Glutamate receptor ionotropic, NMDA 2B

Overview
NameGlutamate receptor ionotropic, NMDA 2B
Smed IDSMED30003957
Length (bp)3809
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamate receptor ionotropic, NMDA 2B (SMED30003957) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamate receptor ionotropic, NMDA 2B (SMED30003957) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamate receptor ionotropic, NMDA 2B (SMED30003957) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamate receptor ionotropic, NMDA 2B (SMED30003957) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003957

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30003957SMESG000009938.1 dd_Smed_v4_16258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30003957SMESG000009938.1 dd_Smed_v6_16258_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30003957SMESG000009938.1 dd_Smed_v6_17326_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Human
Match: GRIN2A (glutamate ionotropic receptor NMDA type subunit 2A [Source:HGNC Symbol;Acc:HGNC:4585])

HSP 1 Score: 324.324 bits (830), Expect = 3.593e-92
Identity = 177/515 (34.37%), Postives = 287/515 (55.73%), Query Frame = 3
Query: 1425 RWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGK-RLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQ-RADH--KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRL 2951
             W KVGKW            + +    WP  ++      PD   L + T++E PFV           C  N +PCR   K  + ++ G                            + V  CC G  +D+L ++ + + F  DL+ V +GK G      WNG++  ++  +A + + SL I   RSE +DFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E+ SP G +R   + +A H   F++ +++WL+W ++F  +V   NP+G  S+ + ++WA FA++FLASYTANLAAFMI ++    ++G+ D +   PH + P FRF TVP+G+TE N++ N+P M +YM  FN+  V+D + +LKTG++DAFIYD+ VL+YKA +D+ CKL T+G+  ++A TGYG+   KGS W+++I+  +LQ+   G+++  +  W+TG C  ++  +  + +L + N    F +L A M +       EHLF+  LR 
Sbjct:  234 EWEKVGKWE--------NHTLSLRHAVWPRYKSFS-DCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEG----------------------------MNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKN-EVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHLFYWKLRF 710          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Human
Match: GRIN2A (glutamate ionotropic receptor NMDA type subunit 2A [Source:HGNC Symbol;Acc:HGNC:4585])

HSP 1 Score: 323.168 bits (827), Expect = 3.991e-91
Identity = 177/515 (34.37%), Postives = 287/515 (55.73%), Query Frame = 3
Query: 1425 RWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGK-RLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQ-RADH--KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRL 2951
             W KVGKW            + +    WP  ++      PD   L + T++E PFV           C  N +PCR   K  + ++ G                            + V  CC G  +D+L ++ + + F  DL+ V +GK G      WNG++  ++  +A + + SL I   RSE +DFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E+ SP G +R   + +A H   F++ +++WL+W ++F  +V   NP+G  S+ + ++WA FA++FLASYTANLAAFMI ++    ++G+ D +   PH + P FRF TVP+G+TE N++ N+P M +YM  FN+  V+D + +LKTG++DAFIYD+ VL+YKA +D+ CKL T+G+  ++A TGYG+   KGS W+++I+  +LQ+   G+++  +  W+TG C  ++  +  + +L + N    F +L A M +       EHLF+  LR 
Sbjct:  371 EWEKVGKWE--------NHTLSLRHAVWPRYKSFS-DCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEG----------------------------MNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKN-EVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHLFYWKLRF 847          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Human
Match: GRIN2A (glutamate ionotropic receptor NMDA type subunit 2A [Source:HGNC Symbol;Acc:HGNC:4585])

HSP 1 Score: 323.939 bits (829), Expect = 8.195e-91
Identity = 177/514 (34.44%), Postives = 287/514 (55.84%), Query Frame = 3
Query: 1428 WFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGK-RLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQ-RADH--KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRL 2951
            W KVGKW            + +    WP  ++      PD   L + T++E PFV           C  N +PCR   K  + ++ G                            + V  CC G  +D+L ++ + + F  DL+ V +GK G      WNG++  ++  +A + + SL I   RSE +DFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E+ SP G +R   + +A H   F++ +++WL+W ++F  +V   NP+G  S+ + ++WA FA++FLASYTANLAAFMI ++    ++G+ D +   PH + P FRF TVP+G+TE N++ N+P M +YM  FN+  V+D + +LKTG++DAFIYD+ VL+YKA +D+ CKL T+G+  ++A TGYG+   KGS W+++I+  +LQ+   G+++  +  W+TG C  ++  +  + +L + N    F +L A M +       EHLF+  LR 
Sbjct:  372 WEKVGKWE--------NHTLSLRHAVWPRYKSFS-DCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEG----------------------------MNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKN-EVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHLFYWKLRF 847          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Human
Match: GRIN2A (glutamate ionotropic receptor NMDA type subunit 2A [Source:HGNC Symbol;Acc:HGNC:4585])

HSP 1 Score: 323.939 bits (829), Expect = 8.195e-91
Identity = 177/514 (34.44%), Postives = 287/514 (55.84%), Query Frame = 3
Query: 1428 WFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGK-RLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQ-RADH--KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRL 2951
            W KVGKW            + +    WP  ++      PD   L + T++E PFV           C  N +PCR   K  + ++ G                            + V  CC G  +D+L ++ + + F  DL+ V +GK G      WNG++  ++  +A + + SL I   RSE +DFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E+ SP G +R   + +A H   F++ +++WL+W ++F  +V   NP+G  S+ + ++WA FA++FLASYTANLAAFMI ++    ++G+ D +   PH + P FRF TVP+G+TE N++ N+P M +YM  FN+  V+D + +LKTG++DAFIYD+ VL+YKA +D+ CKL T+G+  ++A TGYG+   KGS W+++I+  +LQ+   G+++  +  W+TG C  ++  +  + +L + N    F +L A M +       EHLF+  LR 
Sbjct:  372 WEKVGKWE--------NHTLSLRHAVWPRYKSFS-DCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEG----------------------------MNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKN-EVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHLFYWKLRF 847          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Human
Match: GRIN2B (glutamate ionotropic receptor NMDA type subunit 2B [Source:HGNC Symbol;Acc:HGNC:4586])

HSP 1 Score: 320.472 bits (820), Expect = 1.310e-89
Identity = 193/578 (33.39%), Postives = 309/578 (53.46%), Query Frame = 3
Query: 1248 PKGIC-NSNESVWKWGKRLYQIMKSE----TVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLE-NGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDR---GNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLR 2948
            PK  C N++E      KR+YQ          V FE   + F  +G     +L I     +    +W +VGKW       K KS +++    WP     P     +   L + T++E PFV        +G C  N +PC+                        KR   I + N + + P Y+  CC G  +D+L ++ K + F  DL+ V +GK G      WNG++  ++  +A + + SL I   RSE +DFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E+ SP G +R      +     F++ +++WL+W ++F  +V   NP+G  S+ + ++WA FA++FLASYTANLAAFMI ++    +SG+ D +   P+   P FRF TVP+G+TE N++ N+ +M  YM  FN+  VDD + +LKTG++DAFIYD+ VL+Y A +D+ CKL T+G+  ++A TGYG+   K S W+++++  ILQ    G+++  +  W+TG C  ++  +  + +L + N    F +L A M +       EHLF+   R
Sbjct:  317 PKSSCYNTHE------KRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHPKLVII---LLNKERKWERVGKW-------KDKS-LQMKYYVWP--RMCPETEEQEDDHLSIVTLEEAPFVIVESVDPLSGTCMRNTVPCQ------------------------KR---IVTENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYLVTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLSLKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAILQLFGDGEMEELEALWLTGICHNEKN-EVMSSQLDIDNMAGVFYMLGAAMALSLITFICEHLFYWQFR 847          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Celegans
Match: nmr-2 (NMDA class glutamate Receptor [Source:UniProtKB/TrEMBL;Acc:E0AHC1])

HSP 1 Score: 422.165 bits (1084), Expect = 5.828e-129
Identity = 235/608 (38.65%), Postives = 344/608 (56.58%), Query Frame = 3
Query: 1260 CNSNES--VWKWGKRLYQIMKSETVE---------FEDEYIGFHSNGAINTTELFIFNSKT-VQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQN--FNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNK 3041
            C S +    W  GK +Y+ MK+  V+          +  +  F   G +  + L I N +T  +G   W KVG +        T +++++  V WPG +  PP+G  DK  ++V T+ E PF+           DV+    +         D G V   D   V   R                +  CC+G  +DLLN++  D+ F   L++V D KWG  T  GWNGL+  L+  KAD+ +TSLK+   R+  IDFS PF++TGI+IIV +R G +SPTAFLEP++Y +W +IL   +H    ++F++EW+SP+  +       +HKFSL RS WL+W+ LF A+V+TD P+   SR +A +WA F L FLA YTANLAAFMI +  +YDLSGI D  L  PH  KP FRF TV  G T E +K N+ KM +Y+++  + +  +  GI+A+K  E+DAFIYD+ VLDY A KD  C L TVG   +MTGYG+GFPK S     +N  +LQYQ+ G L+R + FW+TG C       + +  LG+ NF+SAF+LL  G+ V   +L  EH++  +LR  ++K D  G C ++S+++ + + +   V++
Sbjct:  360 CKSEDGDPYWDNGKYIYEHMKAAFVKGNPFHVDDGHDSFFYTFEKTGRLRNSILQISNLRTNSKGEKTWEKVGIF--------TNNELKMADVQWPGEKANPPQGAADKFHVKVVTLHEPPFI--------AVSDVDPDTQKCPGNQGSICDWGDVEYTDGAGVKKNRT---------------LLKCCSGYCVDLLNKLANDIGFTYTLYKVRDEKWGLKTENGWNGLIADLMHNKADMCVTSLKLNSERARDIDFSLPFLDTGISIIVKIRSGVLSPTAFLEPFEYSTWVIILFVCIHVAAISIFLFEWVSPYSFNMQKYPPPEHKFSLFRSYWLVWATLFSASVSTDVPKSTVSRLMALVWAAFGLTFLAVYTANLAAFMITRVQYYDLSGIHDPMLNFPHDQKPPFRFGTVDGGNTHETMKRNWHKMHEYVKHNKYFRMNISAGIEAVKNEELDAFIYDAVVLDYWAGKDANCALMTVGKWASMTGYGIGFPKNSPHTSLVNHYMLQYQQKGDLERLQNFWLTGACTPDSHSQTQSAPLGIENFLSAFVLLAGGIIVSVIVLGFEHIYCMHLRKPLQKIDPNGWCGIISMAMGKSLTFTEAVDR 936          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Celegans
Match: nmr-2 (NMDA class glutamate Receptor [Source:UniProtKB/TrEMBL;Acc:E0AHC1])

HSP 1 Score: 342.428 bits (877), Expect = 4.740e-106
Identity = 170/375 (45.33%), Postives = 245/375 (65.33%), Query Frame = 3
Query: 1923 LDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQN--FNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNK 3041
            +  KAD+ +TSLK+   R+  IDFS PF++TGI+IIV +R G +SPTAFLEP++Y +W +IL   +H    ++F++EW+SP+  +       +HKFSL RS WL+W+ LF A+V+TD P+   SR +A +WA F L FLA YTANLAAFMI +  +YDLSGI D  L  PH  KP FRF TV  G T E +K N+ KM +Y+++  + +  +  GI+A+K  E+DAFIYD+ VLDY A KD  C L TVG   +MTGYG+GFPK S     +N  +LQYQ+ G L+R + FW+TG C       + +  LG+ NF+SAF+LL  G+ V   +L  EH++  +LR  ++K D  G C ++S+++ + + +   V++
Sbjct:    1 MHNKADMCVTSLKLNSERARDIDFSLPFLDTGISIIVKIRSGVLSPTAFLEPFEYSTWVIILFVCIHVAAISIFLFEWVSPYSFNMQKYPPPEHKFSLFRSYWLVWATLFSASVSTDVPKSTVSRLMALVWAAFGLTFLAVYTANLAAFMITRVQYYDLSGIHDPMLNFPHDQKPPFRFGTVDGGNTHETMKRNWHKMHEYVKHNKYFRMNISAGIEAVKNEELDAFIYDAVVLDYWAGKDANCALMTVGKWASMTGYGIGFPKNSPHTSLVNHYMLQYQQKGDLERLQNFWLTGACTPDSHSQTQSAPLGIENFLSAFVLLAGGIIVSVIVLGFEHIYCMHLRKPLQKIDPNGWCGIISMAMGKSLTFTEAVDR 375          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Celegans
Match: nmr-1 (NMDA class glutamate Receptor; NMDA-type ionotropic glutamate receptor NMR-1 [Source:UniProtKB/TrEMBL;Acc:G5EGQ9])

HSP 1 Score: 152.91 bits (385), Expect = 2.898e-37
Identity = 139/523 (26.58%), Postives = 224/523 (42.83%), Query Frame = 3
Query: 1494 DGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLL---------NEMMKDLNFVVDLFE----VPDGKWGGWTPQGWNGLVKVLLDG-KADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSP----HGLDRGNIQR------------ADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVK--INFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMT-GQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRK 2963
            D + W GG        P    LRV T+ + PFV+        +C        +     + S   K+         Y  P T+ +S          + CCAGL +DLL         N +     F + L E    V   +  G T  G  G     LDG  AD+ +  + I P R   +DF+ P++  GI I+           +FL+P     W  + + SV   G A++  ++ SP    +  D+   Q             AD   +   ++W +W +L  + V+   PR  ++R L  +W  F ++ +ASYTANLAAF++       L+G+ D RL NP  +   F F TV +    +  K  +    MF+ M+  N     + + +L  G +DAFI+DS     +    + C+L+T G+L+  + YG+G  K S W   I   IL+    G +++  + W+  G          +  RLG+ N    FIL+ +G+ +   + F+E  + R L  K R+
Sbjct:  378 DSIEWAGGTKPLEISLPKH--LRVVTVADPPFVYTTPIGSPSQC------AELGNTVVEWSIFDKIVVSGP---WYSCPLTLENSTE--------YFCCAGLAIDLLSNLSLPEANNSIDTSFTFSLHLNESYGVVQASETTGITISGVIGE----LDGDTADMAIGGITINPERERIVDFTEPWLYHGIRILEKNIPRDSPMQSFLQPLQSSLWTALFI-SVILVGLAIYCLDFKSPFERFYQADKEMEQDLKKEFELWIGKDADENVNFGEAMWFVWGVLLNSGVSEKTPRSCSARVLGIVWCGFCMIMVASYTANLAAFLVLDQPEKGLTGVTDPRLRNPSAN---FSFGTVLNSNVYQYFKRHVELSSMFRKMEPHNVRRASEAVHSLLNGSLDAFIWDST--RLEFEAARHCELRTRGSLFGRSAYGIGLQKNSPWTPHITSAILRMSESGVMEKLDQKWIDRGGPNCVVEAHKSPARLGLVNMKDIFILVSSGVALGIFLSFVEVSYGRRLADKGRR 871          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Celegans
Match: nmr-1 (NMDA class glutamate Receptor; NMDA-type ionotropic glutamate receptor NMR-1 [Source:UniProtKB/TrEMBL;Acc:G5EGQ9])

HSP 1 Score: 152.91 bits (385), Expect = 2.898e-37
Identity = 139/523 (26.58%), Postives = 224/523 (42.83%), Query Frame = 3
Query: 1494 DGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLL---------NEMMKDLNFVVDLFE----VPDGKWGGWTPQGWNGLVKVLLDG-KADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSP----HGLDRGNIQR------------ADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVK--INFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMT-GQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRK 2963
            D + W GG        P    LRV T+ + PFV+        +C        +     + S   K+         Y  P T+ +S          + CCAGL +DLL         N +     F + L E    V   +  G T  G  G     LDG  AD+ +  + I P R   +DF+ P++  GI I+           +FL+P     W  + + SV   G A++  ++ SP    +  D+   Q             AD   +   ++W +W +L  + V+   PR  ++R L  +W  F ++ +ASYTANLAAF++       L+G+ D RL NP  +   F F TV +    +  K  +    MF+ M+  N     + + +L  G +DAFI+DS     +    + C+L+T G+L+  + YG+G  K S W   I   IL+    G +++  + W+  G          +  RLG+ N    FIL+ +G+ +   + F+E  + R L  K R+
Sbjct:  378 DSIEWAGGTKPLEISLPKH--LRVVTVADPPFVYTTPIGSPSQC------AELGNTVVEWSIFDKIVVSGP---WYSCPLTLENSTE--------YFCCAGLAIDLLSNLSLPEANNSIDTSFTFSLHLNESYGVVQASETTGITISGVIGE----LDGDTADMAIGGITINPERERIVDFTEPWLYHGIRILEKNIPRDSPMQSFLQPLQSSLWTALFI-SVILVGLAIYCLDFKSPFERFYQADKEMEQDLKKEFELWIGKDADENVNFGEAMWFVWGVLLNSGVSEKTPRSCSARVLGIVWCGFCMIMVASYTANLAAFLVLDQPEKGLTGVTDPRLRNPSAN---FSFGTVLNSNVYQYFKRHVELSSMFRKMEPHNVRRASEAVHSLLNGSLDAFIWDST--RLEFEAARHCELRTRGSLFGRSAYGIGLQKNSPWTPHITSAILRMSESGVMEKLDQKWIDRGGPNCVVEAHKSPARLGLVNMKDIFILVSSGVALGIFLSFVEVSYGRRLADKGRR 871          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 141.739 bits (356), Expect = 8.533e-34
Identity = 110/398 (27.64%), Postives = 190/398 (47.74%), Query Frame = 3
Query: 1794 GLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQG-WNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVA-----LRKGAISPTAFLEPYDYPSWCLILV------FSVHACGAALFIYEWLSPHGLDR---GNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVD--------DGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQ-----CKKQRTLDSTNKRLGVTNFISAFILLLAGMFVC 2903
            G  +DLLNEM + L F   + EV DG +G     G WNG++  L   +ADL ++++ IT +R+E +DF+ PFM  GI+I++A       KG++    FLEP     W  +L+      +S+H   A    YEW +   +D     NI+   ++F+++ S W     L     +   PR  A+R +A +W +F  + ++SYTA LAAF+  +     +   +D        ++   R+  + SG+T +  + +   M++ M +  +++          +GI  +K+G    + Y       +   ++ C+L+++G L    GYG+  PKGS  R  ++  +LQ Q    L+  K  W   +     C    +  +TN +    N    F +LL G+ V 
Sbjct:  431 GFCIDLLNEMTQVLKFNYTIIEVQDGTYGIEDESGRWNGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFMHLGISILLARTSEETDKGSL--WTFLEPLSLTVWISLLISYCIVSYSMHIL-AKFSPYEWYNLERIDERDFENIKNQKNQFTVLNSFWFTMGSLMQQGSDVI-PRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDL------ANQQKIRYGVLKSGSTMDFFRESKIPMYERMWSVMESSSPGVFVNSSREGIARVKSG---GYAYMMESSMLEYYLERDCELQSIGGLLDSKGYGIALPKGSPLRDILSRTVLQLQERTILEALKNKWWRDRREGPSCGPPPSEKATNSK--PQNIFGIFYVLLTGLIVA 813          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0091453)

HSP 1 Score: 437.187 bits (1123), Expect = 2.218e-135
Identity = 242/670 (36.12%), Postives = 397/670 (59.25%), Query Frame = 3
Query: 1179 LKLIQFIKERFPSNSTDLKNKIIPKGICNSNESVWKW--GKRLYQIMKSETVE--FEDEYIGFHSNGAINTTELFIFNSKTVQGR--MRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFV-FYGKRLENGKCDVN-AIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRG----NIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNKSADTLKXXXXXXXXXXXXXXRLKQENEFLKQKIQKLE 3152
            +K+  +  E + ++  +   ++  + +   +E   +W  G+  ++ +++ ++E       I F ++G + + EL I N +       + W ++G W     W   K  IR   + WPG  + PP+G P+K  L++  ++E P++        +GKC ++  + CR+   A D   A  +               +  ++ +  F    + CC+G  +DLL +  ++L F  +L  V DGKWG      WNGL+  L++ K D+V+TSL I   R   +DFS PFMETGIAI+VA R G ISPTAFLEP+D  SW L+ + ++ A    +F++EWLSP G D      N     ++FSL R+ WL+W++LF AAV+ D+PRG  SRF+ N+WALFA+VFLA YTANLAAFMI +++F++ SG+ D RL++P +HKP F+F T+P   T+  +   F  M  YM+ +NKT+V DG+ A+  G +D+FIYD  VLDY  A+D+ C+L TVG+ YAMTGYG+ F + SK+ Q  N  +L+++  G L+R +R+WMTG C+  +    ++  L +  F+SAF+LL+AG+ + + +L LEH++F+Y+R ++ K D   CC L+S+S+ + + +   V ++ + LK   C++   ++   ++K E +  + ++++LE
Sbjct:  197 IKIYSYGVEAYLTDPANRDRRLTTQSLSCEDEGRGRWDNGEIFFKYLRNVSIEGDLNKPNIEFTADGDLRSAELKIMNLRPSANNKNLVWEEIGVWK---SWETQKLDIR--DIAWPGNSHAPPQGVPEKFHLKITFLEEAPYINLSPADPVSGKCLMDRGVLCRV---AADHEMAADI--------------DVGQAHRNESF----YQCCSGFCIDLLEKFAEELGFTYELVRVEDGKWGTLENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPFMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHEFSGLNDSRLVHPFSHKPSFKFGTIPYSHTDSTIHKYFNVMHNYMRQYNKTSVADGVAAVLNGNLDSFIYDGTVLDYLVAQDEDCRLMTVGSWYAMTGYGLAFSRNSKYVQMFNKRLLEFRANGDLERLRRYWMTGTCRPGKQEHKSSDPLALEQFLSAFLLLMAGILLAALLLLLEHVYFKYIRKRLAKKDGGHCCALISLSMGKSLTFRGAVFEATEILKKHRCNDPICDTHLWKVKHELDMSRLRVRQLE 840          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0301842)

HSP 1 Score: 437.187 bits (1123), Expect = 2.218e-135
Identity = 242/670 (36.12%), Postives = 397/670 (59.25%), Query Frame = 3
Query: 1179 LKLIQFIKERFPSNSTDLKNKIIPKGICNSNESVWKW--GKRLYQIMKSETVE--FEDEYIGFHSNGAINTTELFIFNSKTVQGR--MRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFV-FYGKRLENGKCDVN-AIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRG----NIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNKSADTLKXXXXXXXXXXXXXXRLKQENEFLKQKIQKLE 3152
            +K+  +  E + ++  +   ++  + +   +E   +W  G+  ++ +++ ++E       I F ++G + + EL I N +       + W ++G W     W   K  IR   + WPG  + PP+G P+K  L++  ++E P++        +GKC ++  + CR+   A D   A  +               +  ++ +  F    + CC+G  +DLL +  ++L F  +L  V DGKWG      WNGL+  L++ K D+V+TSL I   R   +DFS PFMETGIAI+VA R G ISPTAFLEP+D  SW L+ + ++ A    +F++EWLSP G D      N     ++FSL R+ WL+W++LF AAV+ D+PRG  SRF+ N+WALFA+VFLA YTANLAAFMI +++F++ SG+ D RL++P +HKP F+F T+P   T+  +   F  M  YM+ +NKT+V DG+ A+  G +D+FIYD  VLDY  A+D+ C+L TVG+ YAMTGYG+ F + SK+ Q  N  +L+++  G L+R +R+WMTG C+  +    ++  L +  F+SAF+LL+AG+ + + +L LEH++F+Y+R ++ K D   CC L+S+S+ + + +   V ++ + LK   C++   ++   ++K E +  + ++++LE
Sbjct:  197 IKIYSYGVEAYLTDPANRDRRLTTQSLSCEDEGRGRWDNGEIFFKYLRNVSIEGDLNKPNIEFTADGDLRSAELKIMNLRPSANNKNLVWEEIGVWK---SWETQKLDIR--DIAWPGNSHAPPQGVPEKFHLKITFLEEAPYINLSPADPVSGKCLMDRGVLCRV---AADHEMAADI--------------DVGQAHRNESF----YQCCSGFCIDLLEKFAEELGFTYELVRVEDGKWGTLENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPFMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHEFSGLNDSRLVHPFSHKPSFKFGTIPYSHTDSTIHKYFNVMHNYMRQYNKTSVADGVAAVLNGNLDSFIYDGTVLDYLVAQDEDCRLMTVGSWYAMTGYGLAFSRNSKYVQMFNKRLLEFRANGDLERLRRYWMTGTCRPGKQEHKSSDPLALEQFLSAFLLLMAGILLAALLLLLEHVYFKYIRKRLAKKDGGHCCALISLSMGKSLTFRGAVFEATEILKKHRCNDPICDTHLWKVKHELDMSRLRVRQLE 840          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0091454)

HSP 1 Score: 437.187 bits (1123), Expect = 2.218e-135
Identity = 242/670 (36.12%), Postives = 397/670 (59.25%), Query Frame = 3
Query: 1179 LKLIQFIKERFPSNSTDLKNKIIPKGICNSNESVWKW--GKRLYQIMKSETVE--FEDEYIGFHSNGAINTTELFIFNSKTVQGR--MRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFV-FYGKRLENGKCDVN-AIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRG----NIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNKSADTLKXXXXXXXXXXXXXXRLKQENEFLKQKIQKLE 3152
            +K+  +  E + ++  +   ++  + +   +E   +W  G+  ++ +++ ++E       I F ++G + + EL I N +       + W ++G W     W   K  IR   + WPG  + PP+G P+K  L++  ++E P++        +GKC ++  + CR+   A D   A  +               +  ++ +  F    + CC+G  +DLL +  ++L F  +L  V DGKWG      WNGL+  L++ K D+V+TSL I   R   +DFS PFMETGIAI+VA R G ISPTAFLEP+D  SW L+ + ++ A    +F++EWLSP G D      N     ++FSL R+ WL+W++LF AAV+ D+PRG  SRF+ N+WALFA+VFLA YTANLAAFMI +++F++ SG+ D RL++P +HKP F+F T+P   T+  +   F  M  YM+ +NKT+V DG+ A+  G +D+FIYD  VLDY  A+D+ C+L TVG+ YAMTGYG+ F + SK+ Q  N  +L+++  G L+R +R+WMTG C+  +    ++  L +  F+SAF+LL+AG+ + + +L LEH++F+Y+R ++ K D   CC L+S+S+ + + +   V ++ + LK   C++   ++   ++K E +  + ++++LE
Sbjct:  197 IKIYSYGVEAYLTDPANRDRRLTTQSLSCEDEGRGRWDNGEIFFKYLRNVSIEGDLNKPNIEFTADGDLRSAELKIMNLRPSANNKNLVWEEIGVWK---SWETQKLDIR--DIAWPGNSHAPPQGVPEKFHLKITFLEEAPYINLSPADPVSGKCLMDRGVLCRV---AADHEMAADI--------------DVGQAHRNESF----YQCCSGFCIDLLEKFAEELGFTYELVRVEDGKWGTLENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPFMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHEFSGLNDSRLVHPFSHKPSFKFGTIPYSHTDSTIHKYFNVMHNYMRQYNKTSVADGVAAVLNGNLDSFIYDGTVLDYLVAQDEDCRLMTVGSWYAMTGYGLAFSRNSKYVQMFNKRLLEFRANGDLERLRRYWMTGTCRPGKQEHKSSDPLALEQFLSAFLLLMAGILLAALLLLLEHVYFKYIRKRLAKKDGGHCCALISLSMGKSLTFRGAVFEATEILKKHRCNDPICDTHLWKVKHELDMSRLRVRQLE 840          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0301843)

HSP 1 Score: 437.187 bits (1123), Expect = 5.357e-135
Identity = 242/670 (36.12%), Postives = 397/670 (59.25%), Query Frame = 3
Query: 1179 LKLIQFIKERFPSNSTDLKNKIIPKGICNSNESVWKW--GKRLYQIMKSETVE--FEDEYIGFHSNGAINTTELFIFNSKTVQGR--MRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFV-FYGKRLENGKCDVN-AIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRG----NIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNKSADTLKXXXXXXXXXXXXXXRLKQENEFLKQKIQKLE 3152
            +K+  +  E + ++  +   ++  + +   +E   +W  G+  ++ +++ ++E       I F ++G + + EL I N +       + W ++G W     W   K  IR   + WPG  + PP+G P+K  L++  ++E P++        +GKC ++  + CR+   A D   A  +               +  ++ +  F    + CC+G  +DLL +  ++L F  +L  V DGKWG      WNGL+  L++ K D+V+TSL I   R   +DFS PFMETGIAI+VA R G ISPTAFLEP+D  SW L+ + ++ A    +F++EWLSP G D      N     ++FSL R+ WL+W++LF AAV+ D+PRG  SRF+ N+WALFA+VFLA YTANLAAFMI +++F++ SG+ D RL++P +HKP F+F T+P   T+  +   F  M  YM+ +NKT+V DG+ A+  G +D+FIYD  VLDY  A+D+ C+L TVG+ YAMTGYG+ F + SK+ Q  N  +L+++  G L+R +R+WMTG C+  +    ++  L +  F+SAF+LL+AG+ + + +L LEH++F+Y+R ++ K D   CC L+S+S+ + + +   V ++ + LK   C++   ++   ++K E +  + ++++LE
Sbjct:  236 IKIYSYGVEAYLTDPANRDRRLTTQSLSCEDEGRGRWDNGEIFFKYLRNVSIEGDLNKPNIEFTADGDLRSAELKIMNLRPSANNKNLVWEEIGVWK---SWETQKLDIR--DIAWPGNSHAPPQGVPEKFHLKITFLEEAPYINLSPADPVSGKCLMDRGVLCRV---AADHEMAADI--------------DVGQAHRNESF----YQCCSGFCIDLLEKFAEELGFTYELVRVEDGKWGTLENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPFMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHEFSGLNDSRLVHPFSHKPSFKFGTIPYSHTDSTIHKYFNVMHNYMRQYNKTSVADGVAAVLNGNLDSFIYDGTVLDYLVAQDEDCRLMTVGSWYAMTGYGLAFSRNSKYVQMFNKRLLEFRANGDLERLRRYWMTGTCRPGKQEHKSSDPLALEQFLSAFLLLMAGILLAALLLLLEHVYFKYIRKRLAKKDGGHCCALISLSMGKSLTFRGAVFEATEILKKHRCNDPICDTHLWKVKHELDMSRLRVRQLE 879          

HSP 2 Score: 51.6026 bits (122), Expect = 5.581e-6
Identity = 40/139 (28.78%), Postives = 72/139 (51.80%), Query Frame = 3
Query:  324 MMRMVCKEFQGTRIQPITNTLLLVNDDGDEVDKKNADSGLEYFLYLSSIIKIPVITWFPDRSGQMENYA--NSMALRLEPMNWHIARAFVDFMQAYNWDLVTIVMSSKQREKNTFLKELRNVQKERSNIENNNHFPFTI 734
            ++  +CKEF    +  I   L ++N++       ++ +  +YFL L+  + IPVI+W  D SG +E  A  +++ L+L P   H + A +  ++ Y W   ++V +S+    + F++ +R    ER   E   HF FTI
Sbjct:   21 ILSTLCKEFLRVNVSAI---LYMMNNE----QFGHSTASAQYFLQLAGYLGIPVISWNADNSG-LERRASQSTLQLQLAPSIEHQSAAMLSILERYKWHQFSVV-TSQIAGHDDFVQAVR----ERV-AEMQEHFKFTI 145          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0339592)

HSP 1 Score: 437.573 bits (1124), Expect = 9.920e-134
Identity = 240/672 (35.71%), Postives = 396/672 (58.93%), Query Frame = 3
Query: 1179 LKLIQFIKERFPSNSTDLKNKIIPKGICNSNESVWKW--GKRLYQIMKSETVE--FEDEYIGFHSNGAINTTELFIFNSKTVQGR--MRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFV-FYGKRLENGKCDVN-AIPCRIL--QKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRG----NIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNKSADTLKXXXXXXXXXXXXXXRLKQENEFLKQKIQKLE 3152
            +K+  +  E + ++  +   ++  + +   +E   +W  G+  ++ +++ ++E       I F ++G + + EL I N +       + W ++G W     W   K  IR   + WPG  + PP+G P+K  L++  ++E P++        +GKC ++  + CR+    +   + D G+ + ++                         + CC+G  +DLL +  ++L F  +L  V DGKWG      WNGL+  L++ K D+V+TSL I   R   +DFS PFMETGIAI+VA R G ISPTAFLEP+D  SW L+ + ++ A    +F++EWLSP G D      N     ++FSL R+ WL+W++LF AAV+ D+PRG  SRF+ N+WALFA+VFLA YTANLAAFMI +++F++ SG+ D RL++P +HKP F+F T+P   T+  +   F  M  YM+ +NKT+V DG+ A+  G +D+FIYD  VLDY  A+D+ C+L TVG+ YAMTGYG+ F + SK+ Q  N  +L+++  G L+R +R+WMTG C+  +    ++  L +  F+SAF+LL+AG+ + + +L LEH++F+Y+R ++ K D   CC L+S+S+ + + +   V ++ + LK   C++   ++   ++K E +  + ++++LE
Sbjct:  378 IKIYSYGVEAYLTDPANRDRRLTTQSLSCEDEGRGRWDNGEIFFKYLRNVSIEGDLNKPNIEFTADGDLRSAELKIMNLRPSANNKNLVWEEIGVWK---SWETQKLDIR--DIAWPGNSHAPPQGVPEKFHLKITFLEEAPYINLSPADPVSGKCLMDRGVLCRVAADHEMAADIDVGQAHRNES-----------------------FYQCCSGFCIDLLEKFAEELGFTYELVRVEDGKWGTLENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPFMETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHEFSGLNDSRLVHPFSHKPSFKFGTIPYSHTDSTIHKYFNVMHNYMRQYNKTSVADGVAAVLNGNLDSFIYDGTVLDYLVAQDEDCRLMTVGSWYAMTGYGLAFSRNSKYVQMFNKRLLEFRANGDLERLRRYWMTGTCRPGKQEHKSSDPLALEQFLSAFLLLMAGILLAALLLLLEHVYFKYIRKRLAKKDGGHCCALISLSMGKSLTFRGAVFEATEILKKHRCNDPICDTHLWKVKHELDMSRLRVRQLE 1021          

HSP 2 Score: 54.6842 bits (130), Expect = 6.728e-7
Identity = 41/143 (28.67%), Postives = 74/143 (51.75%), Query Frame = 3
Query:  312 NPRKMMRMVCKEFQGTRIQPITNTLLLVNDDGDEVDKKNADSGLEYFLYLSSIIKIPVITWFPDRSGQMENYA--NSMALRLEPMNWHIARAFVDFMQAYNWDLVTIVMSSKQREKNTFLKELRNVQKERSNIENNNHFPFTI 734
            +P  ++  +CKEF    +  I   L ++N++       ++ +  +YFL L+  + IPVI+W  D SG +E  A  +++ L+L P   H + A +  ++ Y W   ++V +S+    + F++ +R    ER   E   HF FTI
Sbjct:  159 SPTAILSTLCKEFLRVNVSAI---LYMMNNE----QFGHSTASAQYFLQLAGYLGIPVISWNADNSG-LERRASQSTLQLQLAPSIEHQSAAMLSILERYKWHQFSVV-TSQIAGHDDFVQAVR----ERV-AEMQEHFKFTI 287          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Zebrafish
Match: grin2aa (glutamate receptor, ionotropic, N-methyl D-aspartate 2A, a [Source:ZFIN;Acc:ZDB-GENE-070424-129])

HSP 1 Score: 324.324 bits (830), Expect = 4.350e-91
Identity = 180/515 (34.95%), Postives = 290/515 (56.31%), Query Frame = 3
Query: 1425 RWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYG--KRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADH---KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLR 2948
             W K+GKW   S        + +    WP   N       D   L + T++E PFV     +RL  G C  N++PCR   K                             N++     Y+  CC G  +D+L ++ +++ F  DL+ V +GK G      WNG+V  +++ KA + + SL I   RSE IDFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E++SP G +R   Q  D     F++ +++WL+W ++F  +V   NP+G  S+F+ ++WA FA++FLASYTANLAAFMI ++    ++G+ D +  +P+++ P FRF TVP+G+TE N++ N+P M +YM  +++T V+D + +LKTG++DAFIYD+ VL+Y A +D+ CKL T+G+  ++A TGYG+   KGS W++ ++  IL     G+++  +  W+TG C  ++  +  + +L V N    F +L   M +       EHLF+  LR
Sbjct:  368 EWEKMGKWENQS--------LTLKYPVWPRF-NSFGDAETDDNHLTIVTLEEKPFVIVENVERL-TGTCMRNSVPCRKHIK----------------------------DNTTEGGGTYIKKCCKGFCIDILKKIARNVKFTYDLYLVTNGKHGKKINNVWNGMVGEVVNKKAVMAVGSLTINEERSEVIDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLLVTAMAVFMFEYISPLGFNRNLAQGKDPHGPSFTMGKAVWLLWGLVFNNSVPVQNPKGTTSKFIVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQSPYSYSPPFRFGTVPNGSTERNIRKNYPDMHQYMVKYHQTGVNDALVSLKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGYIFATTGYGIALQKGSLWKRPVDLAILAIIGDGEMEELEAQWLTGICHNEKN-EVMSSQLDVDNMAGVFYMLATAMGLSLITFVWEHLFYWRLR 843          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Zebrafish
Match: BX649405.2 (glutamate receptor, ionotropic, N-methyl D-aspartate 2A, b [Source:NCBI gene;Acc:570493])

HSP 1 Score: 321.242 bits (822), Expect = 2.109e-90
Identity = 181/513 (35.28%), Postives = 288/513 (56.14%), Query Frame = 3
Query: 1428 WFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGK-RLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADH---KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLR 2948
            W K+G+W   S        +R+    WP   N       D+  L + T++E PFV      +  G C  N++PCR  +   D +  G                             YV  CC G  +D+L ++ +++ F  DL+ V +GK G      WNG+V  ++  KA + + SL I   RSE IDFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E++SP G +R   Q  D     F++ +++WL+W ++F  +V   NPRG  S+F+ ++WA FA++FLASYTANLAAFMI ++    ++G+ D +  +P+++ P FRF TVP+G+TE N++ N+P M +YM  +++T V D + +LKTG++DAFIYD+ VL+Y A +D  CKL T+G+  ++A TGYG+   KGS W++ ++  IL     G+++  +  W+TG C  ++  +  + +L V N    F +L A M +       EHLF+  LR
Sbjct:  262 WEKMGRWENHS--------LRLKFPVWPR-YNSFGDMDADENHLSIVTLEERPFVIVDDVDILTGTCMRNSVPCR--KHIKDNTTEGS----------------------------YVKKCCKGFCIDILKKIARNVKFTYDLYLVTNGKHGKKINNVWNGMVGEVVYKKAVMAVGSLTINEERSEAIDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVTAIAVFLFEFISPLGFNRNLAQGKDPHGPSFTIGKAVWLLWGLVFNNSVPVQNPRGTTSKFIVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDRKFQSPYSYSPPFRFGTVPNGSTERNIRKNYPAMHQYMVKYHQTGVVDALVSLKTGKLDAFIYDAAVLNYMAGRDDGCKLVTIGSGYIFATTGYGIAMQKGSYWKRLVDLAILGIIGDGEMEELEAQWLTGICHNEKN-EVMSSQLDVDNMAGVFYMLAAAMALSLITFVWEHLFYWRLR 734          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Zebrafish
Match: grin2ab (glutamate receptor, ionotropic, N-methyl D-aspartate 2A, b [Source:ZFIN;Acc:ZDB-GENE-070424-223])

HSP 1 Score: 320.857 bits (821), Expect = 5.959e-90
Identity = 181/513 (35.28%), Postives = 288/513 (56.14%), Query Frame = 3
Query: 1428 WFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGK-RLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADH---KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLR 2948
            W K+G+W   S        +R+    WP   N       D+  L + T++E PFV      +  G C  N++PCR  +   D +  G                             YV  CC G  +D+L ++ +++ F  DL+ V +GK G      WNG+V  ++  KA + + SL I   RSE IDFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E++SP G +R   Q  D     F++ +++WL+W ++F  +V   NPRG  S+F+ ++WA FA++FLASYTANLAAFMI ++    ++G+ D +  +P+++ P FRF TVP+G+TE N++ N+P M +YM  +++T V D + +LKTG++DAFIYD+ VL+Y A +D  CKL T+G+  ++A TGYG+   KGS W++ ++  IL     G+++  +  W+TG C  ++  +  + +L V N    F +L A M +       EHLF+  LR
Sbjct:  362 WEKMGRWENHS--------LRLKFPVWPR-YNSFGDMDADENHLSIVTLEERPFVIVDDVDILTGTCMRNSVPCR--KHIKDNTTEGS----------------------------YVKKCCKGFCIDILKKIARNVKFTYDLYLVTNGKHGKKINNVWNGMVGEVVYKKAVMAVGSLTINEERSEAIDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVTAIAVFLFEFISPLGFNRNLAQGKDPHGPSFTIGKAVWLLWGLVFNNSVPVQNPRGTTSKFIVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDRKFQSPYSYSPPFRFGTVPNGSTERNIRKNYPAMHQYMVKYHQTGVVDALVSLKTGKLDAFIYDAAVLNYMAGRDDGCKLVTIGSGYIFATTGYGIAMQKGSYWKRLVDLAILGIIGDGEMEELEAQWLTGICHNEKN-EVMSSQLDVDNMAGVFYMLAAAMALSLITFVWEHLFYWRLR 834          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Zebrafish
Match: grin2ab (glutamate receptor, ionotropic, N-methyl D-aspartate 2A, b [Source:ZFIN;Acc:ZDB-GENE-070424-223])

HSP 1 Score: 320.857 bits (821), Expect = 5.959e-90
Identity = 181/513 (35.28%), Postives = 288/513 (56.14%), Query Frame = 3
Query: 1428 WFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGK-RLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADH---KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLR 2948
            W K+G+W   S        +R+    WP   N       D+  L + T++E PFV      +  G C  N++PCR  +   D +  G                             YV  CC G  +D+L ++ +++ F  DL+ V +GK G      WNG+V  ++  KA + + SL I   RSE IDFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E++SP G +R   Q  D     F++ +++WL+W ++F  +V   NPRG  S+F+ ++WA FA++FLASYTANLAAFMI ++    ++G+ D +  +P+++ P FRF TVP+G+TE N++ N+P M +YM  +++T V D + +LKTG++DAFIYD+ VL+Y A +D  CKL T+G+  ++A TGYG+   KGS W++ ++  IL     G+++  +  W+TG C  ++  +  + +L V N    F +L A M +       EHLF+  LR
Sbjct:  362 WEKMGRWENHS--------LRLKFPVWPR-YNSFGDMDADENHLSIVTLEERPFVIVDDVDILTGTCMRNSVPCR--KHIKDNTTEGS----------------------------YVKKCCKGFCIDILKKIARNVKFTYDLYLVTNGKHGKKINNVWNGMVGEVVYKKAVMAVGSLTINEERSEAIDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVTAIAVFLFEFISPLGFNRNLAQGKDPHGPSFTIGKAVWLLWGLVFNNSVPVQNPRGTTSKFIVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDRKFQSPYSYSPPFRFGTVPNGSTERNIRKNYPAMHQYMVKYHQTGVVDALVSLKTGKLDAFIYDAAVLNYMAGRDDGCKLVTIGSGYIFATTGYGIAMQKGSYWKRLVDLAILGIIGDGEMEELEAQWLTGICHNEKN-EVMSSQLDVDNMAGVFYMLAAAMALSLITFVWEHLFYWRLR 834          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Zebrafish
Match: grin2ca (glutamate receptor, ionotropic, N-methyl D-aspartate 2Ca [Source:ZFIN;Acc:ZDB-GENE-070822-3])

HSP 1 Score: 320.472 bits (820), Expect = 6.030e-90
Identity = 191/557 (34.29%), Postives = 303/557 (54.40%), Query Frame = 3
Query: 1326 VEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWP--GGENKPPKGRPDKVKLRVATIQEMPFVFY-GKRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADH---KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDR 2972
            V +E+    F+S+G +    + I    T+    +W KVG +            +++    WP  G   +P     D   L VAT++E PFV         G C  N +PCR               + ++ E I             G    Y   CC G  +D+L ++ +++ F  DL+ V +GK G      WNG++  +   +AD+ + SL I   RSE IDFS PF+ETGI+++VA   G +SP+AFLEPY    W ++ V  +      +F++E+ SP G +R  +   D     F++ +S+WL+W ++F  +V  +NP+G  S+ +  +WA FA++FLASYTANLAAFMI +     +SG+ D +   P    P FRF TVP+G+TE N++ N+P+M  +M  +N+  V+D + +LKTG++DAFIYD+ VL+Y A KD+ CKL T+G+  ++A TGYG+   K S+W++ I+  +LQ+   G  Q+ +  W+TG C+ ++  +  + +L + N    F +LL  M +   +   EHL +  LR  VRK++R
Sbjct:  347 VSWENTDFSFNSDGYLVNPSMIII---TLDRGRQWDKVGNYE--------SGILQMRYPVWPRYGTFLEPVS---DNRHLTVATLEERPFVIVEAVDPVTGTCLSNTVPCR--------------RQSNKTETIV------------GHTEPYTKLCCKGFCIDILKKLSRNIKFSYDLYLVTNGKHGKLVRGIWNGMIGEVFYKRADMAIGSLTINEERSEIIDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVTVFVFEYCSPVGYNRSLVSAKDPGGPTFTIGKSVWLLWGIVFNNSVPIENPKGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTVSGLSDKKFQKPQDQYPPFRFGTVPNGSTERNIRSNYPEMHSHMVKYNQKGVEDALNSLKTGKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIALQKESRWKRPIDLALLQFLADGDTQKLQTVWLTGICRNEKK-EVMSSKLDIDNMAGVFYMLLVAMGLSLLVFAWEHLLYWKLRHSVRKSER 862          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Xenopus
Match: GRIN2A (glutamate receptor, ionotropic, N-methyl D-aspartate 2A [Source:NCBI gene;Acc:100489006])

HSP 1 Score: 328.176 bits (840), Expect = 1.149e-92
Identity = 182/518 (35.14%), Postives = 289/518 (55.79%), Query Frame = 3
Query: 1425 RWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLEN-----GKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQ-RADH--KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLR 2948
             W KVGKW   S        + +    WP          PD   L + T++E PFV     +EN     G C  N +PCR                       Y R +  ++  +S      V  CC G  +D+L ++ K + F  DL+ V +GK G      WNG++  ++  +A + + SL I   RSE +DFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E+ SP G +R     +A H   F++ +++WL+W ++F  +V   NP+G  S+ + +IWA FA++FLASYTANLAAFMI ++    ++G+ D +   PH + P FRF TVP+G+TE N++ N+P M +YM  F++  V D + +LKTG++DAFIYD+ VL+Y A +D+ CKL T+G+  ++A TGYG+   KGS+W++ I+  +LQ+   G+++  ++ W+TG C  ++  +  + +L + N    F +L A M +       EHLF+  LR
Sbjct:  231 EWEKVGKWENKS--------LNMKYPVWPR-ITASLDSDPDDNHLSIVTLEEAPFVI----VENVDYLTGTCVRNTVPCRK----------------------YFRLNNSTTEGTS------VKKCCKGFCIDILKKLSKTVKFTYDLYLVTNGKHGKKIKNVWNGMIGEVVYKRAVMAVGSLTINEERSEAVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLLVSAVAVFVFEYFSPVGYNRNLADGKAPHGPSFTIGKAVWLLWGLVFNNSVPVQNPKGTTSKIIVSIWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPDMHQYMVKFHQKGVQDALVSLKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGYIFATTGYGIALQKGSRWKRPIDLALLQFVGDGEMEELEKLWLTGICHTEKN-EVMSSQLDIDNMAGVFYMLAAAMALSLITFVWEHLFYWKLR 706          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Xenopus
Match: sdr42e1 (short chain dehydrogenase/reductase family 42E, member 1 [Source:Xenbase;Acc:XB-GENE-985965])

HSP 1 Score: 320.087 bits (819), Expect = 1.495e-92
Identity = 176/482 (36.51%), Postives = 277/482 (57.47%), Query Frame = 3
Query: 1545 DKVKLRVATIQEMPFVFY-GKRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRG---NIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDR 2972
            D   L VAT++E PFV   G     G C  +++PCR   K  + +D                       N      I+V  CC G  +D+L  + K + F  DL+ V +GK G      WNG++  +   +AD+ + SL I   RSE IDFS PF+ETGI+++V+   G +SP+AFLEPY    W ++ V  +      +FI+E+ SP G +R      +    KF++ +S+WL+W+++F  +V  +NP+G  S+ +  IWA FA++FLASYTANLAAFMI ++    +SG+ D +   PH   P  +F TVP+G+TE+N++ N+P M  YM  +N+  V+D ++ LKTG++DAFIYD+ VL+Y A KD+ CKL T+G+  ++A TGYG+   KGSKW++ I+  +LQ+    +++  +R W++G C   + ++  + +L + N    F +LL  M +   +   EHL +  LR  +R + +
Sbjct:  391 DDQHLTVATLEERPFVIVEGVDPATGTCIRDSVPCR---KQLNRTD-----------------------NHLTDPIIFVKQCCKGFCIDILKRLSKTIGFTYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSLTINEERSEIIDFSVPFVETGISVMVSRSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVTVFIFEYFSPVGYNRSLSTGKRPGGSKFTIGKSIWLLWALVFNNSVPVENPKGTTSKIMVLIWAFFAVIFLASYTANLAAFMIQEEYVDTVSGLSDKKFQRPHEQYPPLKFGTVPNGSTEKNIRSNYPDMHAYMIKYNQRHVEDALQNLKTGKLDAFIYDAAVLNYMARKDEGCKLVTIGSGKVFATTGYGIALQKGSKWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDK-IEVMSSKLDIDNMAGVFYMLLVAMGLSLLVFAWEHLIYWKLRHCMRHSGK 845          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Xenopus
Match: sdr42e1 (short chain dehydrogenase/reductase family 42E, member 1 [Source:Xenbase;Acc:XB-GENE-985965])

HSP 1 Score: 323.553 bits (828), Expect = 2.905e-91
Identity = 177/497 (35.61%), Postives = 277/497 (55.73%), Query Frame = 3
Query: 1545 DKVKLRVATIQEMPFVFY-GKRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRG---NIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDR-----------YGCC 2984
            D   L VAT++E PFV   G     G C  +++PCR      D      +                          I+V  CC G  +D+L  + K + F  DL+ V +GK G      WNG++  +   +AD+ + SL I   RSE IDFS PF+ETGI+++V+   G +SP+AFLEPY    W ++ V  +      +FI+E+ SP G +R      +    KF++ +S+WL+W+++F  +V  +NP+G  S+ +  IWA FA++FLASYTANLAAFMI ++    +SG+ D +   PH   P  +F TVP+G+TE+N++ N+P M  YM  +N+  V+D ++ LKTG++DAFIYD+ VL+Y A KD+ CKL T+G+  ++A TGYG+   KGSKW++ I+  +LQ+    +++  +R W++G C   + ++  + +L + N    F +LL  M +   +   EHL +  LR  +R + +           Y CC
Sbjct:  405 DDQHLTVATLEERPFVIVEGVDPATGTCIRDSVPCRKQLNRTDNHLTDPI--------------------------IFVKQCCKGFCIDILKRLSKTIGFTYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSLTINEERSEIIDFSVPFVETGISVMVSRSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVTVFIFEYFSPVGYNRSLSTGKRPGGSKFTIGKSIWLLWALVFNNSVPVENPKGTTSKIMVLIWAFFAVIFLASYTANLAAFMIQEEYVDTVSGLSDKKFQRPHEQYPPLKFGTVPNGSTEKNIRSNYPDMHAYMIKYNQRHVEDALQNLKTGKLDAFIYDAAVLNYMARKDEGCKLVTIGSGKVFATTGYGIALQKGSKWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDK-IEVMSSKLDIDNMAGVFYMLLVAMGLSLLVFAWEHLIYWKLRHCMRHSGKLDFLLAFSRGMYSCC 874          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Xenopus
Match: GRIN2C (glutamate receptor, ionotropic, N-methyl D-aspartate 2C [Source:NCBI gene;Acc:100496638])

HSP 1 Score: 320.857 bits (821), Expect = 7.800e-91
Identity = 189/542 (34.87%), Postives = 294/542 (54.24%), Query Frame = 3
Query: 1347 IGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWP--GGENKPPKGRPDKVKLRVATIQEMPFVFY-GKRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDR--GNIQR-ADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLR 2948
            + F+S G +    + +    T+     W +VG+W            IR+    WP  G  N+      D   L VAT++E PFV         G C  N +PCR       +S+                  T+SSS        Y   CC G  +D+L ++ + + F  DL+ V +GK G      WNG++  +   +A L + SL I   RSE +DFS PF+ETGI+++V+   G +SP+AFLEPY    W ++ V  +      +FI+E+ SP G D+   N +R     F++ +SLWL+W+++F  +V   NPRG  S+ +  +WA FA++FLASYTANLAAFMI +     +SG+ D +   P    P FRF TVP+G+TE N++ N+P M  YM  +N+ +V+D + +LK G++DAFIYD+ VL+Y A KD+ CKL T+G+  ++A TGYG+   K S+W++ I+  +LQ+   G  QR +  W++G C+ ++  ++ + +L + N    F +LL  M +   +   EHL +  +R
Sbjct:  340 VSFNSQGYLLDPSMLVI---TLTPHRAWEEVGRWE--------SGIIRMKYPVWPRYGAGNQLVT---DSRHLTVATLEERPFVIVESTDPATGDCIRNTVPCR------KQSNL-----------------TLSSSGEP-----YTKLCCKGFCIDILKKLARTVKFSYDLYLVTNGKHGKLVRGVWNGMIGEVYYRRAHLAIGSLTINEERSEIVDFSVPFVETGISVLVSRSNGTVSPSAFLEPYSPAVWMMMFVMCLSVVAVTVFIFEYFSPMGYDQDLSNGKRLGGPSFTIGKSLWLLWALVFNNSVPIQNPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTVSGLSDRKFQKPQEQYPPFRFGTVPNGSTERNIRTNYPDMHSYMVRYNQRSVEDALASLKAGKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIALQKNSRWKRPIDLALLQFLGDGDTQRLETVWLSGICQNEKN-EAVSSKLDIDNMAGVFYMLLVAMGLSLLVFSWEHLVYWRMR 838          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Xenopus
Match: GRIN2B (glutamate receptor, ionotropic, N-methyl D-aspartate 2B [Source:NCBI gene;Acc:100490580])

HSP 1 Score: 320.857 bits (821), Expect = 7.998e-90
Identity = 181/547 (33.09%), Postives = 295/547 (53.93%), Query Frame = 3
Query: 1326 VEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLE-NGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDR---GNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLR 2948
            V FE   + F  +G     +L I     +  + +W +VGK+   S        +++    WP  E  P         L + T++E PFV        +G C  N +PCR                             I + N + +   Y+  CC G  +D+L ++ K + F  DL+ V +GK G      WNG++  ++  +A + + SL I   RSE +DFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E+ SP G +R      +     F++ +++WL+W ++F  +V   NP+G  S+ + ++WA FA++FLASYTANLAAFMI ++    +SG+ D +   P+   P FRF TVP+G+TE N++ N+ +M  YM  FN+ +V D + +LKTG++DAFIYD+ VL+Y A +D+ CKL T+G+  ++A TGYG+   K S W+++++  ILQ    G+++  +  W+TG C  ++  +  + +L + N    F +L A M +      +EHLFF  LR
Sbjct:  337 VTFEGRNLSFSEDGYQMHPKLVII---LLNQQRKWERVGKYKDRS--------LKMKYYVWPVFELYPNSEEHKDEHLSIVTLEEAPFVIVEDVDPLSGTCMRNTVPCR---------------------------KQIRTENRTEEGGNYIKRCCKGFCIDILKKIAKTVKFTYDLYLVTNGKHGKKINGTWNGMIGEVVTKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQRPNDFSPAFRFGTVPNGSTERNIRNNYLEMHSYMVKFNQRSVQDALLSLKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFATTGYGIAIQKDSGWKRQVDLAILQLFGDGEMEELEALWLTGICHNEKN-EVMSSQLDIDNMAGVFYMLAAAMALSLITFIMEHLFFWQLR 844          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Mouse
Match: Grin2a (glutamate receptor, ionotropic, NMDA2A (epsilon 1) [Source:MGI Symbol;Acc:MGI:95820])

HSP 1 Score: 324.709 bits (831), Expect = 3.847e-91
Identity = 177/515 (34.37%), Postives = 287/515 (55.73%), Query Frame = 3
Query: 1425 RWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGK-RLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQ-RADH--KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRL 2951
             W KVGKW            + +    WP  ++      PD   L + T++E PFV           C  N +PCR   K  + ++ G                            + V  CC G  +D+L ++ + + F  DL+ V +GK G      WNG++  ++  +A + + SL I   RSE +DFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E+ SP G +R   + +A H   F++ +++WL+W ++F  +V   NP+G  S+ + ++WA FA++FLASYTANLAAFMI ++    ++G+ D +   PH + P FRF TVP+G+TE N++ N+P M +YM  FN+  V+D + +LKTG++DAFIYD+ VL+YKA +D+ CKL T+G+  ++A TGYG+   KGS W+++I+  +LQ+   G+++  +  W+TG C  ++  +  + +L + N    F +L A M +       EHLF+  LR 
Sbjct:  371 EWEKVGKWE--------NQTLSLRHAVWPRYKSFS-DCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEG----------------------------MNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQRGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKN-EVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHLFYWKLRF 847          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Mouse
Match: Grin2a (glutamate receptor, ionotropic, NMDA2A (epsilon 1) [Source:MGI Symbol;Acc:MGI:95820])

HSP 1 Score: 324.709 bits (831), Expect = 3.847e-91
Identity = 177/515 (34.37%), Postives = 287/515 (55.73%), Query Frame = 3
Query: 1425 RWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGK-RLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQ-RADH--KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRL 2951
             W KVGKW            + +    WP  ++      PD   L + T++E PFV           C  N +PCR   K  + ++ G                            + V  CC G  +D+L ++ + + F  DL+ V +GK G      WNG++  ++  +A + + SL I   RSE +DFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E+ SP G +R   + +A H   F++ +++WL+W ++F  +V   NP+G  S+ + ++WA FA++FLASYTANLAAFMI ++    ++G+ D +   PH + P FRF TVP+G+TE N++ N+P M +YM  FN+  V+D + +LKTG++DAFIYD+ VL+YKA +D+ CKL T+G+  ++A TGYG+   KGS W+++I+  +LQ+   G+++  +  W+TG C  ++  +  + +L + N    F +L A M +       EHLF+  LR 
Sbjct:  371 EWEKVGKWE--------NQTLSLRHAVWPRYKSFS-DCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEG----------------------------MNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQRGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKN-EVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHLFYWKLRF 847          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Mouse
Match: Grin2a (glutamate receptor, ionotropic, NMDA2A (epsilon 1) [Source:MGI Symbol;Acc:MGI:95820])

HSP 1 Score: 324.709 bits (831), Expect = 3.847e-91
Identity = 177/515 (34.37%), Postives = 287/515 (55.73%), Query Frame = 3
Query: 1425 RWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGK-RLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQ-RADH--KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRL 2951
             W KVGKW            + +    WP  ++      PD   L + T++E PFV           C  N +PCR   K  + ++ G                            + V  CC G  +D+L ++ + + F  DL+ V +GK G      WNG++  ++  +A + + SL I   RSE +DFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E+ SP G +R   + +A H   F++ +++WL+W ++F  +V   NP+G  S+ + ++WA FA++FLASYTANLAAFMI ++    ++G+ D +   PH + P FRF TVP+G+TE N++ N+P M +YM  FN+  V+D + +LKTG++DAFIYD+ VL+YKA +D+ CKL T+G+  ++A TGYG+   KGS W+++I+  +LQ+   G+++  +  W+TG C  ++  +  + +L + N    F +L A M +       EHLF+  LR 
Sbjct:  371 EWEKVGKWE--------NQTLSLRHAVWPRYKSFS-DCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEG----------------------------MNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQRGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKN-EVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHLFYWKLRF 847          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Mouse
Match: Grin2b (glutamate receptor, ionotropic, NMDA2B (epsilon 2) [Source:MGI Symbol;Acc:MGI:95821])

HSP 1 Score: 321.242 bits (822), Expect = 6.213e-90
Identity = 194/578 (33.56%), Postives = 309/578 (53.46%), Query Frame = 3
Query: 1248 PKGIC-NSNESVWKWGKRLYQIMKSE----TVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLE-NGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDR---GNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLR 2948
            PK  C N++E      KR+YQ          V FE   + F  +G     +L I     +    +W +VGKW       K KS +++    WP     P     +   L + T++E PFV        +G C  N +PC+                        KR   I S N + + P Y+  CC G  +D+L ++ K + F  DL+ V +GK G      WNG++  ++  +A + + SL I   RSE +DFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E+ SP G +R      +     F++ +++WL+W ++F  +V   NP+G  S+ + ++WA FA++FLASYTANLAAFMI ++    +SG+ D +   P+   P FRF TVP+G+TE N++ N+ +M  YM  FN+  VDD + +LKTG++DAFIYD+ VL+Y A +D+ CKL T+G+  ++A TGYG+   K S W+++++  ILQ    G+++  +  W+TG C  ++  +  + +L + N    F +L A M +       EHLF+   R
Sbjct:  317 PKSSCYNTHE------KRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHPKLVII---LLNKERKWERVGKW-------KDKS-LQMKYYVWP--RMCPETEEQEDDHLSIVTLEEAPFVIVESVDPLSGTCMRNTVPCQ------------------------KR---IISENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYLVTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLSLKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAILQLFGDGEMEELEALWLTGICHNEKN-EVMSSQLDIDNMAGVFYMLGAAMALSLITFICEHLFYWQFR 847          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Mouse
Match: Grin2b (glutamate receptor, ionotropic, NMDA2B (epsilon 2) [Source:MGI Symbol;Acc:MGI:95821])

HSP 1 Score: 321.242 bits (822), Expect = 6.213e-90
Identity = 194/578 (33.56%), Postives = 309/578 (53.46%), Query Frame = 3
Query: 1248 PKGIC-NSNESVWKWGKRLYQIMKSE----TVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLE-NGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDR---GNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLR 2948
            PK  C N++E      KR+YQ          V FE   + F  +G     +L I     +    +W +VGKW       K KS +++    WP     P     +   L + T++E PFV        +G C  N +PC+                        KR   I S N + + P Y+  CC G  +D+L ++ K + F  DL+ V +GK G      WNG++  ++  +A + + SL I   RSE +DFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E+ SP G +R      +     F++ +++WL+W ++F  +V   NP+G  S+ + ++WA FA++FLASYTANLAAFMI ++    +SG+ D +   P+   P FRF TVP+G+TE N++ N+ +M  YM  FN+  VDD + +LKTG++DAFIYD+ VL+Y A +D+ CKL T+G+  ++A TGYG+   K S W+++++  ILQ    G+++  +  W+TG C  ++  +  + +L + N    F +L A M +       EHLF+   R
Sbjct:  317 PKSSCYNTHE------KRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHPKLVII---LLNKERKWERVGKW-------KDKS-LQMKYYVWP--RMCPETEEQEDDHLSIVTLEEAPFVIVESVDPLSGTCMRNTVPCQ------------------------KR---IISENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYLVTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLSLKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAILQLFGDGEMEELEALWLTGICHNEKN-EVMSSQLDIDNMAGVFYMLGAAMALSLITFICEHLFYWQFR 847          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. UniProt/SwissProt
Match: sp|P35436|NMDE1_MOUSE (Glutamate receptor ionotropic, NMDA 2A OS=Mus musculus OX=10090 GN=Grin2a PE=1 SV=2)

HSP 1 Score: 324.709 bits (831), Expect = 2.691e-90
Identity = 177/515 (34.37%), Postives = 287/515 (55.73%), Query Frame = 3
Query: 1425 RWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGK-RLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQ-RADH--KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRL 2951
             W KVGKW            + +    WP  ++      PD   L + T++E PFV           C  N +PCR   K  + ++ G                            + V  CC G  +D+L ++ + + F  DL+ V +GK G      WNG++  ++  +A + + SL I   RSE +DFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E+ SP G +R   + +A H   F++ +++WL+W ++F  +V   NP+G  S+ + ++WA FA++FLASYTANLAAFMI ++    ++G+ D +   PH + P FRF TVP+G+TE N++ N+P M +YM  FN+  V+D + +LKTG++DAFIYD+ VL+YKA +D+ CKL T+G+  ++A TGYG+   KGS W+++I+  +LQ+   G+++  +  W+TG C  ++  +  + +L + N    F +L A M +       EHLF+  LR 
Sbjct:  371 EWEKVGKWE--------NQTLSLRHAVWPRYKSFS-DCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEG----------------------------MNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQRGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKN-EVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHLFYWKLRF 847          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. UniProt/SwissProt
Match: sp|B7ZSK1|NMDE1_XENLA (Glutamate receptor ionotropic, NMDA 2A OS=Xenopus laevis OX=8355 GN=grin2a PE=1 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 3.383e-90
Identity = 181/519 (34.87%), Postives = 286/519 (55.11%), Query Frame = 3
Query: 1425 RWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLEN-----GKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADH---KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRL 2951
             W KVGKW   S        + +    WP           D   L + T++E PFV     +EN     G C  N +PCR                       Y R +  ++  +S      V  CC G  +D+L ++ K + F  DL+ V +GK G      WNG++  ++  +A + + SL I   RS  +DFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+FI+E+ SP G +R   Q  D     F++ +++WL+W ++F  +V   NP+G  S+ + +IWA FA++FLASYTANLAAFMI ++    ++G+ D +   PH + P FRF TVP+G+TE N++ N+P M +YM  F++  V D + +LKTG++DAFIYD+ VL+Y A +D+ CKL T+G+  ++A TGYG+   KGS+W++ I+  +LQ+   G+++  ++ W+TG C  ++  +  + +L + N    F +L A M +       EHLF+  LR 
Sbjct:  363 EWEKVGKWENKS--------LNMKYPVWPRITASLDSDHDDN-HLSIVTLEEAPFVI----VENIDYLTGTCVRNTVPCRK----------------------YFRLNNSTTEGTS------VKKCCKGFCIDILKKLSKTVKFTYDLYLVTNGKHGKKIKNVWNGMIGEVVYKRAVMAVGSLTINEERSVAVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLLVSAMAVFIFEYFSPVGYNRNLAQGKDPHGPSFTIGKAVWLLWGLVFNNSVPVQNPKGTTSKIIVSIWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDNKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPDMHQYMVKFHQKGVQDALVSLKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGYIFATTGYGIALQKGSRWKRPIDLALLQFVGDGEMEELEKLWLTGICHTEKN-EVMSSQLDIDNMAGVFYMLAAAMALSLITFVWEHLFYWKLRF 839          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. UniProt/SwissProt
Match: sp|Q00959|NMDE1_RAT (Glutamate receptor ionotropic, NMDA 2A OS=Rattus norvegicus OX=10116 GN=Grin2a PE=1 SV=2)

HSP 1 Score: 324.324 bits (830), Expect = 3.792e-90
Identity = 177/514 (34.44%), Postives = 287/514 (55.84%), Query Frame = 3
Query: 1428 WFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGK-RLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQ-RADH--KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRL 2951
            W KVGKW            + +    WP  ++      PD   L + T++E PFV           C  N +PCR   K  + ++ G                            + V  CC G  +D+L ++ + + F  DL+ V +GK G      WNG++  ++  +A + + SL I   RSE +DFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E+ SP G +R   + +A H   F++ +++WL+W ++F  +V   NP+G  S+ + ++WA FA++FLASYTANLAAFMI ++    ++G+ D +   PH + P FRF TVP+G+TE N++ N+P M +YM  FN+  V+D + +LKTG++DAFIYD+ VL+YKA +D+ CKL T+G+  ++A TGYG+   KGS W+++I+  +LQ+   G+++  +  W+TG C  ++  +  + +L + N    F +L A M +       EHLF+  LR 
Sbjct:  372 WEKVGKWE--------NQTLSLRHAVWPRYKSFS-DCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEG----------------------------MNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTRFNQRGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFASTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKN-EVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHLFYWKLRF 847          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. UniProt/SwissProt
Match: sp|Q12879|NMDE1_HUMAN (Glutamate receptor ionotropic, NMDA 2A OS=Homo sapiens OX=9606 GN=GRIN2A PE=1 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 3.935e-90
Identity = 177/514 (34.44%), Postives = 287/514 (55.84%), Query Frame = 3
Query: 1428 WFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGK-RLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQ-RADH--KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRL 2951
            W KVGKW            + +    WP  ++      PD   L + T++E PFV           C  N +PCR   K  + ++ G                            + V  CC G  +D+L ++ + + F  DL+ V +GK G      WNG++  ++  +A + + SL I   RSE +DFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E+ SP G +R   + +A H   F++ +++WL+W ++F  +V   NP+G  S+ + ++WA FA++FLASYTANLAAFMI ++    ++G+ D +   PH + P FRF TVP+G+TE N++ N+P M +YM  FN+  V+D + +LKTG++DAFIYD+ VL+YKA +D+ CKL T+G+  ++A TGYG+   KGS W+++I+  +LQ+   G+++  +  W+TG C  ++  +  + +L + N    F +L A M +       EHLF+  LR 
Sbjct:  372 WEKVGKWE--------NHTLSLRHAVWPRYKSFS-DCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEG----------------------------MNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKN-EVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHLFYWKLRF 847          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. UniProt/SwissProt
Match: sp|Q5IS45|NMDE1_PANTR (Glutamate receptor ionotropic, NMDA 2A OS=Pan troglodytes OX=9598 GN=GRIN2A PE=2 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 4.199e-90
Identity = 177/514 (34.44%), Postives = 287/514 (55.84%), Query Frame = 3
Query: 1428 WFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGK-RLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQ-RADH--KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRL 2951
            W KVGKW            + +    WP  ++      PD   L + T++E PFV           C  N +PCR   K  + ++ G                            + V  CC G  +D+L ++ + + F  DL+ V +GK G      WNG++  ++  +A + + SL I   RSE +DFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E+ SP G +R   + +A H   F++ +++WL+W ++F  +V   NP+G  S+ + ++WA FA++FLASYTANLAAFMI ++    ++G+ D +   PH + P FRF TVP+G+TE N++ N+P M +YM  FN+  V+D + +LKTG++DAFIYD+ VL+YKA +D+ CKL T+G+  ++A TGYG+   KGS W+++I+  +LQ+   G+++  +  W+TG C  ++  +  + +L + N    F +L A M +       EHLF+  LR 
Sbjct:  372 WEKVGKWE--------NHTLSLRHAVWPRYKSFS-DCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEG----------------------------MNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKN-EVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHLFYWKLRF 847          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. TrEMBL
Match: A0A4E0R4M7 (Glutamate [NMDA] receptor subunit epsilon-2 OS=Fasciola hepatica OX=6192 GN=D915_005905 PE=3 SV=1)

HSP 1 Score: 950.658 bits (2456), Expect = 0.000e+0
Identity = 498/1062 (46.89%), Postives = 700/1062 (65.91%), Query Frame = 3
Query:   96 STRADFDA-SSLIRIRLKAIHFE-NNVANLQKSTIKYEALDEDLQHLIKLMKENPMKSSLDLTFNYEKYFRTNFNPRKMMRMVCKEFQGTRIQP-ITNTLLLVNDDGDEVDKKNADSGLEYFLYLSSIIKIPVITWFPDRSGQMENYANSMALRLEPMNWHIARAFVDFMQAYNWDLVTIVMSSKQREKNTFLKELRNVQKERSNIENNNHFPFTISDVHTFEGLESDELHNCILQ---MHRCRTIKTMLVALERIFKNNDRIVIFLGNKVELVALIAAVRKSNGPXXXXXXXX-XXXXXWICAPSFMNPIETSERSNSIQLDNIVIQNWISKEGMQVSGMFFLACLNHYSIYRKKTEFVRILWQKSLLKLIQFIKERFPSNSTDLKN---------------KIIPKGICNSNESV-WKWGKRLYQIMKSETVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLENGKCDVNAIPCRILQKA-----PDESDAGK-----VYEDDEEEVIYKR----PDTISS---SNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNKSADTL---KXXXXXXXXXXXXXXRLKQENEFLKQKIQKLE 3152
            STR   DA   L+R++++A  F+  N+   +KS+          QHL +LMK  P +  L L   Y +   T +NP  M   VCK+F+G+     +TN++ +VND G  +D+   D     F  ++S + IP ITW P+R GQ+E   + + +RLEP+ WH++ A VDFMQAYNW++  +V ++        ++E+R  ++ER + ++   F F +     FEGL +     C+     +H C  ++ +L  LERI++ + R+++F+GN  +L  L+      +G +    K+L   GY+WI  PS M+ +  ++  +    DN V+Q +      ++ GMF   CLN     ++  E  R +WQK++++L+  + + +P  +    N               K+ P+ +C+ +E + W+WG+R+Y IM+S T  F +E I F  NG +NT+EL+++NS+   G+M+W KVG WSM SKWG+ KS++RIDGVTWPGG N PPKGRP K KLRV TI+E PFV Y ++ ++G CD N++PCR+  ++     P + ++G      +Y  D+      R     DT+ S   ++S+     YV+ CC GLTMDLL E+MKDLNF VDLFEVPDG WG WTP GWNGL++ L+D +AD+ +T+LKITPNRS+Q++FS PFMETGIA+ VALR+GAISPTAFL+PYDY  WCLILVFSVHA GAALF++EWLSP+GLDRG +  + ++FSL RS WLIWSMLFGAAVN DNPRGVASRFL NIWALFALVFLASYTANLAAFMIAK+D+YDLSG+ DWRL  P   KP FRFAT+PSGATEEN+KINFP+M  YM+ FN++TV++G++AL++GE++AFIYD++VL+Y  ++D+ CKL+ VGNLYAMTGYG+GF KG+KW +K+N  IL YQ+ GKLQR K+FW TG C+K   L +TNK LGV NFISAF+LLL GM +CS ILFLEH+  RYLR ++ +T     C ++       +  +P  +K  +     KS  C++    +   RL+ E E L+QK++ L+
Sbjct:  115 STRNKRDALPDLVRVKIQAFVFDVKNIRGNEKSSAA--------QHLRQLMK--PFQHLL-LDPQYSENTITTYNPYAMQYQVCKQFEGSNTNTHMTNSIFVVNDMGAWIDRPLHDRLHRLFFQITSALGIPSITWLPNRVGQLELDESQLTIRLEPLAWHVSHALVDFMQAYNWNIAILVYNTLVPGSTVLVEEIRKRRQERLSQDDPEVFEFDVIHEFQFEGLPATAFTQCVASTENLHPC--VRPLLEILERIWRADARVIVFIGNIYDLHTLLYIADSLDGTEYAHLKVLFDVGYVWIFTPSTMSTLTVADNKDKASSDNNVLQEFTMFR--RIPGMFGFVCLNDLERRKQSAELAREIWQKAMIELVYQLTQIYPPETPVQTNTMNTATLAYFKQILEKLRPEKLCHDSEHLAWQWGRRMYDIMRSLTFTFNNEPISFLPNGGLNTSELYVYNSQISDGQMKWRKVGTWSMKSKWGQGKSRLRIDGVTWPGGANSPPKGRPSKFKLRVVTIKERPFVIYNRQQDDGTCDANSLPCRLRPQSIAHMDPPKQESGSNRVSHLYRSDDVSEPKARKLGPTDTLESNDNTSSTKNHTEYVNGCCTGLTMDLLMELMKDLNFDVDLFEVPDGLWGAWTPDGWNGLIRTLMDREADMAVTALKITPNRSQQVEFSVPFMETGIAVTVALREGAISPTAFLKPYDYQCWCLILVFSVHASGAALFLFEWLSPNGLDRGRMDASGYRFSLFRSFWLIWSMLFGAAVNADNPRGVASRFLVNIWALFALVFLASYTANLAAFMIAKEDYYDLSGMNDWRLQQPWNVKPPFRFATIPSGATEENIKINFPEMGAYMRKFNRSTVEEGLRALRSGELNAFIYDAHVLNYWVSRDEGCKLRIVGNLYAMTGYGIGFAKGNKWLEKVNSRILDYQKNGKLQRWKKFWQTGTCRKDAALGNTNKTLGVKNFISAFLLLLCGMLICSLILFLEHIVHRYLRAQLHRTMDAKLCSII-------VAKQPRNDKEKNQYRSNKSHYCNDPQCLAEMKRLQMEAEQLRQKLEGLQ 1154          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. TrEMBL
Match: A0A4Z2DRV8 (Glutamate receptor ionotropic, NMDA 2A OS=Schistosoma japonicum OX=6182 GN=EWB00_009408 PE=3 SV=1)

HSP 1 Score: 942.184 bits (2434), Expect = 0.000e+0
Identity = 495/997 (49.65%), Postives = 663/997 (66.50%), Query Frame = 3
Query:  126 LIRIRLKAIHFENNVANLQKSTIKYEALD---EDLQHLIKLMKENPMKSSLDLTFNYEKYFRTNFNPRKMMRMVCKEF-QGTRIQPITNTLLLVNDDGDEVDKKNADSGLEYFLYLSSIIKIPVITWFPDRSGQMENYANSMALRLEPMNWHIARAFVDFMQAYNWDLVTIVMSSKQREKNTFLKELRNVQKERSNIENNNHFPFTISDVHTFEGLESDELHNCILQMHRCRTIKTMLVAL----ERIFKNNDRIVIFLGNKVELVALIAAVRKSNGPXXXXXXXX-XXXXXWICAPSFMNPIETSERSNSIQLDNIVIQNWISKEGMQVSGMFFLACLNHYSIYRKKTEFVRILWQKSLLKLIQFIKERFPSNST---DLKN------------KIIPKGIC-NSNESVWKWGKRLYQIMKSETVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLENGKCDVNAIPCRIL-QKAPDESDAGK--------------VYEDDE-----EEVIYKRPDTISSSNSSGKFP---IYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDR 2972
             +R++L+ I F+          +K++  D    D  HL  LMK  P    L L  +Y +   T +NP  M   +CKEF Q      + N+  +VND G  VD+   D     F  ++S + IP ITW P+R GQ E   + +A+RLEP+ WH+ARA VDFM AY W+LV +V ++     +  ++E R +Q ER   ++ N+F F I+    FEGL S E   CI QM   R I+  L+ L    E I++ + R++IF GN  +L  L+      NG K    K L G+ Y+WI  PS M+ +  ++  + +  DN V+    S    ++ GMF L CLN +S  ++  E  R +WQKS+++LI  + + +P + +   D  N            K+ P  +C NS+   W+WG+R+Y IM S  V  ++E I F  NG +N ++LF++NS+   GRM+W+KVG WSMSSK G+TKS++RIDGVTWPGG N PPKGRP K KLRV TI+E+PFV Y K  E G CD N+IPC++  Q   DE  +GK               Y  D       E++ +   T+S  NSS  +    IYV  CC+GLTMDLL E+MKDLNF V+++EV DG WG WTP GWNG+++ L+D KAD+ +TSLKITPNRS+QI+FS PF+ETGIA+ VALR+GAI+PTAFL+PYDY  WC+ILVFSVHA GAAL+IYEW SP+G++RG+ +  +H+FS  RSLWLIWSMLFGAAVN DNPRG+ASRF+ANIWALFALVFLASYTANLAAFMIAK+D++DLSGI DWRL +P   KP FRFAT+P+GATEEN+KINFP+M+KYM+ +NK+ V+DG+KA+K+G++DAF+YD+NVLDY A KD+ CKL+TVGNLYAMTGYG+GF + S+W  K+N  IL YQ+ GKLQR K+FW TG CKK   + +TNK LGV NFISAFILL+ GM +C+  L +E+ F+ Y + K+RK ++
Sbjct:  156 FVRVKLQGIIFD----------VKFQRPDYKSNDGMHLRNLMKPYP---HLLLDPHYTEQVITAYNPLVMQNQICKEFEQYQSSHYVANSFFIVNDIGALVDRPMHDRLHRLFFQIASALGIPSITWLPNRVGQFELDDSQLAIRLEPLTWHVARALVDFMHAYKWNLVIMVYNTLVPGSDVLVEEFRKLQVERGAQDHPNYFEFEINYQFPFEGLTSIEFTECINQM--LREIRPCLIPLVDILESIWRADARVIIFNGNFFDLNTLLYIADSLNGTKHEHLKALFGEDYVWIYTPSTMSSLTVADNQDKVSSDNNVLAE--STMFKKIPGMFGLICLNDHSSRKRSAEIAREVWQKSMIELIYQLTQIYPPDRSIQIDTPNEDTLIYFKQILEKLRPIKLCQNSDHLSWQWGRRMYDIMHSVVVNVDNEPITFLPNGGLNVSKLFVYNSRITDGRMKWYKVGTWSMSSKLGRTKSRLRIDGVTWPGGSNSPPKGRPSKFKLRVVTIKEIPFVIYNKAQEGGTCDANSIPCKLRPQSLQDEDMSGKNPVIHKSLSSLVINSYHKDSNGKVTSEILTRNFTTMSELNSSQVYNNSFIYVDGCCSGLTMDLLMELMKDLNFDVEMYEVMDGYWGAWTPDGWNGIIRDLMDNKADMAVTSLKITPNRSQQIEFSVPFLETGIAVAVALREGAIAPTAFLKPYDYHCWCVILVFSVHATGAALYIYEWFSPNGMNRGHSKDQNHRFSFFRSLWLIWSMLFGAAVNADNPRGMASRFMANIWALFALVFLASYTANLAAFMIAKEDYFDLSGINDWRLQHPWNVKPPFRFATIPNGATEENIKINFPEMYKYMRKYNKSGVEDGLKAMKSGQLDAFLYDANVLDYWAMKDEGCKLRTVGNLYAMTGYGIGFARNSRWLTKVNSRILDYQKNGKLQRWKKFWQTGSCKKDAAVGNTNKTLGVKNFISAFILLVCGMLICTVFLLIEYTFYWYAKPKLRKINQ 1135          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. TrEMBL
Match: A0A3Q0KPC6 (Putative glutamate receptor, NMDA OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 932.939 bits (2410), Expect = 0.000e+0
Identity = 493/994 (49.60%), Postives = 659/994 (66.30%), Query Frame = 3
Query:  225 HLIKLMKENPMKSSLDLTFNYEKYFRTNFNPRKMMRMVCKEF-QGTRIQPITNTLLLVNDDGDEVDKKNADSGLEYFLYLSSIIKIPVITWFPDRSGQMENYANSMALRLEPMNWHIARAFVDFMQAYNWDLVTIVMSSKQREKNTFLKELRNVQKERSNIENNNHFPFTISDVHTFEGLESDELHNCILQMHRCRTIKTMLVAL----ERIFKNNDRIVIFLGNKVELVALIAAVRKSNGPXXXXXXXX-XXXXXWICAPSFMNPIETSERSNSIQLDNIVIQNWISKEGMQVSGMFFLACLNHYSIYRKKTEFVRILWQKSLLKLIQFIKERFPSNST---DLKN------------KIIPKGICN-SNESVWKWGKRLYQIMKSETVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLENGKCDVNAIPCRIL-QKAPDESDAGK--------------VYEDDEEEVIYKRPDTISSS------------NSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNKSADTLK 3059
            HL  LMK  P    L L  +Y +   T +NP  M   +CKEF Q      + N+  +VND G  VD+   D     F  ++S + IP ITW P+R GQ E   + +A+RLEP+ WH+ARA VDFM AY W+LV +V ++     +  ++E R +Q ERS  ++ N+F F I+    FEGL S E   CI QM   R I+  L+ L    E I++ + R++IF GN  +L  L+      NG K    K L G+ Y+WI  PS M+ +  ++  + +  DN V+    S    ++ GMF L CLN +S  R+  E  R +WQKS+++LI  + + +P + +   D  N            K+ P  +C  S+   W+WG+R+Y IM +  V  ++E I F  NG +N ++LFI+NS+ + GRM+W+KVG WSMSSKWG++KS++RIDGVTWPG  N PPKGRP K KLRV TI+E+PFV Y K  E G CD N+IPC++  Q   DE  +GK               Y  D  + I  +P++I+ +            NSS     YV  CC+GLTMDLL E+MKDLNF V+++EV DG WG WTP GWNG+++ L+D +AD+ +TSLKITPNRS+QI+FS PF+ETGIA+ VALR+GAI+PTAFL+PYDY  WC+ILVFSVHA GAAL+IYEW SP+G++RG+    +H+FS  RSLWLIWSMLFGAAVN DNPRG+ASRF+ANIWALFALVFLASYTANLAAFMIAK+D++DLSGI DWRL +P   KP FRFAT+PSGATEEN+KINFP+M+KYM+ +NK+ V+DG+KA+K+G++DAF+YD+NVLDY A KD+ CKL+TVGNLYAMTGYG+GF K S+W  K+N  IL YQ+ GKLQR K+FW TG CKK   + +TNK LGV NFISAFILL+ GM +C+  L +E+ F+ Y + K++K ++      +S++ +    Y P  NK    +K
Sbjct:  191 HLRNLMKPYP---HLLLDPHYAEQVITAYNPLVMQNQICKEFEQNQSSHYVANSFFIVNDIGALVDRPMHDRLHRLFFQITSALGIPSITWLPNRVGQFELDDSQLAIRLEPLTWHVARALVDFMHAYKWNLVIMVYNTLVPGSDVLVEEFRKLQVERSAQDHPNYFEFEINYQFPFEGLTSLEFTECINQM--LREIRPCLIPLINILESIWRADARVIIFNGNFFDLNTLLYIADSLNGTKHEHLKALFGEDYVWIYTPSTMSSLTVADNQDKVSSDNNVLAE--STMFKKIPGMFGLICLNDHSSRRRSAEIAREVWQKSMIELIYQLTQIYPPDKSIQIDTPNRDTLIYFKQILEKLRPVKLCQFSDHLSWQWGRRMYDIMHTIVVNVDNEPISFLPNGGLNVSKLFIYNSRIIDGRMKWYKVGTWSMSSKWGRSKSRLRIDGVTWPGASNSPPKGRPSKFKLRVVTIKEIPFVIYTKAQEGGTCDANSIPCKLRPQSLQDEDISGKNSIIHKTLSSLGLNSYTKDLNKKI--KPESITGNFSNLPELNNVNENSSIS---YVDGCCSGLTMDLLMELMKDLNFDVEMYEVKDGFWGAWTPDGWNGIIRDLMDNRADMAVTSLKITPNRSQQIEFSVPFLETGIAVAVALREGAIAPTAFLKPYDYQCWCVILVFSVHATGAALYIYEWFSPNGMNRGHTTDQNHRFSFFRSLWLIWSMLFGAAVNADNPRGMASRFMANIWALFALVFLASYTANLAAFMIAKEDYFDLSGINDWRLQHPWNVKPPFRFATIPSGATEENIKINFPEMYKYMRKYNKSDVEDGLKAMKSGQLDAFLYDANVLDYWAMKDEGCKLRTVGNLYAMTGYGIGFAKNSRWLTKVNSRILDYQKNGKLQRWKKFWQTGSCKKDAAVGNTNKTLGVKNFISAFILLVCGMLICTVFLLIEYTFYWYAKPKLQKINQANWFGRLSLTENHTC-YLPEQNKQTMNMK 1171          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. TrEMBL
Match: A0A094ZJC6 (Glutamate receptor ionotropic, NMDA 2B (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_02890 PE=3 SV=1)

HSP 1 Score: 930.243 bits (2403), Expect = 0.000e+0
Identity = 486/960 (50.62%), Postives = 645/960 (67.19%), Query Frame = 3
Query:  225 HLIKLMKENPMKSSLDLTFNYEKYFRTNFNPRKMMRMVCKEF-QGTRIQPITNTLLLVNDDGDEVDKKNADSGLEYFLYLSSIIKIPVITWFPDRSGQMENYANSMALRLEPMNWHIARAFVDFMQAYNWDLVTIVMSSKQREKNTFLKELRNVQKERSNIENNNHFPFTISDVHTFEGLESDELHNCILQMHRCRTIKTMLVAL----ERIFKNNDRIVIFLGNKVELVALIAAVRKSNGPXXXXXXXX-XXXXXWICAPSFMNPIETSERSNSIQLDNIVIQNWISKEGMQVSGMFFLACLNHYSIYRKKTEFVRILWQKSLLKLIQFIKERFPSNST---DLKN------------KIIPKGICN-SNESVWKWGKRLYQIMKSETVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLENGKCDVNAIPCRIL-QKAPDESDAGK--------------VYEDDEEEVIYKRPDTISSSNSSGKFPI-------YVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDR 2972
            HL  LMK  P    L L  +Y +   T +NP  M   +CKEF Q      + N+  +VND G  VD+   D     F  ++S + IP ITW P+R GQ E   + +A+RLEP+ WH+ARA VDFM AY W+LV +V +++    +  ++E R +Q ERS  ++ N+F F I+    FEGL S E   CI QM   R I+  L+ L    E I++ + R++IF GN  +L  L+      NG K    K L G+ Y+WI  PS M+ +  ++  + +  DN V+    S    ++ GMF L CLN +S  R+  E  R +WQKS+++LI  + + +P + +   D  N            K+ P  +C  S+   W+WG+R+Y IM +  V  ++E I F  NG +N ++LFI+NS+ + GRM+W+KVG WSMSSKWG++KS++RIDGVTWPG  N PPKGRP K KLRV TI+E+PFV Y K  E G CD N+IPC++  Q   DE  +GK               Y  D  + I     T + SN S  + +       YV  CC+GLTMDLL E+MKDLNF V+++EV DG WG WTP GWNG+++ L+D +AD+ +TSLKITPNRS+QI+FS PF+ETGIA+ VALR+GAI+PTAFL+PYDY  WC+ILVFSVHA GAAL+IYEW SP+G++RG+    +H+FS  RSLWLIWSMLFGAAVN DNPRG+ASRF+ANIWALFALVFLASYTANLAAFMIAK+D++DLSGI DWRL +P   KP FRFAT+PSGATEEN+KINFP+M KYM+ +NK+ V+DG+KA+K+G++DAF+YD+NVLDY A KD+ CKL+TVGNLYAMTGYG+GF K S+W  K+N  IL YQ+ GKLQR K+FW TG CKK   + +TNK LGV NFISAFILL+ GM +C+  L +E+ F+ Y + K++K ++
Sbjct:  106 HLRNLMKPYP---HLLLDPHYAEQVITAYNPLVMQNQICKEFEQNQSSNYVANSFFIVNDIGALVDRPMHDRLHRLFFQITSALGIPSITWLPNRVGQFELDDSQLAIRLEPLTWHVARALVDFMHAYKWNLVIMVYNTQVPGSDVLVEEFRKLQVERSAQDHPNYFEFEINYQFPFEGLTSIEFTECIDQM--LREIRPCLIPLINILESIWRADARVIIFNGNFFDLNTLLYIADSLNGTKHEHLKALFGEDYVWIYTPSTMSSLTVADNQDKVSSDNNVLAE--STMFKKIPGMFGLICLNDHSSRRRSAEIAREVWQKSMIELIYQLTQIYPPDKSIQIDTPNRDTLIYFKQILEKLRPVKLCQFSDHLSWQWGRRMYDIMHTIVVNVDNEPISFLPNGGLNVSKLFIYNSRIIDGRMKWYKVGTWSMSSKWGRSKSRLRIDGVTWPGASNSPPKGRPSKFKLRVVTIKEIPFVIYTKAQEGGTCDANSIPCKLRPQSLQDEDISGKNSIIHKTLSSLGLNSYTKDINKKIKPESLTENVSNLSELYNVNENNSISYVDGCCSGLTMDLLMELMKDLNFDVEMYEVKDGFWGAWTPDGWNGIIRDLMDNRADMAVTSLKITPNRSQQIEFSVPFLETGIAVAVALREGAIAPTAFLKPYDYQCWCVILVFSVHATGAALYIYEWFSPNGMNRGHTTDQNHRFSFFRSLWLIWSMLFGAAVNADNPRGMASRFMANIWALFALVFLASYTANLAAFMIAKEDYFDLSGINDWRLQHPWNVKPPFRFATIPSGATEENIKINFPEMHKYMRKYNKSDVEDGLKAMKSGQLDAFLYDANVLDYWAMKDEGCKLRTVGNLYAMTGYGIGFAKNSRWLTKVNSRILDYQKNGKLQRWKKFWQTGSCKKDAAVGNTNKTLGVKNFISAFILLVCGMLICTVFLLIEYTFYWYAKPKLQKINQ 1058          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. TrEMBL
Match: A0A5K4ES92 (Putative glutamate receptor, NMDA OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 928.702 bits (2399), Expect = 0.000e+0
Identity = 488/978 (49.90%), Postives = 654/978 (66.87%), Query Frame = 3
Query:  225 HLIKLMKENPMKSSLDLTFNYEKYFRTNFNPRKMMRMVCKEF-QGTRIQPITNTLLLVNDDGDEVDKKNADSGLEYFLYLSSIIKIPVITWFPDRSGQMENYANSMALRLEPMNWHIARAFVDFMQAYNWDLVTIVMSSKQREKNTFLKELRNVQKERSNIENNNHFPFTISDVHTFEGLESDELHNCILQMHRCRTIKTMLVAL----ERIFKNNDRIVIFLGNKVELVALIAAVRKSNGPXXXXXXXX-XXXXXWICAPSFMNPIETSERSNSIQLDNIVIQNWISKEGMQVSGMFFLACLNHYSIYRKKTEFVRILWQKSLLKLIQFIKERFPSNST---------------DLKNKIIPKGICN-SNESVWKWGKRLYQIMKSETVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLENGKCDVNAIPCRIL-QKAPDESDAGK--------------VYEDDEEEVIYKRPDTISSS------------NSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDR---YGCCQLVSIS 3002
            HL  LMK  P    L L  +Y +   T +NP  M   +CKEF Q      + N+  +VND G  VD+   D     F  ++S + IP ITW P+R GQ E   + +A+RLEP+ WH+ARA VDFM AY W+LV +V ++     +  ++E R +Q ERS  ++ N+F F I+    FEGL S E   CI QM   R I+  L+ L    E I++ + R++IF GN  +L  L+      NG K    K L G+ Y+WI  PS M+ +  ++  + +  DN V+    S    ++ GMF L CLN +S  R+  E  R +WQKS+++LI  + + +P + +                +  K+ P  +C  S+   W+WG+R+Y IM +  V  ++E I F  NG +N ++LFI+NS+ + GRM+W+KVG WSMSSKWG++KS++RIDGVTWPG  N PPKGRP K KLRV TI+E+PFV Y K  E G CD N+IPC++  Q   DE  +GK               Y  D  + I  +P++I+ +            NSS     YV  CC+GLTMDLL E+MKDLNF V+++EV DG WG WTP GWNG+++ L+D +AD+ +TSLKITPNRS+QI+FS PF+ETGIA+ VALR+GAI+PTAFL+PYDY  WC+ILVFSVHA GAAL+IYEW SP+G++RG+    +H+FS  RSLWLIWSMLFGAAVN DNPRG+ASRF+ANIWALFALVFLASYTANLAAFMIAK+D++DLSGI DWRL +P   KP FRFAT+PSGATEEN+KINFP+M+KYM+ +NK+ V+DG+KA+K+G++DAF+YD+NVLDY A KD+ CKL+TVGNLYAMTGYG+GF K S+W  K+N  IL YQ+ GKLQR K+FW TG CKK   + +TNK LGV NFISAFILL+ GM +C+  L +E+ F+ Y + K++K ++   +G   LV+++
Sbjct:  191 HLRNLMKPYP---HLLLDPHYAEQVITAYNPLVMQNQICKEFEQNQSSHYVANSFFIVNDIGALVDRPMHDRLHRLFFQITSALGIPSITWLPNRVGQFELDDSQLAIRLEPLTWHVARALVDFMHAYKWNLVIMVYNTLVPGSDVLVEEFRKLQVERSAQDHPNYFEFEINYQFPFEGLTSLEFTECINQM--LREIRPCLIPLINILESIWRADARVIIFNGNFFDLNTLLYIADSLNGTKHEHLKALFGEDYVWIYTPSTMSSLTVADNQDKVSSDNNVLAE--STMFKKIPGMFGLICLNDHSSRRRSAEIAREVWQKSMIELIYQLTQIYPPDKSIQIDTPNRDTLIYFKQILEKLRPVKLCQFSDHLSWQWGRRMYDIMHTIVVNVDNEPISFLPNGGLNVSKLFIYNSRIIDGRMKWYKVGTWSMSSKWGRSKSRLRIDGVTWPGASNSPPKGRPSKFKLRVVTIKEIPFVIYTKAQEGGTCDANSIPCKLRPQSLQDEDISGKNSIIHKTLSSLGLNSYTKDLNKKI--KPESITGNFSNLPELNNVNENSSIS---YVDGCCSGLTMDLLMELMKDLNFDVEMYEVKDGFWGAWTPDGWNGIIRDLMDNRADMAVTSLKITPNRSQQIEFSVPFLETGIAVAVALREGAIAPTAFLKPYDYQCWCVILVFSVHATGAALYIYEWFSPNGMNRGHTTDQNHRFSFFRSLWLIWSMLFGAAVNADNPRGMASRFMANIWALFALVFLASYTANLAAFMIAKEDYFDLSGINDWRLQHPWNVKPPFRFATIPSGATEENIKINFPEMYKYMRKYNKSDVEDGLKAMKSGQLDAFLYDANVLDYWAMKDEGCKLRTVGNLYAMTGYGIGFAKNSRWLTKVNSRILDYQKNGKLQRWKKFWQTGSCKKDAAVGNTNKTLGVKNFISAFILLVCGMLICTVFLLIEYTFYWYAKPKLQKINQANWFGRLSLVNLN 1156          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Cavefish
Match: grin2ca (glutamate receptor ionotropic, NMDA 2C-like [Source:NCBI gene;Acc:103025257])

HSP 1 Score: 324.324 bits (830), Expect = 2.810e-91
Identity = 202/603 (33.50%), Postives = 324/603 (53.73%), Query Frame = 3
Query: 1194 FIKER--FPSNSTDLKNKIIPKGICNSNESVWKWGKRLYQIMKSETVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWP--GGENKPPKGRPDKVKLRVATIQEMPFVFY-GKRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADH---KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDR 2972
            F K+R   P   TD +  + P    ++N++       L+  M + T E  D    F+S+G +    + I    T+    +W KVG++            +++    WP  G   +P     D   L VAT++E PFV         G C  N +PCR               + ++ E I             G    Y   CC G  +D+L ++ +++ F  DL+ V +GK G      WNG++  ++  +AD+ + SL I   RSE IDFS PF+ETGI+++VA   G +SP+AFLEPY    W ++ V  +      +F++E+ SP G +R  +   D     F++ +S+WL+W ++F  +V  +NP+G  S+ +  +WA FA++FLASYTANLAAFMI +     +SG+ D +   P    P FRF TVP+G+TE N++ N+P+M  +M  +N+  V+D + +LKTG++DAFIYD+ VL+Y A KD+ CKL T+G+  ++A TGYG+   KGS+W++ I+  +LQ+   G  Q+ +  W+TG C+ ++  +  + +L + N    F +LL  M +   +   EHL +  LR  VR+++R
Sbjct:  317 FRKQRGFVPDGHTDCQTPLRP----DTNDT-------LFTHMLNVTWEHTD--FSFNSDGYLVNPAMIII---TLDRERQWDKVGRYE--------SGILQMRYPVWPRYGTYLEPVS---DNRHLTVATLEERPFVIVEAVDPVTGTCLSNTVPCR--------------RQSNKTETII------------GHTEPYTKLCCKGFCIDILKKLSRNIKFSYDLYLVTNGKHGKLVRGVWNGMIGEVVYKRADMAIGSLTINEERSEIIDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVTVFVFEYCSPVGYNRSLVSAKDPGGPTFTIGKSVWLLWGIVFNNSVPIENPKGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTVSGLSDKKFQKPQEQYPPFRFGTVPNGSTERNIRSNYPEMHSHMVKYNQKGVEDALNSLKTGKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIALQKGSRWKRPIDLALLQFLADGDTQKLQTVWLTGICRNEKK-EVMSSKLDIDNMAGVFYMLLVAMGLSLLVFAWEHLLYWKLRHSVRRSER 865          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Cavefish
Match: grin2aa (glutamate receptor, ionotropic, N-methyl D-aspartate 2A, a [Source:ZFIN;Acc:ZDB-GENE-070424-129])

HSP 1 Score: 318.546 bits (815), Expect = 8.557e-90
Identity = 171/513 (33.33%), Postives = 279/513 (54.39%), Query Frame = 3
Query: 1425 RWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYG--KRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADH---KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLR 2948
             W K+GKW   S        + +    WP   N       D   L + T++E PFV     +RL  G C  N++PCR   K                             N++     Y+  CC G  +D+L ++ +++ F  DL+ V +GK G      WNG+V  ++  KA + + SL I   RSE IDFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E++SP G +R   Q  D     F++ +++WL+W ++F  +V   NP+G  S+F+ ++WA FA++FLASYTANLAAFMI ++    ++G+ D +  +P+++ P FRF TVP+G+TE N++ N+P M +YM  +++T V+D + +LKTG++DAFIYD+ ++   +           G ++A TGYG+   KGS W+++++  IL     G+++  +  W+TG C  ++  +  + +L V N    F +L   M +       EHLF+  LR
Sbjct:  214 EWEKMGKWENRS--------LTLKYPVWPRF-NSFGDAETDDNHLTIVTLEEKPFVIVEDVERL-TGTCMRNSVPCRKHIK----------------------------DNTTEGGGTYIKKCCKGFCIDILKKIARNVKFTYDLYLVTNGKHGKKINNVWNGMVGEVVYKKAVMAVGSLTINEERSEVIDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLLVTAMAVFMFEYISPLGFNRNLAQGKDPHGPSFTMGKAVWLLWGLVFNNSVPVQNPKGTTSKFIVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDNKFQSPYSYSPPFRFGTVPNGSTERNIRKNYPDMHQYMVKYHQTGVNDALVSLKTGKLDAFIYDAALVTIGS-----------GYIFATTGYGIALQKGSAWKRQVDLAILAIIGDGEMEELEAQWLTGICHNEKN-EVMSSQLDVDNMAGVFYMLATAMGLSLITFVWEHLFYWRLR 676          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Cavefish
Match: grin2ab (glutamate receptor, ionotropic, N-methyl D-aspartate 2A, b [Source:ZFIN;Acc:ZDB-GENE-070424-223])

HSP 1 Score: 318.161 bits (814), Expect = 3.575e-89
Identity = 172/474 (36.29%), Postives = 274/474 (57.81%), Query Frame = 3
Query: 1545 DKVKLRVATIQEMPFVFYGK-RLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADH---KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLR 2948
            D+  L + T++E PFV      +  G C  N++PCR  +   D +  G                             YV  CC G  +D+L ++ +++ F  DL+ V +GK G      WNG+V  ++  KA + + SL I   RSE IDFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E++SP G +R   Q  D     F++ +++WL+W ++F  +V   NPRG  S+F+ ++WA FA++FLASYTANLAAFMI ++    ++G+ D +  +P++  P FRF TVP+G+TE N++ N+P M +YM  +++T V D + +LKTG++DAFIYD+ VL+Y A +D  CKL T+G+  ++A TGYG+   KGS W++ ++  IL     G+++  +  W+TG C  ++  +  + +L V N    F +L A M +       EHLF+  LR
Sbjct:  379 DENHLSIVTLEEKPFVIVDDVDILTGTCMRNSVPCR--KHIKDNTTGGS----------------------------YVKQCCKGFCIDILKKIARNVKFTYDLYLVTNGKHGKKINNVWNGMVGEVVYKKAVMAVGSLTINEERSEVIDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVTAIAVFLFEFISPLGFNRNLAQGKDPHGPSFTIGKAVWLLWGLVFNNSVPVQNPRGTTSKFIVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDRKFQSPYSFSPPFRFGTVPNGSTERNIRKNYPDMHQYMVKYHQTGVQDALVSLKTGKLDAFIYDAAVLNYMAGRDDGCKLVTIGSGYIFATTGYGIALQKGSYWKRLVDLAILGIIGDGEMEELEAQWLTGICHNEKN-EVMSSQLDVDNMAGVFYMLAAAMALSLITFAWEHLFYWRLR 821          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Cavefish
Match: grin2cb (glutamate receptor ionotropic, NMDA 2C [Source:NCBI gene;Acc:103046826])

HSP 1 Score: 315.849 bits (808), Expect = 1.080e-88
Identity = 177/508 (34.84%), Postives = 281/508 (55.31%), Query Frame = 3
Query: 1545 DKVKLRVATIQEMPFVFY-GKRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQR---ADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNKSAD 3050
            D   L VAT++E PFV         G C  N +PCR               + ++ E ++            G    Y   CC G  +D+L ++ + + F  DL+ V +GK G      WNG++  +   +AD+ + SL I   RSE IDFS PF+ETGI+++VA   G +SP+AFLEPY    W ++ V  +      +F++E+ SP G +R  +         F++ +S+WL+W ++F  +V  +NP+G  S+ +  +WA FA++FLASYTANLAAFMI +     +SG+ D +   P  H P FRF TVP+G+TE N++ N+P M  +M  +N+  V++ + +LKTG++DAFIYD+ VL+Y A KD+ CKL T+G+  ++A TGYG+   K S+W++ I+  +LQ+   G  QR +  W++G C+ ++  +  + +L + N    F +LL  M +   +   EHL +  LR  V K++R      +S  +    N    V +S +
Sbjct:  406 DNRHLTVATLEERPFVIVESVDPATGTCVRNTVPCR--------------RQANKTEAVF------------GHSEPYTKLCCKGFCIDILKKLSRTIKFSYDLYLVTNGKHGKLVRGTWNGMIGEVFYKRADMAIGSLTINEERSEIIDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVTVFVFEYFSPVGYNRSLVSAKAPGGPTFTIGKSVWLLWGIVFNNSVPIENPKGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTVSGLSDKKFQKPQEHYPPFRFGTVPNGSTERNIRSNYPDMHTHMMKYNQKGVEEALNSLKTGKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIALQKDSRWKRPIDLALLQFLGDGDTQRLETVWLSGICQNEKN-EVMSSKLDIDNMAGVFYMLLVAMGLSLLVFAWEHLLYWKLRHSVHKSERLDFLLAISRGIYSCFNGVEDVGRSGN 886          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Cavefish
Match: grin2bb (glutamate receptor, ionotropic, N-methyl D-aspartate 2B, genome duplicate b [Source:ZFIN;Acc:ZDB-GENE-061207-27])

HSP 1 Score: 314.309 bits (804), Expect = 8.915e-88
Identity = 181/548 (33.03%), Postives = 292/548 (53.28%), Query Frame = 3
Query: 1326 VEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLE-NGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDR---GNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRL 2951
            V FE   + F  +G     +L I     +    +W +VGKW   S        + +    WP  E        +   L + T++E PFV        +G C  N +PCR                             + + N +G   IY+  CC G  +D+L ++ K + F  DL+ V +GK G      WNG+V  ++   A + + SL I   RSE IDFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E+ SP G +R      +     F++ +++WL+W ++F  +V   NP+G  S+ + ++WA FA++FLASYTANLAAFMI ++    ++G+ D +   P+   P FRF TVP+G+TE N++ N+ +M  YM +F++  V++ + +LKTG++DAFIYD+ VL+Y A +D+ CKL T+G+  ++A TGYG+   K S W++ ++  ILQ    G+++  +  W+TG C  ++  +  + +L V N    F +L A M +       EHLF+  LR 
Sbjct:  295 VTFEGRNLSFSEDGYQMHPKLVII---LLDKERQWDRVGKWENGS--------LTMKYHVWPRFELYSDAEEREDDHLSIVTLEEAPFVIVEDVDPLSGTCMRNTVPCR---------------------------KQLKTQNQTGDSGIYIKRCCKGFCIDILKKIAKTVKFTYDLYLVTNGKHGKKINGTWNGMVGEVVFKNAHMAVGSLTINEERSEVIDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVTGLSDKKFQRPNDFSPPFRFGTVPNGSTERNIRNNYKEMHSYMTSFHQKNVNEALHSLKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGYIFATTGYGIAIQKDSGWKRAVDLAILQLFGDGEMEELEALWLTGICHNEKN-EVMSSQLDVDNMAGVFYMLGAAMALSLITFIAEHLFYWQLRF 803          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010716.1 (pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1 gene:ENSPMAG00000009705.1 transcript:ENSPMAT00000010716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 315.464 bits (807), Expect = 2.309e-92
Identity = 161/428 (37.62%), Postives = 262/428 (61.21%), Query Frame = 3
Query: 1773 YVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDR---GNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLR--LKVRKTDRYGCCQLVS-ISLSQMMNYEPT 3032
            YV  CC G  +D+L ++ K + F  DL+ V +GK G      WNG++  +++ +A + + SL I   RSE +DFS PF+ETGI+++V    G +SP+AFLEP+    W ++ +  +   G A+FI+E+ SP G +R      +     F++ +S+WL+W+++F  +V  +NPRG  S+F+ ++WA FA++FLASYTANLAAFMI +D    +SG+ D +  +P  H P FRF TVP+G+TE N++ N+ +M  YM  F++ +V+D + +LK G++DAFIYD+ VL+Y A KD+ C+L T+G+  ++  TGYG+   K S+W++ I+  +LQ+   G++   +  W+TG C  +R  D  + +L + N    F +LL  M +   +   EH F+   R  +K ++ D  G    +S +SL    +  P+
Sbjct:  391 YVKKCCKGFCIDILKKLSKTVKFTYDLYLVTNGKHGSKINGVWNGMIGEVVNMRAHMAVGSLTINEERSEVVDFSVPFVETGISVMVPRSNGTVSPSAFLEPFSADVWVMMFILCLLVSGIAVFIFEYFSPVGYNRQLSAGKEFGGPAFTIGKSIWLLWAIVFNNSVPVENPRGTTSKFMVSVWAFFAVIFLASYTANLAAFMIQEDYIDQVSGLSDKKFQSPLEHSPPFRFGTVPNGSTERNIRNNYLQMHGYMSKFHQKSVEDALMSLKAGKLDAFIYDAAVLNYMAGKDEGCRLVTIGSGKVFVATGYGIALQKSSRWKRAIDLALLQFIGDGEMDELEMIWLTGICHGERN-DVMSSQLDIDNMAGVFYMLLVAMGLSFIVFVCEHFFYHVGRHCVKNKENDEPGLLYSISRVSLGSNTSRPPS 817          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000889.1 (pep scaffold:Pmarinus_7.0:GL476542:184998:205948:1 gene:ENSPMAG00000000813.1 transcript:ENSPMAT00000000889.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.168 bits (300), Expect = 9.064e-31
Identity = 66/217 (30.41%), Postives = 109/217 (50.23%), Query Frame = 3
Query: 1545 DKVKLRVATIQEMPFVFYGKRLEN-----GKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDR 2180
            D+  L + T++E PFV     +EN     G C  + + CR                             I+ +++SG    YV  CC G  +D+L ++   + F  DL+ V +GK G      WNG+V  +   +A + + SL I   RS+ +DFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ +  +     A++++E+LSP G +R
Sbjct:   32 DERHLSIVTLEERPFVI----VENVDALTGTCMRSTVACR---------------------------QEINMTDTSGDKSPYVKRCCKGFCIDILRKLSTTVRFTYDLYLVVNGKHGKKIQGVWNGMVGEVEQKRAHMAVGSLTINEERSQVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSAAVWVMMFILCLMLSAIAVWLFEYLSPVGFNR 217          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Sea Lamprey
Match: gria1b (glutamate receptor, ionotropic, AMPA 1b [Source:ZFIN;Acc:ZDB-GENE-020125-2])

HSP 1 Score: 126.331 bits (316), Expect = 1.941e-30
Identity = 112/427 (26.23%), Postives = 186/427 (43.56%), Query Frame = 3
Query: 1794 GLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTP--QGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVAL-RKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRAD-------------------------------HKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEE---NVKIN-FPKMFKYMQN-----FNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWM--TGQCKKQRTLDSTNKR--LGVTNFISAFILLLAGMFVCSTILFLEHLF 2933
            G  +DL  E+     F      VPDG +G   P  + WNG+V  L+ G+AD+ +  L I+  R E IDFS PFM  GI+I++   +K      +FL+P  Y  W + ++F+       LF+    SP+   R +    +                               ++F +  SLW              +PR ++ R +  +W  F L+ ++SYTANLAAF+  +     +    D   +   T      + T+ SG+T+E     KI  + KM+ +M++     F +T  D   +  K+    A++ +S   +Y   +     +K  GNL +  GYG+  PKGS  R  +N  +L+    G L + K  W    G+C      DS +K   L ++N    F +L+ G+ +   +  +E  +
Sbjct:   61 GYCVDLGQEIAIHEQFEYKWSVVPDGAYGARNPDTKVWNGMVGELVYGRADIAIAPLTISLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVISFLDPLAYEIW-MCIIFAYIGVSVVLFLVSRFSPYEWQRDDDTDVEPNGNGGAGGGGGGGGSGGGAGGGSGGGGEPPNEFGIFNSLWFSLGAFMQQGCEI-SPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADD---LAKQTE---IAYGTLDSGSTKEFFQRSKIGVYEKMWLFMKDAEPKVFVRTNADGVSRVRKSKGKYAYLLESTTNEYTEQRKPCDTMKVGGNLDS-KGYGIATPKGSALRDAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGG-DSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCY 477          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005084.1 (pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 gene:ENSPMAG00000004612.1 transcript:ENSPMAT00000005084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.931 bits (289), Expect = 2.869e-28
Identity = 96/337 (28.49%), Postives = 152/337 (45.10%), Query Frame = 3
Query: 1932 KADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPT--AFLEPYDYPSWCLILVFSVHACGAALFI------YEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVK----INFPKMFKYMQNFNKTTV---DDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQ-CKKQRTLDSTNKRLGVTNFISAFILLLAGM 2894
            KADL +  L I   R + IDFS PFM  GI+I+     G  +P   +FL P     W  IL+ +       LF+      YEW +PH  +  +    ++ F+++ S W     L         P+ +++R +  IW  F L+ ++SYTANLAAF+  +     +S   D         +    +  V  G+T    K      + KM+ +M +     +   ++GI+ + T +    +  +N+           +   +G L    GYG+G P GS +R KI   ILQ Q  GKL   K  W  G  C ++ + +++   LGV N    FI+L AG+
Sbjct:    9 KADLAVAPLTINYMREKAIDFSKPFMTLGISILYRKPNGT-NPGIFSFLNPLSPDIWMYILL-AYLGVSCVLFVIARFSPYEWYNPHPCNPDS-DVVENNFTMLNSFWFGVGALMQQGSEL-MPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPISSADD------LAKQTRIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQTALIKNNEEGIQRVLTTDYAMLMESTNIEYVTQRNCNLTQ---IGGLIDNKGYGIGTPLGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDSNEAS--ALGVQNIGGIFIVLAAGL 330          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000779.1 (pep scaffold:Pmarinus_7.0:GL482437:4504:14157:1 gene:ENSPMAG00000000712.1 transcript:ENSPMAT00000000779.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.9593 bits (206), Expect = 6.882e-17
Identity = 59/187 (31.55%), Postives = 91/187 (48.66%), Query Frame = 3
Query: 1899 WNGLVKVLLDGKADLVMTSLKIT-PNRSEQIDFSAPFMETGIAIIVALRKGAISPT-AFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADH-------------KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKD 2414
            W   +  L  G ADL +T+L    P+ +  ++F+APF+ + ++I VA R+    P  AF  P  +  W  + V ++HA    L ++E  +P       +  +                FSL  +L L +S+LFG  V    PR  +SRFL  +WA+F L+    YTANLAA ++      +L GI D
Sbjct:  318 WAWPLSELSSGAADLAVTALGAGGPHAAPPLEFTAPFLSSSLSIAVARRQEGRHPLGAFALPLHWTVWVGVFV-ALHAIALFLTLFECRTPRADGEAPVGTSGSAAAAAGTPAKARGSFSLAAALGLCYSVLFGRNVARGAPRCWSSRFLVGLWAMFCLLCFCIYTANLAAMLVGGRSRDELMGIHD 503          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Nematostella
Match: EDO44842 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUE9])

HSP 1 Score: 212.231 bits (539), Expect = 4.610e-61
Identity = 117/328 (35.67%), Postives = 191/328 (58.23%), Query Frame = 3
Query: 1785 CCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGE---IDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQR 2759
            CC GL +DL+  + +D+ F+  +  +  G+ G +    W GL+  ++ G AD+ M+S+ IT  RS+ +DFS PF+ TG  I+VA R G+     FL+P+   +W LI    ++     + ++E  +P GL R   +    +F + +S+WL++S  F   +N   PR V+SR + + W+   L+  A YTANLAAFM+ +D  + + GI D R+ NP     + +F T+   + E+  KINFP ++ +M+N+      +G++A+K G    IDAFI++S  ++   A D +C L TVG L+  +G+   FPKGS W + I+D IL+YQ+
Sbjct:    2 CCYGLCIDLIKLLSRDIGFIPVIETIQGGRAGSFKNGKWTGLIGEVVAGNADMAMSSISITSQRSKFVDFSEPFIHTGSTILVAKRHGSFKGDGFLKPFKVSAWLLIFA-VLYLVAVVVLLFESHNP-GLQRQKHRNYRGEFDIHQSVWLMFSRFFSGILNAPIPRFVSSRVVLSSWSFATLMIDALYTANLAAFMVLQDQAHYIDGINDSRIQNPLA--SVLKFTTIRDTSVEKYFKINFPHVYSFMRNYRFNHSSEGVRAVKEGYVIVIDAFIWESATMERYVANDTRCSLLTVGKLFDTSGFAAAFPKGSPWTRNISDFILKYQQ 325          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Nematostella
Match: EDO35545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL56])

HSP 1 Score: 214.542 bits (545), Expect = 2.941e-57
Identity = 145/496 (29.23%), Postives = 235/496 (47.38%), Query Frame = 3
Query: 1494 DGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLENGKC---DVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWG------GWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHG-LDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVK--INFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWM-TGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRY 2942
            + + WPG  N  P G      LRV T+   PFV+      +G+C   D N     +      ++D+G                                       MDLL  + + +NF   +    DG +G      G   + WNG+V  ++ GKADL++ +L I   R+E I+FS PF   G+ I+V   + + S  +FL P+    W L+L+ SVH     L++ +  SP G       ++ +   +L  ++W  W +L  + +    PR  ++R L  +WA FA++ +ASYTANLAAF++       +SGI D  L NP      F +ATV + + +   +  +    M+ +M+ +N  T  +GI+ +K GE+ AFI+DS V        K C L T G L+  +GYG+G PKGS W   I+  IL +   G ++  +  W+   +C  + T  +T   LG+ + +  FI++ AG+     I+ LE L+ ++
Sbjct:  375 ESIIWPGNLNTTPTGVFLSNHLRVVTLVGEPFVYVKPIPTSGRCSDLDTNTAKHVLCTGTVSDTDSG-------------------------------------FCMDLLIRLGEKVNFTYSVSLSEDGSYGSLRRVNGSDTKQWNGMVGEVIQGKADLIVAALTINNERAEWIEFSKPFKYQGLTILVKKNEQSNSLDSFLRPFQIHLWLLVLL-SVHIVAVILYLLDRFSPFGRFKLARKEKEETALNLSSAMWFSWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPKAVVSGIDDPNLRNPSKQ---FIYATVANSSVDAYFRRQVELSSMYTFMEGYNVKTAKEGIEKVKNGELKAFIWDSPV--LYYEASKDCTLTTAGELFGRSGYGIGMPKGSPWSNAISLAILNFHESGVMEELETTWIDASKCNTENTSPAT---LGLQHMLGVFIMVAAGIGAGIVIIILEILYHKH 824          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Nematostella
Match: EDO34363 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPJ5])

HSP 1 Score: 155.606 bits (392), Expect = 4.594e-41
Identity = 105/388 (27.06%), Postives = 189/388 (48.71%), Query Frame = 3
Query: 1785 CCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQG--WNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRK--GAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKIN----FPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLE 2924
            C +G  ++LL  + + ++F  + + + D K+G   P    WNG+V  ++ G+AD+ + +L IT +RS  IDFS+P+ E GI I+       G++    F+ P     W +IL   +        + +W          I     + SL+ S+   WS        T  P   ++R +A  +AL  L+   SYTA LAAF + +     +SGI+D ++ NP    P F+FAT+   +TE   + +      +++++M++ N   V+DG+  L +GE   +I D   L++  +    C L+ +G  + ++GYG+   K S W + I++ I++      L+     W+  +C  Q     +   L + N    F+++ AG  +C+  L +E
Sbjct:    1 CISGQMIELLELIREYVHFTYEFYLIRDHKYGSVDPVTGLWNGMVGDIITGEADMALATLTITASRSRVIDFSSPYGEVGIGILARTDTTLGSVVNMDFMIPLSSQLWTVILATILFVIIVLWVLGDWEWYLKGRSHFIPDYKRRVSLLESMTYSWSTFVHVQAGTGLPMSTSARLVALFFALAMLIVNTSYTAELAAFKVKEQFVPPISGIEDPKMQNP---PPDFKFATLRDSSTEAYFRFSKDEKLRRIYEHMKDNNVEMVEDGVAKLISGEFKLYIDDQPYLEHLVSSSGNCMLRMIGRPFGISGYGIALAKNSPWTRPISNAIIKLNDMKALENLWSKWLKRKCVTQDEFGKSPSGLSIENVNGLFVVVCAGFAMCALFLGIE 385          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Nematostella
Match: EDO30203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1G4])

HSP 1 Score: 147.517 bits (371), Expect = 5.025e-36
Identity = 115/423 (27.19%), Postives = 207/423 (48.94%), Query Frame = 3
Query: 1740 SSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTP--QGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKG-AISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHK-----------FSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAK---------DDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALK--TGEIDAFIYDSNVXXXXXXXXXX-XXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTG--QCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLE 2924
            + +N  G+  + +   C    ++LL ++ + L F  +++ VPD  +G   P  + WNG+V+ +L+G+ADL +TSL I+P R + IDF+ P+M+ G+ +++        +P A L P+ Y  W + +  ++   G  L+++   SP G     +Q+   K            SLVR+LW       G + +  +P   + R    ++    L+ +++YTANLAAF+  K         DD      I    ++N    +  F  A+VPS          F  M++YM+ ++ T V++  + ++    E  AFI+DS VL++ A        L T G+++   GYG G  K S + +++++ ILQ +  G ++   R W+    +C +      +  +L   +    FI+L+AG+ V   +L LE
Sbjct:  461 TQTNGQGETRVIIEGYC----IELLRKLSEMLRFKFEVYLVPDNNFGAQDPVTKEWNGVVREVLNGRADLAVTSLTISPERQKVIDFTQPYMDLGLTVLIKPDPTEEKNPFAILRPFRYDLW-MAIGGTMIIVGFFLWLFSTFSPFGFYGRCVQKCHTKIEPRYLKLHDTLSLVRALWSTVVYYVGQSSDHLHPVSSSGRITVAVYWFAMLIVMSTYTANLAAFLTIKRFTSPISSVDDLARQKDISYGTVLNSQP-QAFFESASVPS----------FVTMWQYMR-YHHTFVNNSAEGIEKVMNENYAFIWDSAVLEFVAHNQISCGTLITSGSVFGRIGYGFGLAKDSPYTKQLSNAILQLRHAGYMEFLDRKWLKANDKCAEAAEKAKSENQLTFEDLSGVFIVLIAGIGVSCVVLVLE 866          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Nematostella
Match: EDO47825 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLA0])

HSP 1 Score: 144.821 bits (364), Expect = 5.032e-35
Identity = 101/387 (26.10%), Postives = 187/387 (48.32%), Query Frame = 3
Query: 1785 CCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGG-WTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIV-ALRKGAISPTA---FLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHG-------LDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDN-PRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPI-FRFATVPSGATEENVKINFPKMFKYMQNFNKTT-----VDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRF-WMTGQCKKQRTLDSTNKRLGVTNFISAFILLL 2885
            CC G  +DL+  + +DLNF  +++ VPDGKWG       WNGL+  L+ GK D +   L I+  R   ++F+ P+    + I+V  +    ++P     F +P+ +  W +++  S +     ++  + +SP G       L +GN    D+ F+L+ S+  +W + F   +  +N PRG ++RF++  +A  AL+ + +Y ANL AF++  +    +SG++D +L++   + P  F+   V     E   K +  K  + + N N        +++G   L+ G++D  + D  V     A    CK   +   +   G    FPKGS W  +    +L+ Q  G L + ++  +    C+KQ       ++ G+ +F   F+ ++
Sbjct:  468 CCVGTQIDLIKLLERDLNFNAEIYFVPDGKWGTQLASDEWNGLMNELVTGKGD-ITAFLGISSQRLADVEFTQPYFTLQLTILVKTINASELNPQIHWNFQDPFHWDLWVMVIA-SCNIVLVVIWALDRMSPRGHRRRLKILQQGNAP-VDNGFTLLDSMSYVWGVAFSKDIGAENTPRGPSARFVSIFFAFMALILVNTYCANLTAFLLEDNVVLPISGVEDRKLLDTSLYPPDGFQLGVVQGSFEEAFFKNHNKKELQLLYNVNIKINLVKGMNEGFDLLQKGKLDGLVGDE-VSLQSQANVDDCKFSLIKKSFYNLGVAFAFPKGSPWASEATLSVLKNQENGTLDQIRKLRFPKNTCQKQSV-----RKFGIADFSGLFVTVV 845          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Medaka
Match: grin2ca (glutamate ionotropic receptor NMDA type subunit 2C [Source:NCBI gene;Acc:101159589])

HSP 1 Score: 329.717 bits (844), Expect = 3.477e-93
Identity = 205/610 (33.61%), Postives = 323/610 (52.95%), Query Frame = 3
Query: 1176 LLKLIQ-FIKER--FPSNSTDLKNKIIPKGICNSNESVWKWGKRLYQIMKSETVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWP--GGENKPPKGRPDKVKLRVATIQEMPFVFY-GKRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADH---KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDR 2972
            ++K +Q F KER   P   +D  N + P  I ++          L++ M + T E  D    F+SNG +    + I    T+    +W KVG + +          +++    WP  G   +P     D   L VAT++E PFV         G C  N +PCR               + ++ E I             G    Y   CC G  +D+L ++ + + F  DL+ V +GK G      WNG++  +   +AD+ + SL I   RSE IDFS PF+ETGI+++VA   G +SP+AFLEPY    W ++ V  +      +F++E+ SP G +R  +   D     F++ +S+WL+W ++F  +V  +NP+G  S+ +  +WA FA++FLASYTANLAAFMI +     +SG+ D +   P    P FRF TVP+G+TE N++ N+P+M  +M  +N+  V+D + +LKTG++DAFIYD+ VL+Y A KD+ CKL T+G+  ++A TGYG+   K S W++ I+  +LQ+   G  Q+ +  W+TG C+ ++  +  + +L + N    F +LL  M +   +   EHL +  LR   RK++R
Sbjct:  306 VVKGVQSFRKERGFIPEGHSDCHNPVKPSVINDT----------LFRHMLNVTWEHND--FSFNSNGYLVNPAMIII---TLDRERQWDKVGTYEVG--------ILQMRYPVWPRFGSYLEPVS---DYRHLTVATLEERPFVIVEAVDPATGTCVSNTVPCR--------------RQSNKTETIV------------GHTEPYTKLCCKGFCIDILKKLARTIKFSYDLYLVTNGKHGKLVRGIWNGMIGEVFYKRADMAIGSLTINEERSEIIDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFVFEYCSPVGYNRSLVTAKDPGGPTFTIGKSVWLLWGIVFNNSVPIENPKGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTVSGLSDKKFQKPQEQYPPFRFGTVPNGSTERNIRSNYPEMHAHMVKYNQKGVEDALNSLKTGKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIALQKDSSWKRPIDLALLQFLADGDTQKLQTVWLTGICRNEKK-EVMSSKLDIDNMAGVFYMLLVAMGLSLLVFAWEHLLYWKLRHSDRKSER 862          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Medaka
Match: grin2aa (glutamate ionotropic receptor NMDA type subunit 2A [Source:NCBI gene;Acc:101161811])

HSP 1 Score: 321.242 bits (822), Expect = 5.456e-90
Identity = 175/475 (36.84%), Postives = 277/475 (58.32%), Query Frame = 3
Query: 1545 DKVKLRVATIQEMPFVFYG--KRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADH---KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLR 2948
            D   L + T++E PFV     +RL  G C  N++PCR   K  + ++AG  Y                           +  CC G  +D+L ++ K + F  DL+ V +GK G      WNG+V  ++  KA + + SL I   RSE IDFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E++SP G +R   Q  D     F++ +++WL+W ++F  +V   NP+G  S+F+ ++WA FA++FLASYTANLAAFMI ++    ++G+ D +  NPH + P FRF TVP+G+TE N++ N+P M +YM  +++T V D + +LKTG++DAFIYD+ VL+Y A +D+ CKL T+G+  ++A TGYG+   KGS W+++++  IL     G+++  +  W+TG C  ++  +  + +L V N    F +L   M +       EHLF+  LR
Sbjct:  421 DDNHLSIVTLEEKPFVIVEDVERL-TGTCMRNSVPCRKHIKD-NTTEAGGTY---------------------------IKKCCKGFCIDILKKIAKYVKFTYDLYLVTNGKHGKKINNVWNGMVGEVVYKKAVMAVGSLTINEERSEVIDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLLVTAMAVFMFEYISPLGFNRNLAQGKDPHGPSFTMGKAVWLLWGLVFNNSVPVQNPKGTTSKFIVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDNKFQNPHAYSPPFRFGTVPNGSTERNIRKNYPAMHQYMVKYHQTGVVDALVSLKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGYIFATTGYGIALQKGSYWKRQVDLAILAIIGDGEMEELEAQWLTGICHNEKN-EVMSSQLDVDNMAGVFYMLATAMGLSLITFISEHLFYWRLR 865          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Medaka
Match: ENSORLT00000040618.1 (glutamate receptor ionotropic, NMDA 2A [Source:NCBI gene;Acc:101164378])

HSP 1 Score: 321.242 bits (822), Expect = 7.021e-90
Identity = 180/519 (34.68%), Postives = 289/519 (55.68%), Query Frame = 3
Query: 1425 RWFKVGKWSMSSKWGKTKSKIRIDGVTWP-----GGENKPPKGRPDKVKLRVATIQEMPFVFYGK-RLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADH---KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLR 2948
            +W K+G+W            + +    WP     G E+       D+  L + T++E PFV      +  G C  N++PCR   K                           +S S G    Y+  CC G  +D+L ++ +++ F  DL+ V +GK G      WNG+V  ++  KA + + SL I   RSE IDFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E++SP G +R   Q  D     F++ +++WL+W ++F  +V   NPRG  S+F+ ++WA FA++FLASYTANLAAFMI ++    ++G+ D +  +P+++ P FRF TVP+G+TE N++ N+P M +YM  +++T V D + +LKTG++DAFIYD+ VL+Y A +D  CKL T+G+  ++A TGYG+   KGS W++ ++  IL     G+++  +  W+TG C  ++  +  + +L V N    F +L   M +       EHLF+  LR
Sbjct:  469 KWEKMGRWE--------NGTLSLMFPVWPRYNAYGDEDA------DENHLSIVTLEEKPFVIVDNVDILTGTCMRNSVPCRKHVKL--------------------------NSTSGGA---YIKQCCKGFCIDILKKIARNVKFTYDLYLVTNGKHGKKINNMWNGMVGEVVYKKAVMAVGSLTINEERSEVIDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVTAIAVFLFEFISPLGFNRNLAQGKDPHGPSFTIGKAIWLLWGLVFNNSVPVQNPRGTTSKFIVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQSPYSYSPPFRFGTVPNGSTERNIRKNYPDMHQYMTKYHQTGVTDALVSLKTGKLDAFIYDAAVLNYMAGRDDGCKLVTIGSGYIFATTGYGIALQKGSYWKRHVDLAILSIIGDGEMEELEAQWLTGICHNEKN-EVMSSQLDVDNMAGVFYMLATAMGLSILTFISEHLFYWRLR 943          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Medaka
Match: ENSORLT00000011525.2 (glutamate receptor ionotropic, NMDA 2A [Source:NCBI gene;Acc:101164378])

HSP 1 Score: 320.857 bits (821), Expect = 1.017e-89
Identity = 180/519 (34.68%), Postives = 289/519 (55.68%), Query Frame = 3
Query: 1425 RWFKVGKWSMSSKWGKTKSKIRIDGVTWP-----GGENKPPKGRPDKVKLRVATIQEMPFVFYGK-RLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADH---KFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLR 2948
            +W K+G+W            + +    WP     G E+       D+  L + T++E PFV      +  G C  N++PCR   K                           +S S G    Y+  CC G  +D+L ++ +++ F  DL+ V +GK G      WNG+V  ++  KA + + SL I   RSE IDFS PF+ETGI+++V+   G +SP+AFLEP+    W ++ V  +     A+F++E++SP G +R   Q  D     F++ +++WL+W ++F  +V   NPRG  S+F+ ++WA FA++FLASYTANLAAFMI ++    ++G+ D +  +P+++ P FRF TVP+G+TE N++ N+P M +YM  +++T V D + +LKTG++DAFIYD+ VL+Y A +D  CKL T+G+  ++A TGYG+   KGS W++ ++  IL     G+++  +  W+TG C  ++  +  + +L V N    F +L   M +       EHLF+  LR
Sbjct:  440 KWEKMGRWE--------NGTLSLMFPVWPRYNAYGDEDA------DENHLSIVTLEEKPFVIVDNVDILTGTCMRNSVPCRKHVKL--------------------------NSTSGGA---YIKQCCKGFCIDILKKIARNVKFTYDLYLVTNGKHGKKINNMWNGMVGEVVYKKAVMAVGSLTINEERSEVIDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVTAIAVFLFEFISPLGFNRNLAQGKDPHGPSFTIGKAIWLLWGLVFNNSVPVQNPRGTTSKFIVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQSPYSYSPPFRFGTVPNGSTERNIRKNYPDMHQYMTKYHQTGVTDALVSLKTGKLDAFIYDAAVLNYMAGRDDGCKLVTIGSGYIFATTGYGIALQKGSYWKRHVDLAILSIIGDGEMEELEAQWLTGICHNEKN-EVMSSQLDVDNMAGVFYMLATAMGLSILTFISEHLFYWRLR 914          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Medaka
Match: ENSORLT00000013760.2 (glutamate receptor ionotropic, NMDA 2C [Source:NCBI gene;Acc:101166504])

HSP 1 Score: 313.538 bits (802), Expect = 7.722e-88
Identity = 192/588 (32.65%), Postives = 322/588 (54.76%), Query Frame = 3
Query: 1245 IPKGICNSNESVWKW-GKRLYQIMKSETVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLEN-----GKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDG-KADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQR---ADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGN--LYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDR 2972
            IP+G  + ++   ++    L++ M + T E +D  + F+S G ++   + I    T+    +W KVG ++        +  +++    WP   +       D+  L VAT++E PFV     +EN     G C  N +PCR               + +  E ++            G    Y   CC G  +D+L ++ +++ F  DL+ V +GK G      WNG++  + +  +AD+ + SL I   RSE IDFS PF+ETGI+++VA   G +SP+AFLEPY    W ++ V  +      +F++E+ SP G +R  +         F++ +S+WL+W ++F  +V  +NP+G  S+ +  +WA FA++FLASYTANLAAFMI +     +SG+ D +   P  H P FRF TVP+G+TE N++ N+P M  +M  +N+  V++ +++LKTG++DAFIYD+ VL+Y A KD+ CKL T+G+  ++A TGYG+   K S+W++ I+  +LQ+   G  +R +  W++G C+ ++  +  + +L + N    F +LL  M +   +   EHL +  LR  + K+D+
Sbjct:  319 IPEGYGDCSKPAKQFDNNTLFRHMLNVTWERKD--LSFNSQGFLSNPSMVII---TLDRERQWDKVGTFA--------RGILQVRYPIWPRYGSFLEHVSDDR-HLTVATLEEHPFVM----VENVDPGTGTCVRNTVPCR--------------RQSNYTESVF------------GPTESYTKLCCKGFCIDILKKLSRNIKFSFDLYLVTNGKHGKLVHGVWNGMIGEVRNAQRADMAIGSLTINEERSEIIDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVTVFVFEYFSPVGYNRSLVSAKAPGGPTFTIGKSVWLLWGIVFNNSVPIENPKGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTVSGLSDKKFQKPQEHYPPFRFGTVPNGSTERNIRSNYPDMHTHMMRYNQKGVEEALQSLKTGKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIALVKDSRWKRPIDLALLQFLGDGDTERLETVWLSGICQNEKN-EVMSSKLDIDNMAGVFYMLLVAMGLSMVVFAWEHLLYWKLRHSLHKSDK 861          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Planmine SMEST
Match: SMESG000009938.1 (SMESG000009938.1)

HSP 1 Score: 2390.15 bits (6193), Expect = 0.000e+0
Identity = 1203/1220 (98.61%), Postives = 1204/1220 (98.69%), Query Frame = 3
Query:   45 TLLNFIYSSSVFVLYFLSTRADFDASSLIRIRLKAIHFENNVANLQKSTIKYEALDEDLQHLIKLMKENPMKSSLDLTFNYEKYFRTNFNPRKMMRMVCKEFQGTRIQPITNTLLLVNDDGDEVDKKNADSGLEYFLYLSSIIKIPVITWFPDRSGQMENYANSMALRLEPMNWHIARAFVDFMQAYNWDLVTIVMSSKQREKNTFLKELRNVQKERSNIENNNHFPFTISDVHTFEGLESDELHNCILQMHRCRTIKTMLVALERIFKNNDRIVIFLGNKVELVALIAAVRKSNGPXXXXXXXXXXXXXWICAPSFMNPIETSERSNSIQLDNIVIQNWISKEGMQVSGMFFLACLNHYSIYRKKTEFVRILWQKSLLKLIQFIKERFPSNSTDLKNKIIPKGICNSNESVWKWGKRLYQIMKSETVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNKSADTLKXXXXXXXXXXXXXXRLKQENEFLKQKIQKLEIALSYMAGCDELHRSNTKHLDIPKDTTDVSISLSNYLTLRERRNRDEAECKEDNNKETTKEPAVLYRCEDQQDISIYCPKHIQLYNQKHSRHHSFYTLPKCQNFDRSQHNCLNAVKDIRKYPSCNNVSSQSKSLKPIQNXXXXXXXXXXXXPNNLYRFSNSSFSTFLLKGKRKKDEMLVKESCL 3704
            TLLNFIYSSSVFVLYFLSTRADFDASSLIRIRLKAIHFENNVANLQKSTIKYEALDEDLQHLIKLMKENPMKSSLDLTFNYEKYFRTNFNPRKMMRMVCKEFQGTRIQPITNTLLLVNDDGDEVDKKNADSGLEYFLYLSSIIKIPVITWFPDRSGQMENYANSMALRLEPMNWHIARAFVDFMQAYNWDLVTIVMSSKQREKNTFLKELRNVQKERSNIENNNHFPFTISDVHTFEGLESDELHNCILQMHRCRTIKTMLVALERIFKNNDRIVIFLGNKVELVALIAAVRKSNGPKRYLKKL                +ETSERSNSIQLDNIVIQNWISKEGMQVSGMFFLACLNHYSIYRKKTEFVRILWQKSLLKLIQFIKERFPSNSTDLKNKIIPKGICNSNESVWKWGKRLYQIMKSETVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVLDYKAAKDKKCKLKTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNKSADTLKSSLCSNNPSNSSQSRLKQENEFLKQKIQKLEIALSYMAGCDELHRSNTKHLDIPKDTTDVSISLSNYLTLRERRNRDEAECKEDNNKETTKEPAVLYRCEDQQDISIYCPKHIQLYNQKHSRHHSFYTLPKCQNFDRSQHNCLNAVKDIRKYPSCNNVSSQSKSLKPIQNSSEKYKIIKSISPNNLYRFSNSSFSTFLLKGKRKKDEMLVKESCL
Sbjct:   12 TLLNFIYSSSVFVLYFLSTRADFDASSLIRIRLKAIHFENNVANLQKSTIKYEALDEDLQHLIKLMKENPMKSSLDLTFNYEKYFRTNFNPRKMMRMVCKEFQGTRIQPITNTLLLVNDDGDEVDKKNADSGLEYFLYLSSIIKIPVITWFPDRSGQMENYANSMALRLEPMNWHIARAFVDFMQAYNWDLVTIVMSSKQREKNTFLKELRNVQKERSNIENNNHFPFTISDVHTFEGLESDELHNCILQMHRCRTIKTMLVALERIFKNNDRIVIFLGNKVELVALIAAVRKSNGPKRYLKKL----------------LETSERSNSIQLDNIVIQNWISKEGMQVSGMFFLACLNHYSIYRKKTEFVRILWQKSLLKLIQFIKERFPSNSTDLKNKIIPKGICNSNESVWKWGKRLYQIMKSETVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVLDYKAAKDKKCKLKTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNKSADTLKSSLCSNNPSNSSQSRLKQENEFLKQKIQKLEIALSYMAGCDELHRSNTKHLDIPKDTTDVSISLSNYLTLRERRNRDEAECKEDNNKETTKEPAVLYRCEDQQDISIYCPKHIQLYNQKHSRHHSFYTLPKCQNFDRSQHNCLNAVKDIRKYPSCNNVSSQSKSLKPIQNSSEKYKIIKSISPNNLYRFSNSSFSTFLLKGKRKKDEMLVKESCL 1215          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Planmine SMEST
Match: SMESG000009938.1 (SMESG000009938.1)

HSP 1 Score: 2389.76 bits (6192), Expect = 0.000e+0
Identity = 1203/1220 (98.61%), Postives = 1204/1220 (98.69%), Query Frame = 3
Query:   45 TLLNFIYSSSVFVLYFLSTRADFDASSLIRIRLKAIHFENNVANLQKSTIKYEALDEDLQHLIKLMKENPMKSSLDLTFNYEKYFRTNFNPRKMMRMVCKEFQGTRIQPITNTLLLVNDDGDEVDKKNADSGLEYFLYLSSIIKIPVITWFPDRSGQMENYANSMALRLEPMNWHIARAFVDFMQAYNWDLVTIVMSSKQREKNTFLKELRNVQKERSNIENNNHFPFTISDVHTFEGLESDELHNCILQMHRCRTIKTMLVALERIFKNNDRIVIFLGNKVELVALIAAVRKSNGPXXXXXXXXXXXXXWICAPSFMNPIETSERSNSIQLDNIVIQNWISKEGMQVSGMFFLACLNHYSIYRKKTEFVRILWQKSLLKLIQFIKERFPSNSTDLKNKIIPKGICNSNESVWKWGKRLYQIMKSETVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNKSADTLKXXXXXXXXXXXXXXRLKQENEFLKQKIQKLEIALSYMAGCDELHRSNTKHLDIPKDTTDVSISLSNYLTLRERRNRDEAECKEDNNKETTKEPAVLYRCEDQQDISIYCPKHIQLYNQKHSRHHSFYTLPKCQNFDRSQHNCLNAVKDIRKYPSCNNVSSQSKSLKPIQNXXXXXXXXXXXXPNNLYRFSNSSFSTFLLKGKRKKDEMLVKESCL 3704
            TLLNFIYSSSVFVLYFLSTRADFDASSLIRIRLKAIHFENNVANLQKSTIKYEALDEDLQHLIKLMKENPMKSSLDLTFNYEKYFRTNFNPRKMMRMVCKEFQGTRIQPITNTLLLVNDDGDEVDKKNADSGLEYFLYLSSIIKIPVITWFPDRSGQMENYANSMALRLEPMNWHIARAFVDFMQAYNWDLVTIVMSSKQREKNTFLKELRNVQKERSNIENNNHFPFTISDVHTFEGLESDELHNCILQMHRCRTIKTMLVALERIFKNNDRIVIFLGNKVELVALIAAVRKSNGPKRYLKKL                +ETSERSNSIQLDNIVIQNWISKEGMQVSGMFFLACLNHYSIYRKKTEFVRILWQKSLLKLIQFIKERFPSNSTDLKNKIIPKGICNSNESVWKWGKRLYQIMKSETVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVLDYKAAKDKKCKLKTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNKSADTLKSSLCSNNPSNSSQSRLKQENEFLKQKIQKLEIALSYMAGCDELHRSNTKHLDIPKDTTDVSISLSNYLTLRERRNRDEAECKEDNNKETTKEPAVLYRCEDQQDISIYCPKHIQLYNQKHSRHHSFYTLPKCQNFDRSQHNCLNAVKDIRKYPSCNNVSSQSKSLKPIQNSSEKYKIIKSISPNNLYRFSNSSFSTFLLKGKRKKDEMLVKESCL
Sbjct:   17 TLLNFIYSSSVFVLYFLSTRADFDASSLIRIRLKAIHFENNVANLQKSTIKYEALDEDLQHLIKLMKENPMKSSLDLTFNYEKYFRTNFNPRKMMRMVCKEFQGTRIQPITNTLLLVNDDGDEVDKKNADSGLEYFLYLSSIIKIPVITWFPDRSGQMENYANSMALRLEPMNWHIARAFVDFMQAYNWDLVTIVMSSKQREKNTFLKELRNVQKERSNIENNNHFPFTISDVHTFEGLESDELHNCILQMHRCRTIKTMLVALERIFKNNDRIVIFLGNKVELVALIAAVRKSNGPKRYLKKL----------------LETSERSNSIQLDNIVIQNWISKEGMQVSGMFFLACLNHYSIYRKKTEFVRILWQKSLLKLIQFIKERFPSNSTDLKNKIIPKGICNSNESVWKWGKRLYQIMKSETVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVLDYKAAKDKKCKLKTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNKSADTLKSSLCSNNPSNSSQSRLKQENEFLKQKIQKLEIALSYMAGCDELHRSNTKHLDIPKDTTDVSISLSNYLTLRERRNRDEAECKEDNNKETTKEPAVLYRCEDQQDISIYCPKHIQLYNQKHSRHHSFYTLPKCQNFDRSQHNCLNAVKDIRKYPSCNNVSSQSKSLKPIQNSSEKYKIIKSISPNNLYRFSNSSFSTFLLKGKRKKDEMLVKESCL 1220          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Planmine SMEST
Match: SMESG000009938.1 (SMESG000009938.1)

HSP 1 Score: 2387.45 bits (6186), Expect = 0.000e+0
Identity = 1203/1220 (98.61%), Postives = 1204/1220 (98.69%), Query Frame = 3
Query:   45 TLLNFIYSSSVFVLYFLSTRADFDASSLIRIRLKAIHFENNVANLQKSTIKYEALDEDLQHLIKLMKENPMKSSLDLTFNYEKYFRTNFNPRKMMRMVCKEFQGTRIQPITNTLLLVNDDGDEVDKKNADSGLEYFLYLSSIIKIPVITWFPDRSGQMENYANSMALRLEPMNWHIARAFVDFMQAYNWDLVTIVMSSKQREKNTFLKELRNVQKERSNIENNNHFPFTISDVHTFEGLESDELHNCILQMHRCRTIKTMLVALERIFKNNDRIVIFLGNKVELVALIAAVRKSNGPXXXXXXXXXXXXXWICAPSFMNPIETSERSNSIQLDNIVIQNWISKEGMQVSGMFFLACLNHYSIYRKKTEFVRILWQKSLLKLIQFIKERFPSNSTDLKNKIIPKGICNSNESVWKWGKRLYQIMKSETVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNKSADTLKXXXXXXXXXXXXXXRLKQENEFLKQKIQKLEIALSYMAGCDELHRSNTKHLDIPKDTTDVSISLSNYLTLRERRNRDEAECKEDNNKETTKEPAVLYRCEDQQDISIYCPKHIQLYNQKHSRHHSFYTLPKCQNFDRSQHNCLNAVKDIRKYPSCNNVSSQSKSLKPIQNXXXXXXXXXXXXPNNLYRFSNSSFSTFLLKGKRKKDEMLVKESCL 3704
            TLLNFIYSSSVFVLYFLSTRADFDASSLIRIRLKAIHFENNVANLQKSTIKYEALDEDLQHLIKLMKENPMKSSLDLTFNYEKYFRTNFNPRKMMRMVCKEFQGTRIQPITNTLLLVNDDGDEVDKKNADSGLEYFLYLSSIIKIPVITWFPDRSGQMENYANSMALRLEPMNWHIARAFVDFMQAYNWDLVTIVMSSKQREKNTFLKELRNVQKERSNIENNNHFPFTISDVHTFEGLESDELHNCILQMHRCRTIKTMLVALERIFKNNDRIVIFLGNKVELVALIAAVRKSNGPKRYLKKL                +ETSERSNSIQLDNIVIQNWISKEGMQVSGMFFLACLNHYSIYRKKTEFVRILWQKSLLKLIQFIKERFPSNSTDLKNKIIPKGICNSNESVWKWGKRLYQIMKSETVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVLDYKAAKDKKCKLKTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNKSADTLKSSLCSNNPSNSSQSRLKQENEFLKQKIQKLEIALSYMAGCDELHRSNTKHLDIPKDTTDVSISLSNYLTLRERRNRDEAECKEDNNKETTKEPAVLYRCEDQQDISIYCPKHIQLYNQKHSRHHSFYTLPKCQNFDRSQHNCLNAVKDIRKYPSCNNVSSQSKSLKPIQNSSEKYKIIKSISPNNLYRFSNSSFSTFLLKGKRKKDEMLVKESCL
Sbjct:  948 TLLNFIYSSSVFVLYFLSTRADFDASSLIRIRLKAIHFENNVANLQKSTIKYEALDEDLQHLIKLMKENPMKSSLDLTFNYEKYFRTNFNPRKMMRMVCKEFQGTRIQPITNTLLLVNDDGDEVDKKNADSGLEYFLYLSSIIKIPVITWFPDRSGQMENYANSMALRLEPMNWHIARAFVDFMQAYNWDLVTIVMSSKQREKNTFLKELRNVQKERSNIENNNHFPFTISDVHTFEGLESDELHNCILQMHRCRTIKTMLVALERIFKNNDRIVIFLGNKVELVALIAAVRKSNGPKRYLKKL----------------LETSERSNSIQLDNIVIQNWISKEGMQVSGMFFLACLNHYSIYRKKTEFVRILWQKSLLKLIQFIKERFPSNSTDLKNKIIPKGICNSNESVWKWGKRLYQIMKSETVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLENGKCDVNAIPCRILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVLDYKAAKDKKCKLKTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNKSADTLKSSLCSNNPSNSSQSRLKQENEFLKQKIQKLEIALSYMAGCDELHRSNTKHLDIPKDTTDVSISLSNYLTLRERRNRDEAECKEDNNKETTKEPAVLYRCEDQQDISIYCPKHIQLYNQKHSRHHSFYTLPKCQNFDRSQHNCLNAVKDIRKYPSCNNVSSQSKSLKPIQNSSEKYKIIKSISPNNLYRFSNSSFSTFLLKGKRKKDEMLVKESCL 2151          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Planmine SMEST
Match: SMESG000021416.1 (SMESG000021416.1)

HSP 1 Score: 1063.91 bits (2750), Expect = 0.000e+0
Identity = 563/1038 (54.24%), Postives = 727/1038 (70.04%), Query Frame = 3
Query:   75 VFVLYFLSTRADFDASSLIRIRLKAIHFENNVANLQKSTIKYEALDEDLQHLIKLMKENPMKSS----LDLTFNYEKYFRTNFNPRKMMRMVCKEFQGTRIQPITNTLLLVNDDGDEVDKKNADSGLEYFLYLSSIIKIPVITWFPDRSGQMENYANSMALRLEPMNWHIARAFVDFMQAYNWDLVTIVMSSKQREKNTFLKELRNVQKERSNIENNNHFPFTISDVHTFEGLESDELHNCILQMHRCRTIKTMLVALERIFKNNDRIVIFLGNKVELVALIAAVRK-SNGPXXXXXXXXXXXXXWICAPSFMNPIETSERSNSIQLDNIVIQ-NW-ISKEGMQVSGMFFLACLNHYSIYRKKTEFVRILWQKSLLKLIQFIKERFPSNSTDLKNKIIPKGICNSNESVWKWGKRLYQIMKSETVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLENGKCDVNAIPC--RILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNKSADTLKXXXXXXXXXXXXXXRLKQENEFLKQKIQKLEIAL 3161
            + VL+ +S+ + F  ++LI+  LK +HFE       + T +Y  + + L     L+ +  MK S    L LT +Y+   +  F P  +   +CKE +  ++    NT +LVNDDG E++K+  + G+++ ++++S + IP  TWFPD++GQ +   +S+A+RLEP NWHI +A VDFMQAYNW  V  ++S K      F+KEL+  QKER  + N   F F IS      GL+  +L +C  Q + C  I   L  L+ + KNNDR+++F G + EL+ LI+AV++ +     YL ++ G  Y+W+C+P+ + P++   RS SI  D  VI+ +W + K  +Q+ GMF     N++  Y+ K    R LW +SL KL + +KER P+N + + +K+ P  +C +     K G +LYQIMKS T++  DEYIGF +NGAINTTEL IFNS+     + W KVG WSMSSKWGK KS +RIDGVTWPG E KPP+GRPDK +LRV TI+E+PFV + +  E G CD N++ C  R L +   ES+  + +              I   N +   P YV +CC+GLTMD+L+E+MKDL F VDLFEVPDGKWGGWT  GWNGLVKVL D  AD+ +TS KITPNRSEQIDFS PF++TGIAIIVALR+G ISPTAFLEPYDY SWC+ILVFSVHACGAALFIYEWLSPHGLDRGN   A+HKFS  RSLWLIWSMLFGAAVN DNPRG ASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDL+GIKD  LMNP   KP F FATVPSGATEEN+KINFP M++YM+ FN+++V++GIKALKTGEI+AFIYDSNVL+Y+A KD+ CKLKTVGNL+AMTGYGVGFPK SKW   IND IL Y+  GK+QR K++W+TG CKK R LDSTNKRLGV NFISAFILLL G+ +CS +L LEH F++YLR  +   D+YGCC LVSIS+ Q++N+E +VN++ D +K   CSN    S   + + E + LK++++ LE AL
Sbjct:    4 IIVLFMISSVSMFRRTNLIQ--LKVLHFETKEMADFRPTTQYVTVSKQLM----LVNQTEMKLSHLVPLKLTLDYKAMIKFLFYPTALKSEICKELRQNQV----NTFMLVNDDG-ELEKETFNRGIDFIIHMASSMGIPTFTWFPDKAGQYKLDKSSLAIRLEPANWHIIQAMVDFMQAYNWTQVATIVSKKIPNHQNFIKELQLAQKERGLMNNEKLFRFIISKSLKLIGLDITDLRSCKAQKNLCPFIVDSLRILKELHKNNDRVILFHGTQYELMLLISAVKEYAVDKSSYLNEMFGSNYIWLCSPALVTPVKNEMRSESINPDLFVIKGSWKVGKVDLQIPGMFVFVTFNNFESYKSKAIMARELWARSLSKLTEILKERHPNNISAIVDKLRPSDLCENKNPKLKMGPQLYQIMKSMTLKINDEYIGFLNNGAINTTELLIFNSQKKISGLGWHKVGTWSMSSKWGKKKSNLRIDGVTWPGNEIKPPRGRPDKFRLRVTTIKEVPFVQF-RESETGNCDGNSLKCWVRDLNRQLSESNVNETFY------------AIFGVNVTSDHP-YVPACCSGLTMDMLSELMKDLEFEVDLFEVPDGKWGGWTFDGWNGLVKVLKDHSADMAVTSFKITPNRSEQIDFSVPFLQTGIAIIVALREGGISPTAFLEPYDYQSWCVILVFSVHACGAALFIYEWLSPHGLDRGNQVTAEHKFSFFRSLWLIWSMLFGAAVNADNPRGTASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLTGIKDAHLMNPLGFKPPFTFATVPSGATEENIKINFPTMYEYMKKFNRSSVEEGIKALKTGEINAFIYDSNVLEYRATKDENCKLKTVGNLFAMTGYGVGFPKSSKWLNLINDRILNYESNGKMQRWKQYWLTGACKKDRRLDSTNKRLGVKNFISAFILLLGGIILCSLLLLLEHTFYKYLRPHLTNIDKYGCCGLVSISMGQILNFEQSVNQTVDMVKHHKCSNIICESKWLKARNEADRLKKRVEMLEDAL 1016          
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Planmine SMEST
Match: SMESG000021416.1 (SMESG000021416.1)

HSP 1 Score: 1060.83 bits (2742), Expect = 0.000e+0
Identity = 558/1018 (54.81%), Postives = 715/1018 (70.24%), Query Frame = 3
Query:  135 IRLKAIHFENNVANLQKSTIKYEALDEDLQHLIKLMKENPMKSS----LDLTFNYEKYFRTNFNPRKMMRMVCKEFQGTRIQPITNTLLLVNDDGDEVDKKNADSGLEYFLYLSSIIKIPVITWFPDRSGQMENYANSMALRLEPMNWHIARAFVDFMQAYNWDLVTIVMSSKQREKNTFLKELRNVQKERSNIENNNHFPFTISDVHTFEGLESDELHNCILQMHRCRTIKTMLVALERIFKNNDRIVIFLGNKVELVALIAAVRK-SNGPXXXXXXXXXXXXXWICAPSFMNPIETSERSNSIQLDNIVIQ-NW-ISKEGMQVSGMFFLACLNHYSIYRKKTEFVRILWQKSLLKLIQFIKERFPSNSTDLKNKIIPKGICNSNESVWKWGKRLYQIMKSETVEFEDEYIGFHSNGAINTTELFIFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGRPDKVKLRVATIQEMPFVFYGKRLENGKCDVNAIPC--RILQKAPDESDAGKVYEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNFVVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQIDFSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAALFIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTHKPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEIDAFIYDSNVXXXXXXXXXXXXXXTVGNLYAMTGYGVGFPKGSKWRQKINDLILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAGMFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNKSADTLKXXXXXXXXXXXXXXRLKQENEFLKQKIQKLEIAL 3161
            I+LK +HFE       + T +Y  + + L     L+ +  MK S    L LT +Y+   +  F P  +   +CKE +  ++    NT +LVNDDG E++K+  + G+++ ++++S + IP  TWFPD++GQ +   +S+A+RLEP NWHI +A VDFMQAYNW  V  ++S K      F+KEL+  QKER  + N   F F IS      GL+  +L +C  Q + C  I   L  L+ + KNNDR+++F G + EL+ LI+AV++ +     YL ++ G  Y+W+C+P+ + P++   RS SI  D  VI+ +W + K  +Q+ GMF     N++  Y+ K    R LW +SL KL + +KER P+N + + +K+ P  +C +     K G +LYQIMKS T++  DEYIGF +NGAINTTEL IFNS+     + W KVG WSMSSKWGK KS +RIDGVTWPG E KPP+GRPDK +LRV TI+E+PFV + +  E G CD N++ C  R L +   ES+  + +              I   N +   P YV +CC+GLTMD+L+E+MKDL F VDLFEVPDGKWGGWT  GWNGLVKVL D  AD+ +TS KITPNRSEQIDFS PF++TGIAIIVALR+G ISPTAFLEPYDY SWC+ILVFSVHACGAALFIYEWLSPHGLDRGN   A+HKFS  RSLWLIWSMLFGAAVN DNPRG ASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDL+GIKD  LMNP   KP F FATVPSGATEEN+KINFP M++YM+ FN+++V++GIKALKTGEI+AFIYDSNVL+Y+A KD+ CKLKTVGNL+AMTGYGVGFPK SKW   IND IL Y+  GK+QR K++W+TG CKK R LDSTNKRLGV NFISAFILLL G+ +CS +L LEH F++YLR  +   D+YGCC LVSIS+ Q++N+E +VN++ D +K   CSN    S   + + E + LK++++ LE AL
Sbjct:   14 IQLKVLHFETKEMADFRPTTQYVTVSKQLM----LVNQTEMKLSHLVPLKLTLDYKAMIKFLFYPTALKSEICKELRQNQV----NTFMLVNDDG-ELEKETFNRGIDFIIHMASSMGIPTFTWFPDKAGQYKLDKSSLAIRLEPANWHIIQAMVDFMQAYNWTQVATIVSKKIPNHQNFIKELQLAQKERGLMNNEKLFRFIISKSLKLIGLDITDLRSCKAQKNLCPFIVDSLRILKELHKNNDRVILFHGTQYELMLLISAVKEYAVDKSSYLNEMFGSNYIWLCSPALVTPVKNEMRSESINPDLFVIKGSWKVGKVDLQIPGMFVFVTFNNFESYKSKAIMARELWARSLSKLTEILKERHPNNISAIVDKLRPSDLCENKNPKLKMGPQLYQIMKSMTLKINDEYIGFLNNGAINTTELLIFNSQKKISGLGWHKVGTWSMSSKWGKKKSNLRIDGVTWPGNEIKPPRGRPDKFRLRVTTIKEVPFVQF-RESETGNCDGNSLKCWVRDLNRQLSESNVNETFY------------AIFGVNVTSDHP-YVPACCSGLTMDMLSELMKDLEFEVDLFEVPDGKWGGWTFDGWNGLVKVLKDHSADMAVTSFKITPNRSEQIDFSVPFLQTGIAIIVALREGGISPTAFLEPYDYQSWCVILVFSVHACGAALFIYEWLSPHGLDRGNQVTAEHKFSFFRSLWLIWSMLFGAAVNADNPRGTASRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLTGIKDAHLMNPLGFKPPFTFATVPSGATEENIKINFPTMYEYMKKFNRSSVEEGIKALKTGEINAFIYDSNVLEYRATKDENCKLKTVGNLFAMTGYGVGFPKSSKWLNLINDRILNYESNGKMQRWKQYWLTGACKKDRRLDSTNKRLGVKNFISAFILLLGGIILCSLLLLLEHTFYKYLRPHLTNIDKYGCCGLVSISMGQILNFEQSVNQTVDMVKHHKCSNIICESKWLKARNEADRLKKRVEMLEDAL 1008          
The following BLAST results are available for this feature:
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIN2A3.593e-9234.37glutamate ionotropic receptor NMDA type subunit 2A... [more]
GRIN2A3.991e-9134.37glutamate ionotropic receptor NMDA type subunit 2A... [more]
GRIN2A8.195e-9134.44glutamate ionotropic receptor NMDA type subunit 2A... [more]
GRIN2A8.195e-9134.44glutamate ionotropic receptor NMDA type subunit 2A... [more]
GRIN2B1.310e-8933.39glutamate ionotropic receptor NMDA type subunit 2B... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nmr-25.828e-12938.65NMDA class glutamate Receptor [Source:UniProtKB/T... [more]
nmr-24.740e-10645.33NMDA class glutamate Receptor [Source:UniProtKB/T... [more]
nmr-12.898e-3726.58NMDA class glutamate Receptor; NMDA-type ionotropi... [more]
nmr-12.898e-3726.58NMDA class glutamate Receptor; NMDA-type ionotropi... [more]
glr-48.533e-3427.64GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nmdar22.218e-13536.12gene:FBgn0053513 transcript:FBtr0091453[more]
Nmdar22.218e-13536.12gene:FBgn0053513 transcript:FBtr0301842[more]
Nmdar22.218e-13536.12gene:FBgn0053513 transcript:FBtr0091454[more]
Nmdar25.357e-13536.12gene:FBgn0053513 transcript:FBtr0301843[more]
Nmdar29.920e-13435.71gene:FBgn0053513 transcript:FBtr0339592[more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grin2aa4.350e-9134.95glutamate receptor, ionotropic, N-methyl D-asparta... [more]
BX649405.22.109e-9035.28glutamate receptor, ionotropic, N-methyl D-asparta... [more]
grin2ab5.959e-9035.28glutamate receptor, ionotropic, N-methyl D-asparta... [more]
grin2ab5.959e-9035.28glutamate receptor, ionotropic, N-methyl D-asparta... [more]
grin2ca6.030e-9034.29glutamate receptor, ionotropic, N-methyl D-asparta... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIN2A1.149e-9235.14glutamate receptor, ionotropic, N-methyl D-asparta... [more]
sdr42e11.495e-9236.51short chain dehydrogenase/reductase family 42E, me... [more]
sdr42e12.905e-9135.61short chain dehydrogenase/reductase family 42E, me... [more]
GRIN2C7.800e-9134.87glutamate receptor, ionotropic, N-methyl D-asparta... [more]
GRIN2B7.998e-9033.09glutamate receptor, ionotropic, N-methyl D-asparta... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grin2a3.847e-9134.37glutamate receptor, ionotropic, NMDA2A (epsilon 1)... [more]
Grin2a3.847e-9134.37glutamate receptor, ionotropic, NMDA2A (epsilon 1)... [more]
Grin2a3.847e-9134.37glutamate receptor, ionotropic, NMDA2A (epsilon 1)... [more]
Grin2b6.213e-9033.56glutamate receptor, ionotropic, NMDA2B (epsilon 2)... [more]
Grin2b6.213e-9033.56glutamate receptor, ionotropic, NMDA2B (epsilon 2)... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P35436|NMDE1_MOUSE2.691e-9034.37Glutamate receptor ionotropic, NMDA 2A OS=Mus musc... [more]
sp|B7ZSK1|NMDE1_XENLA3.383e-9034.87Glutamate receptor ionotropic, NMDA 2A OS=Xenopus ... [more]
sp|Q00959|NMDE1_RAT3.792e-9034.44Glutamate receptor ionotropic, NMDA 2A OS=Rattus n... [more]
sp|Q12879|NMDE1_HUMAN3.935e-9034.44Glutamate receptor ionotropic, NMDA 2A OS=Homo sap... [more]
sp|Q5IS45|NMDE1_PANTR4.199e-9034.44Glutamate receptor ionotropic, NMDA 2A OS=Pan trog... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0R4M70.000e+046.89Glutamate [NMDA] receptor subunit epsilon-2 OS=Fas... [more]
A0A4Z2DRV80.000e+049.65Glutamate receptor ionotropic, NMDA 2A OS=Schistos... [more]
A0A3Q0KPC60.000e+049.60Putative glutamate receptor, NMDA OS=Schistosoma m... [more]
A0A094ZJC60.000e+050.63Glutamate receptor ionotropic, NMDA 2B (Fragment) ... [more]
A0A5K4ES920.000e+049.90Putative glutamate receptor, NMDA OS=Schistosoma m... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grin2ca2.810e-9133.50glutamate receptor ionotropic, NMDA 2C-like [Sourc... [more]
grin2aa8.557e-9033.33glutamate receptor, ionotropic, N-methyl D-asparta... [more]
grin2ab3.575e-8936.29glutamate receptor, ionotropic, N-methyl D-asparta... [more]
grin2cb1.080e-8834.84glutamate receptor ionotropic, NMDA 2C [Source:NCB... [more]
grin2bb8.915e-8833.03glutamate receptor, ionotropic, N-methyl D-asparta... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010716.12.309e-9237.62pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1... [more]
ENSPMAT00000000889.19.064e-3130.41pep scaffold:Pmarinus_7.0:GL476542:184998:205948:1... [more]
gria1b1.941e-3026.23glutamate receptor, ionotropic, AMPA 1b [Source:ZF... [more]
ENSPMAT00000005084.12.869e-2828.49pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 ... [more]
ENSPMAT00000000779.16.882e-1731.55pep scaffold:Pmarinus_7.0:GL482437:4504:14157:1 ge... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO448424.610e-6135.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355452.941e-5729.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343634.594e-4127.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302035.025e-3627.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478255.032e-3526.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grin2ca3.477e-9333.61glutamate ionotropic receptor NMDA type subunit 2C... [more]
grin2aa5.456e-9036.84glutamate ionotropic receptor NMDA type subunit 2A... [more]
ENSORLT00000040618.17.021e-9034.68glutamate receptor ionotropic, NMDA 2A [Source:NCB... [more]
ENSORLT00000011525.21.017e-8934.68glutamate receptor ionotropic, NMDA 2A [Source:NCB... [more]
ENSORLT00000013760.27.722e-8832.65glutamate receptor ionotropic, NMDA 2C [Source:NCB... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 2B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009938.10.000e+098.61SMESG000009938.1[more]
SMESG000009938.10.000e+098.61SMESG000009938.1[more]
SMESG000009938.10.000e+098.61SMESG000009938.1[more]
SMESG000021416.10.000e+054.24SMESG000021416.1[more]
SMESG000021416.10.000e+054.81SMESG000021416.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003957 ID=SMED30003957|Name=Glutamate receptor ionotropic, NMDA 2B|organism=Schmidtea mediterranea sexual|type=transcript|length=3809bp
ATAAGTATTTATTTTAACGGAATTAGTAAATAAATCAAAAAATGACCCTG
CTGAATTTCATTTATTCTTCATCAGTTTTCGTTTTATATTTCCTCTCTAC
CCGGGCAGATTTCGATGCTAGCAGCCTCATCAGGATACGACTGAAAGCAA
TTCATTTCGAGAACAATGTTGCGAACTTGCAGAAGAGTACAATCAAATAT
GAAGCCTTGGATGAAGATCTTCAACATCTTATCAAATTGATGAAAGAAAA
TCCAATGAAAAGCTCACTGGATTTGACTTTTAATTATGAGAAATATTTTC
GGACAAATTTCAATCCTCGGAAAATGATGCGAATGGTCTGCAAAGAATTT
CAAGGAACAAGGATCCAACCAATAACAAATACGTTGCTTCTTGTAAATGA
CGATGGCGATGAGGTTGACAAAAAGAATGCCGATAGTGGCTTGGAATATT
TTCTGTATTTATCATCCATCATAAAGATTCCTGTTATAACTTGGTTTCCC
GATAGGTCGGGTCAAATGGAAAATTATGCAAATTCCATGGCGTTACGTCT
CGAGCCAATGAATTGGCATATTGCTCGTGCATTTGTTGATTTCATGCAGG
CGTACAACTGGGACCTTGTTACAATAGTCATGAGTTCGAAACAGAGAGAA
AAAAATACCTTCCTCAAGGAATTAAGAAACGTTCAGAAAGAACGAAGCAA
CATAGAGAATAATAATCACTTCCCATTCACAATTTCAGATGTTCACACTT
TCGAAGGTCTGGAGAGCGATGAATTGCACAATTGTATTCTACAGATGCAC
CGATGTCGAACAATTAAAACAATGCTTGTTGCATTGGAAAGAATATTTAA
AAACAACGACCGAATTGTGATATTTCTTGGGAATAAAGTGGAATTAGTGG
CACTAATTGCAGCGGTAAGAAAATCAAATGGACCGAAACGTTATTTGAAA
AAACTGCTTGGTAAAGGTTACTTGTGGATTTGCGCTCCATCATTCATGAA
TCCAATAGAAACATCGGAACGCAGCAATTCCATCCAATTAGATAACATCG
TCATTCAAAACTGGATTAGTAAAGAAGGGATGCAAGTTTCGGGAATGTTT
TTTCTTGCGTGTTTAAATCACTACTCGATTTACAGGAAAAAAACGGAATT
TGTTAGAATATTGTGGCAGAAATCACTACTGAAACTCATTCAGTTCATTA
AAGAAAGATTCCCTTCAAATTCGACAGATTTGAAGAATAAAATCATTCCG
AAAGGAATTTGCAACAGCAATGAGTCGGTATGGAAATGGGGGAAAAGATT
GTATCAGATTATGAAGTCGGAAACTGTGGAATTCGAGGACGAGTATATAG
GTTTCCATAGCAATGGGGCCATAAATACGACTGAGCTGTTCATTTTCAAC
TCCAAAACCGTCCAGGGTAGAATGAGATGGTTTAAAGTCGGCAAGTGGTC
GATGAGCAGCAAATGGGGCAAAACGAAATCAAAAATTCGAATAGATGGAG
TCACTTGGCCCGGAGGAGAAAACAAACCACCGAAAGGTCGACCCGATAAA
GTCAAACTGAGAGTAGCTACTATACAAGAAATGCCATTTGTATTCTATGG
GAAACGATTAGAAAATGGTAAATGCGACGTTAATGCTATTCCTTGTCGAA
TTTTACAAAAGGCTCCAGATGAATCGGATGCTGGAAAGGTGTATGAAGAC
GATGAAGAAGAGGTTATTTATAAAAGACCAGACACAATATCAAGTTCCAA
CAGTTCTGGAAAGTTTCCAATTTATGTTCATTCTTGTTGTGCTGGCTTAA
CGATGGATCTTCTTAATGAAATGATGAAGGATTTGAATTTTGTCGTTGAT
TTATTTGAAGTTCCAGACGGAAAATGGGGAGGATGGACTCCACAAGGATG
GAATGGATTGGTCAAAGTTCTTTTGGATGGTAAAGCCGATTTGGTTATGA
CATCCCTAAAAATCACTCCGAATCGAAGTGAACAAATAGATTTCAGTGCT
CCTTTCATGGAGACCGGAATCGCCATTATCGTTGCGTTAAGAAAAGGAGC
GATTTCACCGACGGCGTTTCTGGAACCTTATGACTATCCATCATGGTGCC
TCATTCTCGTATTCAGTGTTCATGCATGTGGAGCTGCTTTGTTCATTTAT
GAATGGCTCAGTCCTCACGGGCTGGATCGTGGCAATATCCAACGAGCAGA
TCATAAATTTTCACTCGTTCGATCACTTTGGTTGATCTGGTCAATGTTGT
TTGGTGCCGCGGTGAACACAGATAATCCGCGAGGAGTGGCAAGCAGGTTT
CTCGCTAATATATGGGCTCTATTTGCCTTGGTGTTTCTAGCAAGCTACAC
GGCTAATTTAGCAGCTTTTATGATAGCAAAGGATGATTTTTACGATCTCT
CTGGAATCAAAGATTGGCGGTTAATGAATCCTCATACTCACAAACCGATA
TTCCGGTTTGCGACGGTTCCGAGTGGGGCAACTGAAGAAAATGTGAAAAT
AAATTTCCCTAAAATGTTTAAATACATGCAAAATTTTAACAAAACAACAG
TTGACGATGGCATCAAAGCACTGAAAACTGGGGAAATTGACGCTTTTATC
TATGATTCAAATGTCCTAGATTACAAGGCGGCTAAGGACAAGAAGTGTAA
ATTGAAAACTGTTGGGAACCTTTATGCTATGACCGGATACGGAGTTGGGT
TCCCGAAGGGATCAAAATGGCGACAGAAAATCAATGATTTGATATTGCAA
TATCAGAGATATGGTAAACTACAGAGAGCAAAACGTTTCTGGATGACTGG
TCAATGTAAAAAACAACGAACACTTGACAGTACTAATAAAAGACTTGGAG
TAACCAACTTTATTAGTGCATTTATCTTGCTGCTGGCTGGGATGTTTGTT
TGTTCAACAATTTTGTTTTTGGAACATTTGTTTTTTCGATATCTCAGATT
AAAAGTGAGGAAAACAGATCGGTACGGTTGTTGTCAGTTGGTCAGCATCA
GTCTAAGTCAAATGATGAATTACGAACCAACTGTCAACAAGTCAGCGGAT
ACCTTGAAATCGTCCTTGTGCTCAAATAATCCGAGCAATTCGTCCCAATC
AAGGCTGAAACAAGAAAATGAGTTTCTGAAACAGAAAATACAAAAGCTCG
AAATCGCATTGTCATATATGGCAGGATGTGACGAACTTCATCGATCAAAC
ACGAAGCATCTAGATATTCCTAAAGATACAACTGATGTCTCAATTTCATT
ATCTAATTATCTGACTCTGCGTGAAAGGAGAAATCGTGATGAAGCTGAAT
GCAAGGAGGACAATAATAAGGAGACAACAAAGGAGCCTGCGGTATTGTAC
CGCTGTGAAGATCAACAAGACATATCGATTTATTGTCCAAAGCACATTCA
GTTGTACAATCAAAAACATTCAAGACATCATTCCTTTTATACTTTGCCGA
AGTGTCAAAACTTCGACAGGAGCCAGCACAATTGCTTGAACGCCGTGAAA
GATATACGGAAATATCCTTCGTGTAACAACGTTTCCTCTCAGTCGAAATC
TTTGAAACCCATTCAGAACTCCTCTGAAAAATATAAGATTATAAAATCGA
TCTCACCAAATAATTTGTACAGATTTTCAAATTCTTCATTTTCCACATTT
CTATTGAAAGGTAAGAGAAAAAAAGATGAAATGCTAGTAAAAGAGTCGTG
TTTATGAATAGGAACAATTTCTATTGATTTGTGGTTTTTTATTGATTTGA
ATTTGGTGCAATTGCGTTGCCATGGATTCATTTTTAAATAATAAATTTTA
TCAGTGTGC
back to top

protein sequence of SMED30003957-orf-1

>SMED30003957-orf-1 ID=SMED30003957-orf-1|Name=SMED30003957-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1222bp
MTLLNFIYSSSVFVLYFLSTRADFDASSLIRIRLKAIHFENNVANLQKST
IKYEALDEDLQHLIKLMKENPMKSSLDLTFNYEKYFRTNFNPRKMMRMVC
KEFQGTRIQPITNTLLLVNDDGDEVDKKNADSGLEYFLYLSSIIKIPVIT
WFPDRSGQMENYANSMALRLEPMNWHIARAFVDFMQAYNWDLVTIVMSSK
QREKNTFLKELRNVQKERSNIENNNHFPFTISDVHTFEGLESDELHNCIL
QMHRCRTIKTMLVALERIFKNNDRIVIFLGNKVELVALIAAVRKSNGPKR
YLKKLLGKGYLWICAPSFMNPIETSERSNSIQLDNIVIQNWISKEGMQVS
GMFFLACLNHYSIYRKKTEFVRILWQKSLLKLIQFIKERFPSNSTDLKNK
IIPKGICNSNESVWKWGKRLYQIMKSETVEFEDEYIGFHSNGAINTTELF
IFNSKTVQGRMRWFKVGKWSMSSKWGKTKSKIRIDGVTWPGGENKPPKGR
PDKVKLRVATIQEMPFVFYGKRLENGKCDVNAIPCRILQKAPDESDAGKV
YEDDEEEVIYKRPDTISSSNSSGKFPIYVHSCCAGLTMDLLNEMMKDLNF
VVDLFEVPDGKWGGWTPQGWNGLVKVLLDGKADLVMTSLKITPNRSEQID
FSAPFMETGIAIIVALRKGAISPTAFLEPYDYPSWCLILVFSVHACGAAL
FIYEWLSPHGLDRGNIQRADHKFSLVRSLWLIWSMLFGAAVNTDNPRGVA
SRFLANIWALFALVFLASYTANLAAFMIAKDDFYDLSGIKDWRLMNPHTH
KPIFRFATVPSGATEENVKINFPKMFKYMQNFNKTTVDDGIKALKTGEID
AFIYDSNVLDYKAAKDKKCKLKTVGNLYAMTGYGVGFPKGSKWRQKINDL
ILQYQRYGKLQRAKRFWMTGQCKKQRTLDSTNKRLGVTNFISAFILLLAG
MFVCSTILFLEHLFFRYLRLKVRKTDRYGCCQLVSISLSQMMNYEPTVNK
SADTLKSSLCSNNPSNSSQSRLKQENEFLKQKIQKLEIALSYMAGCDELH
RSNTKHLDIPKDTTDVSISLSNYLTLRERRNRDEAECKEDNNKETTKEPA
VLYRCEDQQDISIYCPKHIQLYNQKHSRHHSFYTLPKCQNFDRSQHNCLN
AVKDIRKYPSCNNVSSQSKSLKPIQNSSEKYKIIKSISPNNLYRFSNSSF
STFLLKGKRKKDEMLVKESCL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015276ligand-gated ion channel activity
GO:0038023signaling receptor activity
GO:0005216ion channel activity
GO:0004872receptor activity
GO:0005234extracellular-glutamate-gated ion channel activity
GO:0004970ionotropic glutamate receptor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001508Iono_rcpt_met
IPR019594Glu/Gly-bd
IPR001320Iontro_rcpt
IPR001638Solute-binding_3/MltF_N
IPR028082Peripla_BP_I
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0098794postsynapse
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0034220ion transmembrane transport
GO:0035235ionotropic glutamate receptor signaling pathway
GO:0060079excitatory postsynaptic potential
GO:0006810transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1019..1039
NoneNo IPR availableCOILSCoilCoilcoord: 197..224
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 583..933
e-value: 3.5E-92
score: 310.9
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 669..961
e-value: 3.5E-92
score: 310.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 172..350
e-value: 7.1E-8
score: 34.5
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 659..883
e-value: 3.5E-92
score: 310.9
NoneNo IPR availablePANTHERPTHR18966IONOTROPIC GLUTAMATE RECEPTORcoord: 139..951
NoneNo IPR availablePANTHERPTHR18966:SF391NMDA RECEPTOR 2, ISOFORM Ccoord: 139..951
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.46
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 505..919
NoneNo IPR availableTMHMMTMhelixcoord: 757..779
NoneNo IPR availableTMHMMTMhelixcoord: 681..703
NoneNo IPR availableTMHMMTMhelixcoord: 723..742
NoneNo IPR availableTMHMMTMhelixcoord: 937..959
IPR001508Ionotropic glutamate receptor, metazoaPRINTSPR00177NMDARECEPTORcoord: 722..746
score: 20.0
coord: 753..780
score: 53.57
coord: 940..964
score: 20.0
coord: 685..710
score: 30.38
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainSMARTSM00918Lig_chan_Glu_bd_2coord: 576..629
e-value: 6.6E-7
score: 39.0
IPR001320Ionotropic glutamate receptorSMARTSM00079GluR_14coord: 564..920
e-value: 3.2E-43
score: 159.6
IPR001320Ionotropic glutamate receptorPFAMPF00060Lig_chancoord: 919..951
e-value: 6.1E-28
score: 98.1
IPR001638Solute-binding protein family 3/N-terminal domain of MltFPFAMPF00497SBP_bac_3coord: 584..918
e-value: 1.7E-23
score: 83.3
IPR028082Periplasmic binding protein-like ISUPERFAMILYSSF53822Periplasmic binding protein-like Icoord: 137..501