 187/374 (50.00%), Query Frame = 3
Query:  198 ASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQEL----IHDSFK-----------------------------------------YETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLN-----STDFDTEKSKHSPTTNR-----LSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVE 1154
            A NKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCP G++CD+   KC +    N+E  K       E      I E  V    +  CPNN+TKC+D++TCC+TKH +Y+CC   NAVCC DK+ CCPE +TCD K  KC     S  EM + +    + D  K                                         ++ N   + ++    + K ++    C   +     CK++   CC D   CCP  T CD  + KC  N     S    T +    P         ++   CP+N T+C   +TCC     SY CC+  NAVCC D+  CCP    CD K + CV+
Sbjct:    7 APNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNR----NIEATKSPIQTTPEPMEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMRKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDIKTCCITKHNNYYCCPHKNNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNRNIEATKSPIQTTPEPMEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVK 376          
BLAST of Granulin b vs. Planmine SMEST
Match: SMESG000018760.1 (SMESG000018760.1)

HSP 1 Score: 630.172 bits (1624), Expect = 0.000e+0
Identity = 332/352 (94.32%), Postives = 335/352 (95.17%), Query Frame = 3
Query:  207 KETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHE----MAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGNHFSIL 1250
            K      CPN RTKC + QTCC TKH SYHCCK+ANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVE+E KTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHE    MAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSP TNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGNHFSIL
Sbjct:  344 KIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVENELKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEIAHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPNTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGNHFSIL 695          

HSP 2 Score: 268.47 bits (685), Expect = 1.510e-82
Identity = 185/374 (49.47%), Postives = 213/374 (56.95%), Query Frame = 3
Query:  207 KETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHK-------------------------------------NAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQ---ELIHDSFKYETNFFKIIS--LLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTT---NRLST------------VVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVET 1157
            K      CPN RTKC + QTCC TKH SYHCCK+ANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEM KLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKD KTCCITKHNNYYCCPHK                                     NAVCC DK+ CCP  T+CD  +KKC  +  +     Q   E +      ET+  KII+       + K   S   C   +G    CKF+   CC D   CCP+ + CD K +KC +     + E  K  P     N L T            V+CP+N+T+C   +TCC     +Y CC  +NAVCC+D+  CCP    CDIK   C  +
Sbjct:  127 KIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMRKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDIKTCCITKHNNYYCCPHKNNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNRNIEATKSPIQTTPEPMEMPVIEETD-VKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKC-VKCAKSNVEMGKLIPALKVENELKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSS 498          

HSP 3 Score: 226.868 bits (577), Expect = 6.202e-67
Identity = 159/412 (38.59%), Postives = 206/412 (50.00%), Query Frame = 3
Query:   84 MKYSYSIFAVLVGLAVIGSKVAAKGVISFQLAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQEL----IHDSFK-----------------------------------------YETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLN-----STDFDTEKSKHSPTTNR-----LSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVE 1154
            MK  +SI  + V L ++ S   A G +SF L+W +     NKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCP G++CD+   KC +    N+E  K       E      I E  V    +  CPNN+TKC+D++TCC+TKH +Y+CC   NAVCC DK+ CCPE +TCD K  KC     S  EM + +    + D  K                                         ++ N   + ++    + K ++    C   +     CK++   CC D   CCP  T CD  + KC  N     S    T +    P         ++   CP+N T+C   +TCC     SY CC+  NAVCC D+  CCP    CD K + CV+
Sbjct:    1 MKNIFSIVTICVVLTLVSSLAEAGGTLSFNLSWLDN---ENKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNR----NIEATKSPIQTTPEPMEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMRKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDIKTCCITKHNNYYCCPHKNNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNRNIEATKSPIQTTPEPMEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVK 405          

HSP 4 Score: 189.119 bits (479), Expect = 4.892e-53
Identity = 141/353 (39.94%), Postives = 189/353 (53.54%), Query Frame = 3
Query:  201 SNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQEL--IHDSFKYETNFF------KIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLN-----------STDFDTEKSKHSPTTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSC----VETNSNKRRHFPLT 1190
            +NKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCP G++CD+   KC +    N+E  K       E      I E  V    +  CPNN+TKC+D++TCC+TKH +Y+CC   NAVCC DK+ CCPE +TCD K  KC     S  EM + +  +    + +TN        K   +    K K   +   C   +     C      CCSD   CCP+ T CD KN KCT +           + +   +  K+     ++ +++    +    S +  C +++   G C+     CC+D  +CCP + KCD K N C     + ++ K +H P T
Sbjct:  254 NNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNR----NIEATKSPIQTTPEPMEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVENELKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEIAHEMAQELIHDSFKYETNFFKIISLLLGFKQKASKS-DFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPNT 601          
BLAST of Granulin b vs. Planmine SMEST
Match: SMESG000018767.1 (SMESG000018767.1)

HSP 1 Score: 319.701 bits (818), Expect = 1.948e-104
Identity = 200/392 (51.02%), Postives = 234/392 (59.69%), Query Frame = 3
Query:  156 GVISFQLAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEM--AQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCP-------ITNGRSGRCKF-------------------------------------SAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTD-------FDTEKSKHSPTTNRLST-------VVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCV 1151
            G  S   +   +       T  NICPNKRTKCT+RQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPE T CD+KNKKC S+   +        + H  F  E + ++++  L   ++  +     CP       +  G+ G CKF                                     +   CC D   CCP+ + CD K +KC   +             K +  P TN L         V+CP+N+T+C   +TCC     +Y CC  +NAVCC+D+  CCP   KCD+K   C+
Sbjct:    5 GSKSLHASKTLEDMLKKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTKCDLKNKKCLSASFVVESQTNVDTVPHQLFLAEQSNYELVFKLFKMEKGCADQKHTCPGKKNCCVMDAGKFGCCKFNHKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTKCDLKNKKCL 396          

HSP 2 Score: 307.76 bits (787), Expect = 9.381e-100
Identity = 173/252 (68.65%), Postives = 193/252 (76.59%), Query Frame = 3
Query:  195 FASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEM--AQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCP-------ITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLN 923
            F     T  NICPNKRTKCT+RQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPE T CD+KNKKC S+   +        + H  F  E + ++++  L   ++  +     CP       +  G+ G CKF+ G CC DL+TCCP  T+CD+K N+C  N
Sbjct:  240 FNHKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTKCDLKNKKCLSASFVVESQTNVDTVPHQLFLAEQSNYELVFKLFKMEKGCADQKHTCPGKKNCCVMDAGKFGCCKFNHGVCCPDLKTCCPHQTECDDKTNRCIAN 491          

HSP 3 Score: 153.68 bits (387), Expect = 2.688e-41
Identity = 132/372 (35.48%), Postives = 180/372 (48.39%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCA--------------------KSNVEMGKLIPALKVE----DEPKTN-------ILEA------KVNEKD---EVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYE--TNFF------KIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNS------TDFDT--------EKSKHSPTTNRLST-VVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCV 1151
            +CPN +TKC + +TCC TKHN+Y+CC + NAVCC DK+ CCPEG+ CD K  KC+  +                    +SN E+  +    K+E    D+  T        +++A      K N K+   + +CPN +TKC D +TCC TKHN+Y+CC + NAVCC DK+ CCPE +TCD K  KC     S  EM + +     + E  TN        K   +    K K   +   C   +     C      CCSD   CCP+ TKCD KN KC   S      T+ DT        E+S +            C D +  C   + CC +    +GCC+  + VCC D  +CCPH  +CD KTN C+
Sbjct:  120 MCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTKCDLKNKKCLSASFVVESQTNVDTVPHQLFLAEQSNYEL--VFKLFKMEKGCADQKHTCPGKKNCCVMDAGKFGCCKFNHKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTKCDLKNKKCLSASFVVESQTNVDTVPHQLFLAEQSNYELVFKLFKMEKGCADQKHTCPGKKNCCVMDAGKFGCCKFNHGVCCPDLKTCCPHQTECDDKTNRCI 489          

HSP 4 Score: 96.6709 bits (239), Expect = 2.139e-21
Identity = 94/286 (32.87%), Postives = 122/286 (42.66%), Query Frame = 3
Query:  477 KVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYE--TNFF------KIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNS------TDFDT--------EKSKHSPT--------------------------------------TNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVE 1154
            K N   + +CPN +TKC D +TCC TKHN+Y+CC + NAVCC DK+ CCPE +TCD K  KC     S  EM + +     + E  TN        K   +    K K   +   C   +     C      CCSD   CCP+ TKCD KN KC   S      T+ DT        E+S +                                          N  +  +CP+  T+C   +TCC     SY CC+  NAVCC D+  CCP    CD K + CV+
Sbjct:   20 KKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTKCDLKNKKCLSASFVVESQTNVDTVPHQLFLAEQSNYELVFKLFKMEKGCADQKHTCPGKKNCCVMDAGKFGCCKFNHKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVK 305          
BLAST of Granulin b vs. Planmine SMEST
Match: SMESG000018762.1 (SMESG000018762.1)

HSP 1 Score: 319.316 bits (817), Expect = 1.795e-103
Identity = 209/415 (50.36%), Postives = 246/415 (59.28%), Query Frame = 3
Query:   99 SIFAVLVGLAVIGSKVAA---KGV-ISFQLAWREQGFASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEM--AQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCP-------ITNGRSGRCKF-------------------------------------SAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTD-------FDTEKSKHSPTTNRLST-------VVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCV 1151
            S+ A L  LA   S +A    +GV    +L      +  N  T  NICPNKRTKCT+RQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPE T CD+KNKKC S+   +        + H  F  E + ++++  L   ++  +     CP       +  G+ G CKF                                     +   CC D   CCP+ + CD K +KC   +             K +  P TN L         V+CP+N+T+C   +TCC     +Y CC  +NAVCC+D+  CCP   KCD+K   C+
Sbjct:   50 SLLAPLYALAP-DSLIALPDYRGVKTPDKLELISLEYLKN-VTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTKCDLKNKKCLSASFVVESQTNVDTVPHQLFLAEQSNYELVFKLFKMEKGCADQKHTCPGKKNCCVMDAGKFGCCKFNHKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTKCDLKNKKCL 462          

HSP 2 Score: 308.145 bits (788), Expect = 3.606e-99
Identity = 173/252 (68.65%), Postives = 193/252 (76.59%), Query Frame = 3
Query:  195 FASNKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEM--AQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCP-------ITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLN 923
            F     T  NICPNKRTKCT+RQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPE T CD+KNKKC S+   +        + H  F  E + ++++  L   ++  +     CP       +  G+ G CKF+ G CC DL+TCCP  T+CD+K N+C  N
Sbjct:  306 FNHKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTKCDLKNKKCLSASFVVESQTNVDTVPHQLFLAEQSNYELVFKLFKMEKGCADQKHTCPGKKNCCVMDAGKFGCCKFNHGVCCPDLKTCCPHQTECDDKTNRCIAN 557          

HSP 3 Score: 153.68 bits (387), Expect = 7.259e-41
Identity = 132/372 (35.48%), Postives = 180/372 (48.39%), Query Frame = 3
Query:  225 ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCA--------------------KSNVEMGKLIPALKVE----DEPKTN-------ILEA------KVNEKD---EVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYE--TNFF------KIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNS------TDFDT--------EKSKHSPTTNRLST-VVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCV 1151
            +CPN +TKC + +TCC TKHN+Y+CC + NAVCC DK+ CCPEG+ CD K  KC+  +                    +SN E+  +    K+E    D+  T        +++A      K N K+   + +CPN +TKC D +TCC TKHN+Y+CC + NAVCC DK+ CCPE +TCD K  KC     S  EM + +     + E  TN        K   +    K K   +   C   +     C      CCSD   CCP+ TKCD KN KC   S      T+ DT        E+S +            C D +  C   + CC +    +GCC+  + VCC D  +CCPH  +CD KTN C+
Sbjct:  186 MCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTKCDLKNKKCLSASFVVESQTNVDTVPHQLFLAEQSNYEL--VFKLFKMEKGCADQKHTCPGKKNCCVMDAGKFGCCKFNHKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTKCDLKNKKCLSASFVVESQTNVDTVPHQLFLAEQSNYELVFKLFKMEKGCADQKHTCPGKKNCCVMDAGKFGCCKFNHGVCCPDLKTCCPHQTECDDKTNRCI 555          

HSP 4 Score: 99.3673 bits (246), Expect = 3.710e-22
Identity = 97/301 (32.23%), Postives = 128/301 (42.52%), Query Frame = 3
Query:  432 ALKVEDEPKTNILEAKVNEKDEVMCPNNXXXXXXXXXXXXXXHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEMAQELIHDSFKYE--TNFF------KIISLLLGFKQKASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNS------TDFDT--------EKSKHSPT--------------------------------------TNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDIKTNSCVE 1154
             +K  D+ +   LE   N   + +CPN +TKC D +TCC TKHN+Y+CC + NAVCC DK+ CCPE +TCD K  KC     S  EM + +     + E  TN        K   +    K K   +   C   +     C      CCSD   CCP+ TKCD KN KC   S      T+ DT        E+S +                                          N  +  +CP+  T+C   +TCC     SY CC+  NAVCC D+  CCP    CD K + CV+
Sbjct:   71 GVKTPDKLELISLEYLKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEGTKCDLKNKKCLSASFVVESQTNVDTVPHQLFLAEQSNYELVFKLFKMEKGCADQKHTCPGKKNCCVMDAGKFGCCKFNHKNVTTDNICPNKRTKCTDRQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHKCVK 371          
The following BLAST results are available for this feature:
BLAST of Granulin b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRN5.276e-3830.89granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN7.296e-3730.89granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN6.002e-3329.86granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN1.214e-2628.53granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN5.110e-1236.17granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
back to top
BLAST of Granulin b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pgrn-12.019e-2040.44ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:... [more]
pgrn-14.337e-2040.44ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:... [more]
T02B11.88.100e-642.86pep chromosome:WBcel235:V:877530:878667:-1 gene:WB... [more]
back to top
BLAST of Granulin b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Granulin b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grnb2.559e-3832.29granulin b [Source:ZFIN;Acc:ZDB-GENE-030131-7393][more]
grna1.849e-3128.65granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
grna2.003e-3029.86granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
grna2.547e-3028.37granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
grna2.809e-1529.44granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
back to top
BLAST of Granulin b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
trappc111.984e-2829.14trafficking protein particle complex 11 [Source:Xe... [more]
trappc112.319e-2829.14trafficking protein particle complex 11 [Source:Xe... [more]
trappc112.029e-2728.24trafficking protein particle complex 11 [Source:Xe... [more]
trappc116.262e-2728.92trafficking protein particle complex 11 [Source:Xe... [more]
back to top
BLAST of Granulin b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Grn9.793e-3030.46granulin [Source:MGI Symbol;Acc:MGI:95832][more]
Grn3.345e-1535.29granulin [Source:MGI Symbol;Acc:MGI:95832][more]
Grn2.544e-1232.89granulin [Source:MGI Symbol;Acc:MGI:95832][more]
Grn1.404e-1032.39granulin [Source:MGI Symbol;Acc:MGI:95832][more]
back to top
BLAST of Granulin b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P28799|GRN_HUMAN3.504e-3630.89Progranulin OS=Homo sapiens OX=9606 GN=GRN PE=1 SV... [more]
sp|P23785|GRN_RAT8.860e-3133.33Progranulin OS=Rattus norvegicus OX=10116 GN=Grn P... [more]
sp|P28798|GRN_MOUSE8.678e-2930.46Progranulin OS=Mus musculus OX=10090 GN=Grn PE=1 S... [more]
sp|P28797|GRN_CAVPO1.051e-2425.20Progranulin OS=Cavia porcellus OX=10141 GN=GRN PE=... [more]
sp|Q54QR7|GRN_DICDI1.989e-641.43Granulin OS=Dictyostelium discoideum OX=44689 GN=g... [more]
back to top
BLAST of Granulin b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2B4SIQ61.048e-4733.06Granulin OS=Stylophora pistillata OX=50429 GN=GRN ... [more]
V4ARK57.880e-4433.44Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
A0A1A7X3H31.878e-4334.71Granulin b OS=Iconisemion striatum OX=60296 GN=GRN... [more]
A0A3P8VPE04.781e-4335.99Granulin b OS=Cynoglossus semilaevis OX=244447 PE=... [more]
A0A3P8VL475.489e-4335.99Granulin b OS=Cynoglossus semilaevis OX=244447 PE=... [more]
back to top
BLAST of Granulin b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grnb4.279e-3931.64granulins-like [Source:NCBI gene;Acc:103046308][more]
grnb4.279e-3931.64granulins-like [Source:NCBI gene;Acc:103046308][more]
grna7.052e-2627.64granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
ENSAMXT00000029960.16.231e-2527.45pep primary_assembly:Astyanax_mexicanus-2.0:23:267... [more]
grna2.373e-2427.59granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
back to top
BLAST of Granulin b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009302.18.679e-3226.42pep scaffold:Pmarinus_7.0:GL483232:1183:11161:1 ge... [more]
ENSPMAT00000001039.11.147e-2229.28pep scaffold:Pmarinus_7.0:GL484091:11570:24665:-1 ... [more]
back to top
BLAST of Granulin b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Granulin b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO278241.197e-1430.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Granulin b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grnb2.034e-3831.01granulin precursor [Source:NCBI gene;Acc:101166910... [more]
grna2.015e-2926.84granulins [Source:NCBI gene;Acc:101162601][more]
grna7.877e-2826.69granulins [Source:NCBI gene;Acc:101162601][more]
ENSORLT00000029765.11.407e-1426.67granulins [Source:NCBI gene;Acc:101168633][more]
ENSORLT00000005071.21.574e-1426.67granulins [Source:NCBI gene;Acc:101168633][more]
back to top
BLAST of Granulin b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018760.14.239e-8194.32SMESG000018760.1[more]
SMESG000018760.16.631e-8394.32SMESG000018760.1[more]
SMESG000018760.11.510e-8294.32SMESG000018760.1[more]
SMESG000018767.11.948e-10451.02SMESG000018767.1[more]
SMESG000018762.11.795e-10350.36SMESG000018762.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003962 ID=SMED30003962|Name=Granulin b|organism=Schmidtea mediterranea sexual|type=transcript|length=1344bp
GAATTACTGTGTGAATTTCCCAAAATTGAAACTCAATTTTGTAATTTATA
AATCTCCAAAATTCTTAAGTGATCTTTATTTAAATGAAGTATTCATATTC
GATCTTTGCTGTGTTAGTCGGATTGGCAGTGATCGGTTCAAAAGTTGCTG
CTAAGGGAGTCATCAGTTTCCAGTTGGCATGGCGGGAACAGGGTTTTGCA
TCAAACAAAGAAACCGTTGGAAACATTTGTCCAAACAAACGTACAAAATG
TACGGAAAGACAAACCTGCTGTCAAACCAAACACAATAGCTATCACTGCT
GTAAATATGCTAATGCCGTGTGTTGTCCAGATAAATTCCATTGTTGTCCA
GAGGGTTCGACATGCGATGCGAAACAACATAAATGTGTCAAATGTGCTAA
ATCAAATGTTGAAATGGGAAAGTTGATCCCAGCATTGAAAGTCGAAGATG
AACCGAAAACTAACATTCTGGAAGCAAAAGTCAATGAGAAGGATGAAGTA
ATGTGTCCAAACAATAAAACAAAGTGCAAAGACACAAAAACATGTTGTAT
TACAAAGCATAATAATTATTATTGTTGTCCACATAAAAACGCAGTTTGTT
GTTCAGATAAATATCAATGCTGCCCTGAAGCAACAACGTGCGACATTAAA
AACAAAAAATGCACAAGCTCACCGCATAGTATCCATGAAATGGCCCAAGA
GTTAATTCATGATTCCTTCAAATATGAAACCAATTTCTTCAAAATAATAT
CTCTACTGTTAGGCTTCAAACAGAAGGCCTCGAAGTCAGACTTTTATTGC
CCAATAACCAATGGGAGATCTGGACGTTGCAAATTCAGCGCAGGAACTTG
TTGTTCGGATTTGAGAACGTGTTGTCCACAACACACAAAATGCGATGAAA
AAAACAATAAATGCACTCTAAATTCAACCGATTTCGACACCGAAAAATCC
AAACACTCTCCAACCACTAATCGACTTTCAACAGTAGTATGCCCGGATAA
CGAAACCGAATGTTTCAGTTGGGAAACTTGCTGTGCAGTCAGTGATAAAA
GTTACGGATGTTGCGAATTAGAAAATGCAGTTTGTTGTGCTGACAGGGTA
TCTTGCTGTCCGCATAATCAAAAATGTGACATTAAAACAAATAGCTGTGT
AGAAACAAACAGCAATAAAAGGAGACATTTTCCCCTGACATTTCCAAAGA
GATCAAAATTTCGGAAAACTTTAAATGATGGAAATCATTTTTCAATACTA
TAAAATTCAACATCAACAAAACAAAATCATTCGCAATTATTCCAGAAAAC
GTAAAACATTCTCACAACATTGATTTGCACTATTTTTATTGATT
back to top

protein sequence of SMED30003962-orf-1

>SMED30003962-orf-1 ID=SMED30003962-orf-1|Name=SMED30003962-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=390bp
MKYSYSIFAVLVGLAVIGSKVAAKGVISFQLAWREQGFASNKETVGNICP
NKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPEGSTCDAKQHK
CVKCAKSNVEMGKLIPALKVEDEPKTNILEAKVNEKDEVMCPNNKTKCKD
TKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSI
HEMAQELIHDSFKYETNFFKIISLLLGFKQKASKSDFYCPITNGRSGRCK
FSAGTCCSDLRTCCPQHTKCDEKNNKCTLNSTDFDTEKSKHSPTTNRLST
VVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKCDI
KTNSCVETNSNKRRHFPLTFPKRSKFRKTLNDGNHFSIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0048675axon extension
GO:0007165signal transduction
GO:0043312neutrophil degranulation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000240body wall musculature
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR037277Granulin_sf
IPR039036Granulin_fam
IPR000118Granulin
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0005125cytokine activity
GO:0005515protein binding
GO:0008083growth factor activity
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
GO:0005764lysosome
GO:0005768endosome
GO:0005783endoplasmic reticulum
GO:0035578azurophil granule lumen
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000118GranulinSMARTSM00277GRAN_2coord: 49..101
e-value: 1.0E-10
score: 51.6
coord: 141..193
e-value: 1.0E-10
score: 51.6
coord: 307..359
e-value: 1.1E-11
score: 54.9
coord: 239..281
e-value: 0.02
score: 7.8
IPR000118GranulinPFAMPF00396Granulincoord: 61..102
e-value: 1.4E-12
score: 47.7
coord: 153..193
e-value: 5.0E-11
score: 42.7
coord: 319..360
e-value: 3.4E-12
score: 46.5
coord: 243..281
e-value: 1.1E-6
score: 28.9
IPR000118GranulinPROSITEPS00799GRANULINScoord: 81..94
IPR037277Granulin superfamilyGENE3DG3DSA:3.10.20.500coord: 304..370
e-value: 2.1E-14
score: 55.4
coord: 232..295
e-value: 5.6E-7
score: 31.6
coord: 47..113
e-value: 1.3E-13
score: 52.9
coord: 138..207
e-value: 1.9E-13
score: 52.4
IPR039036Granulin familyPANTHERPTHR12274GRANULINcoord: 36..363
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..23
score: 0.54
NoneNo IPR availableTMHMMTMhelixcoord: 7..29