EF-hand domain family, member D1

Overview
NameEF-hand domain family, member D1
Smed IDSMED30003944
Length (bp)965
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EF-hand domain family, member D1 (SMED30003944) t-SNE clustered cells

Violin plots show distribution of expression levels for EF-hand domain family, member D1 (SMED30003944) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EF-hand domain family, member D1 (SMED30003944) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EF-hand domain family, member D1 (SMED30003944) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003944

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30003944SMESG000064891.1 Contig658GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30003944SMESG000009754.1 Contig658GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30003944SMESG000009754.1 dd_Smed_v4_1467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30003944SMESG000009754.1 dd_Smed_v4_1467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003944SMESG000009754.1 dd_Smed_v4_1467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30003944SMESG000009754.1 dd_Smed_v4_1467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003944SMESG000009754.1 dd_Smed_v4_1467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EF-hand domain family, member D1 vs. Ensembl Human
Match: EFHD1 (EF-hand domain family member D1 [Source:HGNC Symbol;Acc:HGNC:29556])

HSP 1 Score: 164.081 bits (414), Expect = 1.321e-48
Identity = 87/166 (52.41%), Postives = 117/166 (70.48%), Query Frame = 3
Query:  153 ELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIARDQEMTNEI 650
            ELS++L+RR+D  E      G   P + +VFNPYTEF EFSR+ IK+LE+ FK YD  RD F+   +LK MMEKLG PQTHLGLK MIK++DED D K+SFR+F+ +F KA AG++  D+ LM+L  K  E++ VA+E  GVKGAK+FFE+KV  ++   +   E+
Sbjct:   54 ELSAQLSRRLDINE------GAARPRRCRVFNPYTEFPEFSRRLIKDLESMFKLYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDEDFDGKLSFREFLLIFHKAAAGELQEDSGLMALA-KLSEID-VALE--GVKGAKNFFEAKVQALSSASKFEAEL 209          
BLAST of EF-hand domain family, member D1 vs. Ensembl Human
Match: EFHD2 (EF-hand domain family member D2 [Source:HGNC Symbol;Acc:HGNC:28670])

HSP 1 Score: 162.155 bits (409), Expect = 7.890e-48
Identity = 85/156 (54.49%), Postives = 107/156 (68.59%), Query Frame = 3
Query:  153 ELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKI 620
            ELS+KL RR D  +      G+      +VFNPYTEFKEFSRK+IK++E  FK+YD  RD F+   +LK MMEKLG PQTHLGLK MIK++DED D+K+SFR+F+ +FRKA AG++  D+ L  L      L  + V   GVKGAKSFFE+KV  I
Sbjct:   54 ELSAKLLRRADLNQGI----GEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLA----RLSEIDVSSEGVKGAKSFFEAKVQAI 201          
BLAST of EF-hand domain family, member D1 vs. Ensembl Human
Match: EFHD1 (EF-hand domain family member D1 [Source:HGNC Symbol;Acc:HGNC:29556])

HSP 1 Score: 116.316 bits (290), Expect = 1.779e-31
Identity = 60/115 (52.17%), Postives = 83/115 (72.17%), Query Frame = 3
Query:  306 FKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIARDQEMTNEI 650
            F++YD  RD F+   +LK MMEKLG PQTHLGLK MIK++DED D K+SFR+F+ +F KA AG++  D+ LM+L  K  E++ VA+E  GVKGAK+FFE+KV  ++   +   E+
Sbjct:    2 FRRYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDEDFDGKLSFREFLLIFHKAAAGELQEDSGLMALA-KLSEID-VALE--GVKGAKNFFEAKVQALSSASKFEAEL 112          
BLAST of EF-hand domain family, member D1 vs. Ensembl Human
Match: EFHD2 (EF-hand domain family member D2 [Source:HGNC Symbol;Acc:HGNC:28670])

HSP 1 Score: 117.087 bits (292), Expect = 2.564e-31
Identity = 59/113 (52.21%), Postives = 75/113 (66.37%), Query Frame = 3
Query:  306 FKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIARDQEMTN 644
            FK+YD  RD F+   +LK MMEKLG PQTHLGLK MIK++DED D+K+SFR+F+ +FRKA AG++  D+ L  L      L  + V   GVKGAKSFFE+K   + R    T 
Sbjct:    4 FKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVL----ARLSEIDVSSEGVKGAKSFFEAKWNWVCRWAPRTG 112          
BLAST of EF-hand domain family, member D1 vs. Ensembl Human
Match: EFHD1 (EF-hand domain family member D1 [Source:HGNC Symbol;Acc:HGNC:29556])

HSP 1 Score: 113.235 bits (282), Expect = 3.321e-30
Identity = 59/113 (52.21%), Postives = 81/113 (71.68%), Query Frame = 3
Query:  312 KYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIARDQEMTNEI 650
            +YD  RD F+   +LK MMEKLG PQTHLGLK MIK++DED D K+SFR+F+ +F KA AG++  D+ LM+L  K  E++ VA+E  GVKGAK+FFE+KV  ++   +   E+
Sbjct:    5 QYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDEDFDGKLSFREFLLIFHKAAAGELQEDSGLMALA-KLSEID-VALE--GVKGAKNFFEAKVQALSSASKFEAEL 113          
BLAST of EF-hand domain family, member D1 vs. Ensembl Celegans
Match: efhd-1 (EF HanD calcium binding protein [Source:UniProtKB/TrEMBL;Acc:Q8I0Z7])

HSP 1 Score: 116.701 bits (291), Expect = 3.147e-31
Identity = 62/135 (45.93%), Postives = 88/135 (65.19%), Query Frame = 3
Query:  210 DGDVVPTQF-KVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKV 611
            +G+ VP +  K  + Y EF EFSRK+I+     FKKYD+D+DS++ F++LK MMEKLG  QTH+ LK++IK +DED D KIS R+F  +FR A +G++       +L       ESV V   GV GA +FF++K+
Sbjct:   33 EGENVPLKMNKKISLYAEFSEFSRKQIQYFSGIFKKYDEDQDSYIDFNELKRMMEKLGEAQTHIALKELIKKVDEDQDGKISQREFFLIFRLAASGELSCSEVFKTL------AESVDVSKEGVLGAANFFQAKI 161          
BLAST of EF-hand domain family, member D1 vs. Ensembl Celegans
Match: efhd-1 (EF HanD calcium binding protein [Source:UniProtKB/TrEMBL;Acc:Q8I0Z7])

HSP 1 Score: 115.931 bits (289), Expect = 3.543e-31
Identity = 62/134 (46.27%), Postives = 87/134 (64.93%), Query Frame = 3
Query:  213 GDVVPTQF-KVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKV 611
            G+ VP +  K  + Y EF EFSRK+I+     FKKYD+D+DS++ F++LK MMEKLG  QTH+ LK++IK +DED D KIS R+F  +FR A +G++       +L       ESV V   GV GA +FF++K+
Sbjct:   10 GENVPLKMNKKISLYAEFSEFSRKQIQYFSGIFKKYDEDQDSYIDFNELKRMMEKLGEAQTHIALKELIKKVDEDQDGKISQREFFLIFRLAASGELSCSEVFKTL------AESVDVSKEGVLGAANFFQAKI 137          
BLAST of EF-hand domain family, member D1 vs. Ensembl Celegans
Match: efhd-1 (EF HanD calcium binding protein [Source:UniProtKB/TrEMBL;Acc:Q8I0Z7])

HSP 1 Score: 117.087 bits (292), Expect = 6.907e-29
Identity = 62/135 (45.93%), Postives = 88/135 (65.19%), Query Frame = 3
Query:  210 DGDVVPTQF-KVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKV 611
            +G+ VP +  K  + Y EF EFSRK+I+     FKKYD+D+DS++ F++LK MMEKLG  QTH+ LK++IK +DED D KIS R+F  +FR A +G++       +L       ESV V   GV GA +FF++K+
Sbjct:  517 EGENVPLKMNKKISLYAEFSEFSRKQIQYFSGIFKKYDEDQDSYIDFNELKRMMEKLGEAQTHIALKELIKKVDEDQDGKISQREFFLIFRLAASGELSCSEVFKTLA------ESVDVSKEGVLGAANFFQAKI 645          
BLAST of EF-hand domain family, member D1 vs. Ensembl Celegans
Match: efhd-1 (EF HanD calcium binding protein [Source:UniProtKB/TrEMBL;Acc:Q8I0Z7])

HSP 1 Score: 117.087 bits (292), Expect = 6.907e-29
Identity = 62/135 (45.93%), Postives = 88/135 (65.19%), Query Frame = 3
Query:  210 DGDVVPTQF-KVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKV 611
            +G+ VP +  K  + Y EF EFSRK+I+     FKKYD+D+DS++ F++LK MMEKLG  QTH+ LK++IK +DED D KIS R+F  +FR A +G++       +L       ESV V   GV GA +FF++K+
Sbjct:  517 EGENVPLKMNKKISLYAEFSEFSRKQIQYFSGIFKKYDEDQDSYIDFNELKRMMEKLGEAQTHIALKELIKKVDEDQDGKISQREFFLIFRLAASGELSCSEVFKTLA------ESVDVSKEGVLGAANFFQAKI 645          
BLAST of EF-hand domain family, member D1 vs. Ensembl Celegans
Match: cal-8 (CALmodulin related genes [Source:UniProtKB/TrEMBL;Acc:Q09980])

HSP 1 Score: 45.8246 bits (107), Expect = 5.643e-6
Identity = 24/67 (35.82%), Postives = 39/67 (58.21%), Query Frame = 3
Query:  279 KEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFR 479
            KE + L + F  +D++ D  +  DDL ++M +LG   T    K+MIK  D DHD  I F++F+ + +
Sbjct:   77 KEERELRDVFNVFDKNGDGVISIDDLIFVMCQLGEKLTETEAKEMIKQGDLDHDGMIDFQEFVNIIK 143          
BLAST of EF-hand domain family, member D1 vs. Ensembl Fly
Match: Swip-1 (gene:FBgn0032731 transcript:FBtr0081185)

HSP 1 Score: 155.992 bits (393), Expect = 4.965e-46
Identity = 82/168 (48.81%), Postives = 112/168 (66.67%), Query Frame = 3
Query:  147 TNELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIARDQEMTNEI 650
            ++EL+  LNRR + +E+     G  V   +KV N YT+F EFSR +IK+ +  F  YD  RD FL   +LK+MMEKLG PQTHLGLKQMI ++DED+D KISFR+F+ +FRKA+AG++  D+ L  L      L  V VE +GV GAK+FFE+K+ +  R  +  +EI
Sbjct:   27 SSELTHILNRRQEIMESQEA--GIEVRRTYKVVNVYTDFPEFSRNQIKDYQKTFNTYDTARDGFLDLQELKFMMEKLGAPQTHLGLKQMIAEVDEDNDGKISFREFLLIFRKAQAGELDSDSGLNQL----ARLTEVDVEQVGVSGAKNFFEAKIEQQLRTNKFHDEI 188          
BLAST of EF-hand domain family, member D1 vs. Ensembl Fly
Match: Swip-1 (gene:FBgn0032731 transcript:FBtr0340322)

HSP 1 Score: 155.992 bits (393), Expect = 4.965e-46
Identity = 82/168 (48.81%), Postives = 112/168 (66.67%), Query Frame = 3
Query:  147 TNELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIARDQEMTNEI 650
            ++EL+  LNRR + +E+     G  V   +KV N YT+F EFSR +IK+ +  F  YD  RD FL   +LK+MMEKLG PQTHLGLKQMI ++DED+D KISFR+F+ +FRKA+AG++  D+ L  L      L  V VE +GV GAK+FFE+K+ +  R  +  +EI
Sbjct:   27 SSELTHILNRRQEIMESQEA--GIEVRRTYKVVNVYTDFPEFSRNQIKDYQKTFNTYDTARDGFLDLQELKFMMEKLGAPQTHLGLKQMIAEVDEDNDGKISFREFLLIFRKAQAGELDSDSGLNQL----ARLTEVDVEQVGVSGAKNFFEAKIEQQLRTNKFHDEI 188          
BLAST of EF-hand domain family, member D1 vs. Ensembl Fly
Match: CG14861 (gene:FBgn0038280 transcript:FBtr0083023)

HSP 1 Score: 61.6178 bits (148), Expect = 2.462e-10
Identity = 38/127 (29.92%), Postives = 65/127 (51.18%), Query Frame = 3
Query:  270 FSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDI--------GHDNPLMSLYD----KYMELESVAVEDIGVKGAKSFFESKVA 614
            F++KEI    + F + D+D D ++   +LK  +EKL +PQTHL  K ++  +  +H  +++F   + ++     G +        GH      L D    +    ++V V  +GV GAK FFE+K+A
Sbjct:  201 FNQKEIDTAYSCFTQMDEDLDGYISLGELKRFLEKLEMPQTHLATKNVMTHVVGNHLERLTFCHALLIY-----GTVLNRLELRKGH------LLDRERLRLARSKAVDVSKVGVSGAKQFFEAKIA 316          
BLAST of EF-hand domain family, member D1 vs. Ensembl Zebrafish
Match: efhd1 (EF-hand domain family, member D1 [Source:ZFIN;Acc:ZDB-GENE-030131-7461])

HSP 1 Score: 171.014 bits (432), Expect = 1.117e-51
Identity = 91/197 (46.19%), Postives = 122/197 (61.93%), Query Frame = 3
Query:   33 QLAEKLSNRKGASENEAETSENIDKLITNKKEINSDQPTNELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIA 623
            +LA KL  R  A  N     E             SD  T+EL+ KLNRR+D        DG   P Q KVFNPYTEFKEFSRK+IK++E  FK++D  +D F+   +LK MMEKLG PQTHLGLK MIK++DED+D K+S+R+F+ +FR+A AG++  ++ LM+L      L  + V   GV GA+ FFE+K   ++
Sbjct:    5 ELARKLQRRLDADTNPGTQDEETP---VKPATTMSDDTTSELTEKLNRRLDI------HDGTAKPKQMKVFNPYTEFKEFSRKQIKDMETMFKRFDSGKDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDYDGKLSYREFLLIFRRAAAGELQEESGLMAL----ARLSEIDVSTEGVLGARDFFEAKAQALS 188          
BLAST of EF-hand domain family, member D1 vs. Ensembl Zebrafish
Match: efhd2 (EF-hand domain family, member D2 [Source:ZFIN;Acc:ZDB-GENE-060531-152])

HSP 1 Score: 162.925 bits (411), Expect = 2.453e-48
Identity = 95/211 (45.02%), Postives = 128/211 (60.66%), Query Frame = 3
Query:   33 QLAEKLSNRKGASENEAETSENIDKLITNKKEINSDQPT-----NELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIARDQEMTNEI 650
            +L+ KL+ R    +   E +  +D+   N      D+PT     +EL +KL RR +  E      G+      KVFNPYTEFKEFSRK+IK++E  FK+YD ++D+++   +LK MMEKLG PQTHLGLK MIK++DED D K+SFR+F+ +FRKA AG++  D+ L  L      L  + V   GVKGAKSFFE+KV  I        EI
Sbjct:    5 ELSSKLNRRLKIEDGSHEPAAALDEAHENGAH---DKPTTSSADSELGAKLQRRGELNEGV----GEHQQPSMKVFNPYTEFKEFSRKQIKDMEKMFKQYDSEKDNYIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDLDGKLSFREFLLIFRKAAAGELAEDSGLHVL----ARLSEIDVSTEGVKGAKSFFEAKVQAINESNRFEAEI 204          
BLAST of EF-hand domain family, member D1 vs. Ensembl Zebrafish
Match: efhd2 (EF-hand domain family, member D2 [Source:ZFIN;Acc:ZDB-GENE-060531-152])

HSP 1 Score: 162.925 bits (411), Expect = 2.453e-48
Identity = 95/211 (45.02%), Postives = 128/211 (60.66%), Query Frame = 3
Query:   33 QLAEKLSNRKGASENEAETSENIDKLITNKKEINSDQPT-----NELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIARDQEMTNEI 650
            +L+ KL+ R    +   E +  +D+   N      D+PT     +EL +KL RR +  E      G+      KVFNPYTEFKEFSRK+IK++E  FK+YD ++D+++   +LK MMEKLG PQTHLGLK MIK++DED D K+SFR+F+ +FRKA AG++  D+ L  L      L  + V   GVKGAKSFFE+KV  I        EI
Sbjct:    5 ELSSKLNRRLKIEDGSHEPAAALDEAHENGAH---DKPTTSSADSELGAKLQRRGELNEGV----GEHQQPSMKVFNPYTEFKEFSRKQIKDMEKMFKQYDSEKDNYIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDLDGKLSFREFLLIFRKAAAGELAEDSGLHVL----ARLSEIDVSTEGVKGAKSFFEAKVQAINESNRFEAEI 204          
BLAST of EF-hand domain family, member D1 vs. Ensembl Zebrafish
Match: aif1l (allograft inflammatory factor 1-like [Source:ZFIN;Acc:ZDB-GENE-030131-9646])

HSP 1 Score: 47.7506 bits (112), Expect = 1.167e-6
Identity = 22/65 (33.85%), Postives = 41/65 (63.08%), Query Frame = 3
Query:  282 EIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLF 476
            ++ + +N + ++D +    +    LK MMEKLGVP+THL +K+MI ++     + I++RDF+ + 
Sbjct:   20 KLDSFKNKYAEFDLNDQGEIDMMGLKRMMEKLGVPKTHLQMKKMISEVTGGCSDTINYRDFVKMM 84          
BLAST of EF-hand domain family, member D1 vs. Ensembl Zebrafish
Match: aif1l (allograft inflammatory factor 1-like [Source:ZFIN;Acc:ZDB-GENE-030131-9646])

HSP 1 Score: 47.7506 bits (112), Expect = 2.031e-6
Identity = 22/65 (33.85%), Postives = 41/65 (63.08%), Query Frame = 3
Query:  282 EIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLF 476
            ++ + +N + ++D +    +    LK MMEKLGVP+THL +K+MI ++     + I++RDF+ + 
Sbjct:   46 KLDSFKNKYAEFDLNDQGEIDMMGLKRMMEKLGVPKTHLQMKKMISEVTGGCSDTINYRDFVKMM 110          
BLAST of EF-hand domain family, member D1 vs. Ensembl Xenopus
Match: alg6 (ALG6, alpha-1,3-glucosyltransferase [Source:Xenbase;Acc:XB-GENE-998187])

HSP 1 Score: 167.162 bits (422), Expect = 6.965e-50
Identity = 89/168 (52.98%), Postives = 121/168 (72.02%), Query Frame = 3
Query:  150 NELSSKLNRRIDTIENATGADGDVVPT-QFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIARDQEMTNEI 650
            +ELS+KLNRR D   NA    G+ VP  + KVFNPYTEFKEFSRK+IK++E  FKKYD  +D F+   +LK++MEKLG PQTHLGLK MIK++DED DNK++FR+F+ +F KA AG++  D+ L++L     +L  + V+  GVKGAK+FFE+KV  ++   +   EI
Sbjct:   49 SELSAKLNRRQDI--NA----GNAVPANRGKVFNPYTEFKEFSRKQIKDMEAMFKKYDSGKDGFIDMMELKFLMEKLGAPQTHLGLKNMIKEVDEDFDNKLNFREFLLIFHKAAAGELEEDSGLLAL----AKLSEIDVDVEGVKGAKNFFEAKVQALSSSSKFEAEI 206          
BLAST of EF-hand domain family, member D1 vs. Ensembl Xenopus
Match: gja5 (gap junction protein alpha 5 [Source:Xenbase;Acc:XB-GENE-490481])

HSP 1 Score: 159.073 bits (401), Expect = 3.795e-47
Identity = 85/176 (48.30%), Postives = 112/176 (63.64%), Query Frame = 3
Query:  150 NELSSKLNRRIDTIENATGADGDVVPTQ---------FKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIARDQEMTNEI 650
            +EL+S+LNRR+   ++     GD  P Q          +VFNPYTEFKEFSRK+IK++E  F+++D   D F+   +LK MMEKLG PQTHLGLK MIK++DED D K+SFR+F+ +FRKA AG++  D+ L +L      L  + V   GVKGAK FFE+KV  I        EI
Sbjct:    5 DELASRLNRRLRMEDDG----GDTTPEQTRRREQSPCMRVFNPYTEFKEFSRKQIKDMEKMFRQFDAGHDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDGKLSFREFLLIFRKAAAGELEEDSGLHALA----RLSEIDVSIEGVKGAKCFFEAKVQAINHGSRFEQEI 172          
BLAST of EF-hand domain family, member D1 vs. Ensembl Mouse
Match: Efhd2 (EF hand domain containing 2 [Source:MGI Symbol;Acc:MGI:106504])

HSP 1 Score: 158.303 bits (399), Expect = 1.436e-46
Identity = 83/157 (52.87%), Postives = 108/157 (68.79%), Query Frame = 3
Query:  150 NELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKI 620
            +ELS+KL RR D  +      G+      +VFNPYTEFKEFSRK+IK++E  FK+YD  RD F+   +LK MMEKLG PQTHLGLK MI+++DED D+K+SFR+F+ +FRKA AG++  D+ L  L      L  + V   GVKGAK+FFE+KV  I
Sbjct:   53 DELSAKLLRRADLNQGI----GEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIQEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLHVL----ARLSEIDVSTEGVKGAKNFFEAKVQAI 201          
BLAST of EF-hand domain family, member D1 vs. Ensembl Mouse
Match: Efhd1 (EF hand domain containing 1 [Source:MGI Symbol;Acc:MGI:1921607])

HSP 1 Score: 158.303 bits (399), Expect = 1.483e-46
Identity = 83/167 (49.70%), Postives = 116/167 (69.46%), Query Frame = 3
Query:  150 NELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIARDQEMTNEI 650
            +EL+ KL+RR+D  +      G   P + KVFNPYTEF EFSR+ +K+LE  FK YD  RD F+   +LK MMEKLG PQTHLGLK MIK++DED D K+SFR+F+ +F KA AG++  D+ L++L  K+ E++ VA+E  GV+GAK+FFE+K   ++   +   E+
Sbjct:   54 SELNLKLSRRLDIHQ------GTARPGRSKVFNPYTEFPEFSRRLLKDLEKMFKTYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDEDFDGKLSFREFLLIFHKAAAGELQEDSGLLALA-KFSEID-VALE--GVRGAKNFFEAKAQALSCSSKFEAEL 210          
BLAST of EF-hand domain family, member D1 vs. Ensembl Mouse
Match: Efhd1 (EF hand domain containing 1 [Source:MGI Symbol;Acc:MGI:1921607])

HSP 1 Score: 158.303 bits (399), Expect = 1.483e-46
Identity = 83/167 (49.70%), Postives = 116/167 (69.46%), Query Frame = 3
Query:  150 NELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIARDQEMTNEI 650
            +EL+ KL+RR+D  +      G   P + KVFNPYTEF EFSR+ +K+LE  FK YD  RD F+   +LK MMEKLG PQTHLGLK MIK++DED D K+SFR+F+ +F KA AG++  D+ L++L  K+ E++ VA+E  GV+GAK+FFE+K   ++   +   E+
Sbjct:   54 SELNLKLSRRLDIHQ------GTARPGRSKVFNPYTEFPEFSRRLLKDLEKMFKTYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDEDFDGKLSFREFLLIFHKAAAGELQEDSGLLALA-KFSEID-VALE--GVRGAKNFFEAKAQALSCSSKFEAEL 210          
BLAST of EF-hand domain family, member D1 vs. Ensembl Mouse
Match: Aif1l (allograft inflammatory factor 1-like [Source:MGI Symbol;Acc:MGI:1919598])

HSP 1 Score: 49.6766 bits (117), Expect = 5.575e-7
Identity = 22/57 (38.60%), Postives = 37/57 (64.91%), Query Frame = 3
Query:  306 FKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLF 476
            + ++D + +  +    LK MMEKLGVP+THL +K+MI ++     + IS+RDF+ + 
Sbjct:   56 YMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMM 112          
BLAST of EF-hand domain family, member D1 vs. Ensembl Mouse
Match: Calm4 (calmodulin 4 [Source:MGI Symbol;Acc:MGI:1931464])

HSP 1 Score: 48.9062 bits (115), Expect = 7.690e-7
Identity = 24/75 (32.00%), Postives = 44/75 (58.67%), Query Frame = 3
Query:  270 FSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAG 494
            F+++E+   +  F ++D+++D  +  ++L  +M++LG       LK +I  +D D D KISF +F+T   K K G
Sbjct:    5 FTKEEVAEFQAAFNRFDKNKDGHISVEELGDVMKQLGKNLPEKDLKALISKLDTDGDGKISFEEFLTAIEKYKKG 79          
BLAST of EF-hand domain family, member D1 vs. UniProt/SwissProt
Match: sp|Q9BUP0|EFHD1_HUMAN (EF-hand domain-containing protein D1 OS=Homo sapiens OX=9606 GN=EFHD1 PE=1 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 6.346e-48
Identity = 87/166 (52.41%), Postives = 117/166 (70.48%), Query Frame = 3
Query:  153 ELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIARDQEMTNEI 650
            ELS++L+RR+D  E      G   P + +VFNPYTEF EFSR+ IK+LE+ FK YD  RD F+   +LK MMEKLG PQTHLGLK MIK++DED D K+SFR+F+ +F KA AG++  D+ LM+L  K  E++ VA+E  GVKGAK+FFE+KV  ++   +   E+
Sbjct:   54 ELSAQLSRRLDINE------GAARPRRCRVFNPYTEFPEFSRRLIKDLESMFKLYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDEDFDGKLSFREFLLIFHKAAAGELQEDSGLMALA-KLSEID-VALE--GVKGAKNFFEAKVQALSSASKFEAEL 209          
BLAST of EF-hand domain family, member D1 vs. UniProt/SwissProt
Match: sp|Q17QM6|EFHD1_BOVIN (EF-hand domain-containing protein D1 OS=Bos taurus OX=9913 GN=EFHD1 PE=2 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.630e-47
Identity = 87/166 (52.41%), Postives = 116/166 (69.88%), Query Frame = 3
Query:  153 ELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIARDQEMTNEI 650
            ELS++LNRR+D  E A        P + KVF+PY+EF EFSR+ IK+LE+ FK YD  RD F+   +LK MMEKLG PQTHLGLK MIK++DED D K+SFR+F+ +F KA AG++  D+ LM+L  K  E++ VA+E  GVKGAK FFE+KV  ++   +   E+
Sbjct:   51 ELSAQLNRRLDINEGAA------RPRRCKVFHPYSEFPEFSRRLIKDLESMFKLYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDEDFDGKLSFREFLLIFHKAAAGELQEDSGLMALA-KLSEID-VALE--GVKGAKDFFEAKVQALSCASKFEAEL 206          
BLAST of EF-hand domain family, member D1 vs. UniProt/SwissProt
Match: sp|Q96C19|EFHD2_HUMAN (EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 3.789e-47
Identity = 85/156 (54.49%), Postives = 107/156 (68.59%), Query Frame = 3
Query:  153 ELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKI 620
            ELS+KL RR D  +      G+      +VFNPYTEFKEFSRK+IK++E  FK+YD  RD F+   +LK MMEKLG PQTHLGLK MIK++DED D+K+SFR+F+ +FRKA AG++  D+ L  L      L  + V   GVKGAKSFFE+KV  I
Sbjct:   54 ELSAKLLRRADLNQGI----GEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLA----RLSEIDVSSEGVKGAKSFFEAKVQAI 201          
BLAST of EF-hand domain family, member D1 vs. UniProt/SwissProt
Match: sp|A5D7A0|EFHD2_BOVIN (EF-hand domain-containing protein D2 OS=Bos taurus OX=9913 GN=EFHD2 PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 3.205e-46
Identity = 84/153 (54.90%), Postives = 106/153 (69.28%), Query Frame = 3
Query:  153 ELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKV 611
            ELS+KL RR D  +      G+      +VFNPYTEFKEFSRK+IK++E  FK+YD  RD F+   +LK MMEKLG PQTHLGLK MIK++DED D+K+SFR+F+ +FRKA AG++  D+ L  L      L  + V   GVKGAKSFFE+KV
Sbjct:   56 ELSAKLLRRADLNQGI----GEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKEYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLHVLA----RLSEIDVSTEGVKGAKSFFEAKV 200          
BLAST of EF-hand domain family, member D1 vs. UniProt/SwissProt
Match: sp|Q9D8Y0|EFHD2_MOUSE (EF-hand domain-containing protein D2 OS=Mus musculus OX=10090 GN=Efhd2 PE=1 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 5.457e-46
Identity = 83/157 (52.87%), Postives = 108/157 (68.79%), Query Frame = 3
Query:  150 NELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKI 620
            +ELS+KL RR D  +      G+      +VFNPYTEFKEFSRK+IK++E  FK+YD  RD F+   +LK MMEKLG PQTHLGLK MI+++DED D+K+SFR+F+ +FRKA AG++  D+ L  L      L  + V   GVKGAK+FFE+KV  I
Sbjct:   53 DELSAKLLRRADLNQGI----GEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIQEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLQVLA----RLSEIDVSTEGVKGAKNFFEAKVQAI 201          
BLAST of EF-hand domain family, member D1 vs. TrEMBL
Match: A0A210R5H0 (EF-hand domain-containing protein D2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT21552 PE=4 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 2.242e-51
Identity = 92/171 (53.80%), Postives = 125/171 (73.10%), Query Frame = 3
Query:  144 PTNELSSKLNRRIDTIENATGADGD--VVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIARDQEMTNEI 650
             T+EL+ KL RR++   N +G DG   V+P+  +V+NPYTEFKEF+RKEI+  +  F KYD  RD F+ F++LK MMEKLG  QTHLGLK MIK++DED+D KISFR+F+ +FRKA+AG++  D+ L +L   Y  LE V V+  GVKGAK+FFE+K+ K  +D++  NEI
Sbjct:    2 ATDELAKKLERRVNI--NESGEDGAEPVLPS-MQVWNPYTEFKEFTRKEIQGFQKTFNKYDTGRDKFIDFEELKVMMEKLGAAQTHLGLKAMIKEVDEDNDGKISFREFLLIFRKARAGELDEDSGLFNL---YQNLEEVDVDKEGVKGAKNFFEAKIDKQTQDKKFENEI 166          
BLAST of EF-hand domain family, member D1 vs. TrEMBL
Match: A0A3Q2XZP0 (EF-hand domain family, member D1 OS=Hippocampus comes OX=109280 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 1.017e-50
Identity = 94/200 (47.00%), Postives = 130/200 (65.00%), Query Frame = 3
Query:   33 QLAEKLSNRKGASENEAETSENIDKLITNK---KEINSDQPTNELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIA 623
            +LA+KL +R  ASE   +  E  + ++T K    E      ++ELS+KLNRR+D  E      G+  P   +VFNPYTEFKEFSRK+IK +E  FK+YD  +D F+   +LK MMEKLG PQTHLGLK MIK++DED D K+SFR+F+ +FR+A AG++  ++ LM+L      L  + V   GV GAK FFE+K+  ++
Sbjct:    5 ELAKKLQSRLAASEETEQRPELEETIVTTKYQESEAACGDTSSELSAKLNRRLDINE------GNAPPRASRVFNPYTEFKEFSRKQIKEMEVMFKRYDTGKDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDGKLSFREFLLIFRRAAAGELQEESGLMAL----ARLSEINVSTEGVSGAKDFFEAKMQALS 194          
BLAST of EF-hand domain family, member D1 vs. TrEMBL
Match: A0A0L8GSR9 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22029165mg PE=4 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 5.202e-49
Identity = 88/156 (56.41%), Postives = 116/156 (74.36%), Query Frame = 3
Query:  144 PTNELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKV 611
             T+EL++ L RRI+ I +A  A G+ V    KVFNPYTEFKEFSRKEIK+LE  FKKYD ++D F+  ++LK MMEKLG PQTHL LK+MIK++DED DNKI+FR+F+ +FRKA A ++  D+ L  LY    E++   V+  GVKGAK+FFE+K+
Sbjct:    2 ATDELATLLTRRIN-ISDALEA-GETVQATAKVFNPYTEFKEFSRKEIKDLEKTFKKYDVNKDKFIDIEELKVMMEKLGAPQTHLALKEMIKEVDEDEDNKINFREFLLIFRKAAAEELNTDSGLYELYQNVWEID---VDKEGVKGAKNFFEAKI 152          
BLAST of EF-hand domain family, member D1 vs. TrEMBL
Match: A0A1A8EHS8 (EF-hand domain family, member D1 OS=Nothobranchius korthausae OX=1143690 GN=EFHD1 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.140e-48
Identity = 96/203 (47.29%), Postives = 134/203 (66.01%), Query Frame = 3
Query:   33 QLAEKLSNRKGASEN---EAETSENIDKLITNKKE-INSDQPT-NELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIAR 626
            +LA+KL +R  ASE      E+ ++  +  T++ +  + D P+ +EL++KLNRR+D        DG   P   +VFNPYTEFKEFSRK IK+LE  FK+YD  RD F+   +LK MMEKLG PQTHLGLK MIK++DED D K+SFR+F+ +FR+A AG++  ++ LM+L      L  + V   GV GAK FFE+KV  +++
Sbjct:    5 ELAKKLQSRLVASEETEPRPESEQSPARAPTHEPDNASGDLPSESELAAKLNRRLDI------NDGTSAPRMSRVFNPYTEFKEFSRKTIKDLEAMFKRYDTGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDGKLSFREFLLIFRRAAAGELQEESGLMAL----ARLSEINVSAEGVMGAKDFFEAKVQALSQ 197          
BLAST of EF-hand domain family, member D1 vs. TrEMBL
Match: A0A1A8NGP8 (EF-hand domain family, member D1 OS=Nothobranchius rachovii OX=451742 GN=EFHD1 PE=4 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 1.972e-48
Identity = 96/203 (47.29%), Postives = 134/203 (66.01%), Query Frame = 3
Query:   33 QLAEKLSNRKGASEN---EAETSENIDKLITNKKE-INSDQPT-NELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIAR 626
            +LA+KL +R  ASE      E+ ++  +  T++ +  + D P+ +EL++KLNRR+D        DG   P   +VFNPYTEFKEFSRK IK+LE  FK+YD  RD F+   +LK MMEKLG PQTHLGLK MIK++DED D K+SFR+F+ +FR+A AG++  ++ LM+L      L  + V   GV GAK FFE+KV  +++
Sbjct:    5 ELAKKLQSRLVASEETEPRPESEQSPVRAPTHEPDNASGDLPSESELAAKLNRRLDI------NDGTSAPRMSRVFNPYTEFKEFSRKTIKDLEAMFKRYDTGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDGKLSFREFLLIFRRAAAGELQEESGLMAL----ARLSEINVSAEGVMGAKDFFEAKVQALSQ 197          
BLAST of EF-hand domain family, member D1 vs. Ensembl Cavefish
Match: efhd1 (EF-hand domain family, member D1 [Source:ZFIN;Acc:ZDB-GENE-030131-7461])

HSP 1 Score: 106.301 bits (264), Expect = 7.689e-28
Identity = 48/106 (45.28%), Postives = 73/106 (68.87%), Query Frame = 3
Query:  306 FKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIA 623
            F+ +D  +D F+   +LK MMEKLG PQTHLGLK MI+++DED+D K+SFR+F+ +F +A AG++  ++ LM+L      L  + V   GV+GA+ FFE+K   ++
Sbjct:    2 FRGFDSGKDGFIDLMELKMMMEKLGAPQTHLGLKSMIREVDEDYDGKLSFREFLLIFHRAAAGELQEESGLMALA----RLSEIDVSTEGVRGAREFFEAKAQALS 103          
BLAST of EF-hand domain family, member D1 vs. Ensembl Cavefish
Match: efhd1 (EF-hand domain family, member D1 [Source:ZFIN;Acc:ZDB-GENE-030131-7461])

HSP 1 Score: 103.605 bits (257), Expect = 7.123e-27
Identity = 47/103 (45.63%), Postives = 71/103 (68.93%), Query Frame = 3
Query:  315 YDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIA 623
            +D  +D F+   +LK MMEKLG PQTHLGLK MI+++DED+D K+SFR+F+ +F +A AG++  ++ LM+L      L  + V   GV+GA+ FFE+K   ++
Sbjct:    2 FDSGKDGFIDLMELKMMMEKLGAPQTHLGLKSMIREVDEDYDGKLSFREFLLIFHRAAAGELQEESGLMALA----RLSEIDVSTEGVRGAREFFEAKAQALS 100          
BLAST of EF-hand domain family, member D1 vs. Ensembl Cavefish
Match: efhd2 (EF-hand domain family, member D2 [Source:ZFIN;Acc:ZDB-GENE-060531-152])

HSP 1 Score: 99.3673 bits (246), Expect = 1.764e-25
Identity = 52/100 (52.00%), Postives = 65/100 (65.00%), Query Frame = 3
Query:  351 DLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIARDQEMTNEI 650
            +LK MMEKL  PQTHLGLK MIK++DED D K+SFR+F+ +FRKA AG++  D+ L  L      L  + V   GVKGAK+FFE+KV  I        EI
Sbjct:    2 ELKLMMEKLEAPQTHLGLKNMIKEVDEDLDGKLSFREFLLIFRKAAAGELAEDSGLHVLA----RLSEIDVSTEGVKGAKTFFEAKVQAINESNRFEAEI 97          
BLAST of EF-hand domain family, member D1 vs. Ensembl Cavefish
Match: aif1l (allograft inflammatory factor 1 like [Source:NCBI gene;Acc:103026376])

HSP 1 Score: 49.6766 bits (117), Expect = 3.969e-7
Identity = 23/64 (35.94%), Postives = 40/64 (62.50%), Query Frame = 3
Query:  285 IKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLF 476
            + + +N + ++D D    +    LK MMEKLGVP+THL +K+MI ++     + I++RDF+ + 
Sbjct:   45 LDSFKNKYAEFDLDNQGDIDMMGLKRMMEKLGVPKTHLEIKKMISEVTGGVSDTINYRDFVKMM 108          
BLAST of EF-hand domain family, member D1 vs. Ensembl Sea Lamprey
Match: efhd1 (EF-hand domain family, member D1 [Source:ZFIN;Acc:ZDB-GENE-030131-7461])

HSP 1 Score: 96.6709 bits (239), Expect = 2.380e-25
Identity = 48/99 (48.48%), Postives = 70/99 (70.71%), Query Frame = 3
Query:  315 YDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKV 611
            ++  +D ++   DLK MMEKLG PQTHLGLK+MI ++DED D ++SFR+F+ +F KA AG++  ++ L++L      L  + V   GVKGAK+FFE+KV
Sbjct:    1 HNSRKDGYMDLMDLKCMMEKLGAPQTHLGLKEMIAEVDEDFDGRLSFREFLLIFHKAAAGELQEESGLLAL----ARLSEIDVSAEGVKGAKNFFEAKV 95          
BLAST of EF-hand domain family, member D1 vs. Ensembl Sea Lamprey
Match: aif1l (allograft inflammatory factor 1-like [Source:ZFIN;Acc:ZDB-GENE-030131-9646])

HSP 1 Score: 45.4394 bits (106), Expect = 1.849e-6
Identity = 27/82 (32.93%), Postives = 49/82 (59.76%), Query Frame = 3
Query:  264 KEFSRKEI-KNLENNFKKYDQDRDSFLGFD----------DLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLF 476
            KEF   E  +++++  +K ++ ++ FL FD           LK M+E++G P+THL LK++I ++   + + I +RDF+TL 
Sbjct:   13 KEFLEDEFYQDVDDLAEKLERYKEKFLDFDLNDEEEIDLMALKKMLERVGTPRTHLELKKIIAEVTTGNSDCIGYRDFLTLM 94          
BLAST of EF-hand domain family, member D1 vs. Ensembl Nematostella
Match: EDO33425 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSA9])

HSP 1 Score: 87.4261 bits (215), Expect = 1.022e-20
Identity = 55/156 (35.26%), Postives = 85/156 (54.49%), Query Frame = 3
Query:  147 TNELSSKLNRRIDTIENATGADGDVVPT-QFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKV 611
            T+EL+SKL RR    E      G+  P  + +VFNPYTEFKEFSRK+IK  E  FK YD     +L   + +   +K G     +G++++  +        + F  F+ +FRK+ AG++   + L  L      L  + V+++GV GA +FFE+K+
Sbjct:    4 TDELASKLARRTAINE------GEEKPRFKIQVFNPYTEFKEFSRKQIKEFEKMFKNYDTTIKVYLVLMNYRQAEKKHGCVHRTIGIREI--NTRSQLTYHVFFFQFLLIFRKSAAGELVEGSGLAEL----ARLAEIDVDEVGVGGAATFFEAKI 147          
BLAST of EF-hand domain family, member D1 vs. Ensembl Nematostella
Match: EDO43391 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYV6])

HSP 1 Score: 45.4394 bits (106), Expect = 2.003e-6
Identity = 23/62 (37.10%), Postives = 37/62 (59.68%), Query Frame = 3
Query:  306 FKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKA 491
            F +YD +    +   +LK MMEKLG  +THL LK+MI ++D  +   I + +F+T+    K+
Sbjct:   49 FMEYDVNNSGDIDIMELKMMMEKLGQAKTHLELKKMIAEVDTTNSGTIFYNEFLTMMLGKKS 110          
BLAST of EF-hand domain family, member D1 vs. Ensembl Nematostella
Match: EDO49868 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REX5])

HSP 1 Score: 45.0542 bits (105), Expect = 3.520e-6
Identity = 31/111 (27.93%), Postives = 54/111 (48.65%), Query Frame = 3
Query:  306 FKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKY----------MELESVAV---EDIGVKGAKSFF 599
            F  YD D D F+G D+L+ +M  LG P T+L L++++KD  E    ++ F +F+ +  + KA  +     +++ +              EL  + V   E IG +  K +F
Sbjct:    7 FSLYDGDNDGFIGKDELELVMRSLGEPVTYLELEKIMKDSGELW--QVVFPEFLKIMAEQKARSVNTRQEILAAFQACDLRKTGTVTKKELRKIMVNTGERIGKQECKCYF 115          
BLAST of EF-hand domain family, member D1 vs. Ensembl Nematostella
Match: EDO33580 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRU7])

HSP 1 Score: 45.0542 bits (105), Expect = 6.216e-6
Identity = 25/87 (28.74%), Postives = 45/87 (51.72%), Query Frame = 3
Query:  270 FSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLY 530
             + +EI   +  F  +D+D D  +   +L  +M  LG   T   +++MIK++DED    I F +F+ L  K   G   +++ LM+ +
Sbjct:    5 LTEEEIAEYKEAFSLFDKDGDGTVTTAELGTVMRNLGQNPTDEEIREMIKEVDEDGSGSIGFEEFLQLMSKKTKGK-SYEDELMAAF 90          
BLAST of EF-hand domain family, member D1 vs. Ensembl Medaka
Match: efhd1 (EF-hand domain-containing protein D1 [Source:NCBI gene;Acc:101163191])

HSP 1 Score: 165.236 bits (417), Expect = 2.026e-49
Identity = 88/199 (44.22%), Postives = 129/199 (64.82%), Query Frame = 3
Query:   33 QLAEKLSNRKGASEN-EAETSENIDKLITNKKEINSDQPTNELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIAR 626
            +LA+KL +R  A E+ E     +  +    + E +  +  +ELS+KL+RR+D        DG  VP   +VFNPYTEFKEFSR++IK++E  F++YD  +D F+   +LK MMEKLG PQTHLGLK MIK++DED D K+SFR+F+ +FR+A +G++  ++ LM+L      L  + V   GV GAK FFE+K   +++
Sbjct:    5 ELAKKLQSRFVAMEDTEPRPELSPARSTPREPEPDGGEEGSELSAKLHRRLDI------NDGAAVPRATRVFNPYTEFKEFSRRQIKDMEAMFRRYDTGKDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDGKLSFREFLLIFRRAASGELQEESGLMAL----ARLSEINVSTEGVMGAKDFFEAKAQALSQ 193          
BLAST of EF-hand domain family, member D1 vs. Ensembl Medaka
Match: efhd2 (EF-hand domain family member D2 [Source:NCBI gene;Acc:101169842])

HSP 1 Score: 158.303 bits (399), Expect = 1.138e-46
Identity = 82/167 (49.10%), Postives = 110/167 (65.87%), Query Frame = 3
Query:  150 NELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIARDQEMTNEI 650
            +EL + L RR +  E      GD      +VFNPYTEFKEFSRK+IK++E  FK +D  +D+++   +LK MMEKLG PQTH+GLK MIK++DED DNK+SFR+F+ +FRKA AG++  D+ L  L      L  + V   GVKGAK+FFE+KV  I+      +EI
Sbjct:   46 SELGALLQRRGELNE----GHGDAQQPSLRVFNPYTEFKEFSRKQIKDMEKMFKTFDAGKDNYIDLMELKLMMEKLGAPQTHIGLKNMIKEVDEDLDNKLSFREFLLIFRKAAAGELAEDSGLSVL----ARLSEIDVSTEGVKGAKTFFEAKVQAISESNRFESEI 204          
BLAST of EF-hand domain family, member D1 vs. Ensembl Medaka
Match: aif1l (allograft inflammatory factor 1-like [Source:NCBI gene;Acc:101161658])

HSP 1 Score: 50.447 bits (119), Expect = 1.014e-7
Identity = 23/64 (35.94%), Postives = 40/64 (62.50%), Query Frame = 3
Query:  285 IKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLF 476
            ++  +N + ++D + +  +    LK MMEKLG P+THL LK+MI ++     N I++RDF+ + 
Sbjct:   16 LEGFKNKYAEFDLNDEGEIELMGLKRMMEKLGAPKTHLELKKMIMEVTGGSSNTINYRDFVKMM 79          
BLAST of EF-hand domain family, member D1 vs. Ensembl Medaka
Match: aif1l (allograft inflammatory factor 1-like [Source:NCBI gene;Acc:101161658])

HSP 1 Score: 50.8322 bits (120), Expect = 1.068e-7
Identity = 23/64 (35.94%), Postives = 40/64 (62.50%), Query Frame = 3
Query:  285 IKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLF 476
            ++  +N + ++D + +  +    LK MMEKLG P+THL LK+MI ++     N I++RDF+ + 
Sbjct:   26 LEGFKNKYAEFDLNDEGEIELMGLKRMMEKLGAPKTHLELKKMIMEVTGGSSNTINYRDFVKMM 89          
BLAST of EF-hand domain family, member D1 vs. Ensembl Medaka
Match: aif1l (allograft inflammatory factor 1-like [Source:NCBI gene;Acc:101161658])

HSP 1 Score: 50.8322 bits (120), Expect = 1.717e-7
Identity = 23/64 (35.94%), Postives = 40/64 (62.50%), Query Frame = 3
Query:  285 IKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLF 476
            ++  +N + ++D + +  +    LK MMEKLG P+THL LK+MI ++     N I++RDF+ + 
Sbjct:   47 LEGFKNKYAEFDLNDEGEIELMGLKRMMEKLGAPKTHLELKKMIMEVTGGSSNTINYRDFVKMM 110          
BLAST of EF-hand domain family, member D1 vs. Planmine SMEST
Match: SMESG000009754.1 (SMESG000009754.1)

HSP 1 Score: 426.787 bits (1096), Expect = 3.514e-152
Identity = 208/209 (99.52%), Postives = 209/209 (100.00%), Query Frame = 3
Query:   24 MDPQLAEKLSNRKGASENEAETSENIDKLITNKKEINSDQPTNELSSKLNRRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIARDQEMTNEI 650
            MDPQLAEKLSNRKGASENEAETSENIDKLITNKKEINSDQPTNELSSKLNRRIDTI+NATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIARDQEMTNEI
Sbjct:    1 MDPQLAEKLSNRKGASENEAETSENIDKLITNKKEINSDQPTNELSSKLNRRIDTIDNATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQDRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTLFRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIARDQEMTNEI 209          
The following BLAST results are available for this feature:
BLAST of EF-hand domain family, member D1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EFHD11.321e-4852.41EF-hand domain family member D1 [Source:HGNC Symbo... [more]
EFHD27.890e-4854.49EF-hand domain family member D2 [Source:HGNC Symbo... [more]
EFHD11.779e-3152.17EF-hand domain family member D1 [Source:HGNC Symbo... [more]
EFHD22.564e-3152.21EF-hand domain family member D2 [Source:HGNC Symbo... [more]
EFHD13.321e-3052.21EF-hand domain family member D1 [Source:HGNC Symbo... [more]
back to top
BLAST of EF-hand domain family, member D1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
efhd-13.147e-3145.93EF HanD calcium binding protein [Source:UniProtKB... [more]
efhd-13.543e-3146.27EF HanD calcium binding protein [Source:UniProtKB... [more]
efhd-16.907e-2945.93EF HanD calcium binding protein [Source:UniProtKB... [more]
efhd-16.907e-2945.93EF HanD calcium binding protein [Source:UniProtKB... [more]
cal-85.643e-635.82CALmodulin related genes [Source:UniProtKB/TrEMBL... [more]
back to top
BLAST of EF-hand domain family, member D1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Swip-14.965e-4648.81gene:FBgn0032731 transcript:FBtr0081185[more]
Swip-14.965e-4648.81gene:FBgn0032731 transcript:FBtr0340322[more]
CG148612.462e-1029.92gene:FBgn0038280 transcript:FBtr0083023[more]
back to top
BLAST of EF-hand domain family, member D1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
efhd11.117e-5146.19EF-hand domain family, member D1 [Source:ZFIN;Acc:... [more]
efhd22.453e-4845.02EF-hand domain family, member D2 [Source:ZFIN;Acc:... [more]
efhd22.453e-4845.02EF-hand domain family, member D2 [Source:ZFIN;Acc:... [more]
aif1l1.167e-633.85allograft inflammatory factor 1-like [Source:ZFIN;... [more]
aif1l2.031e-633.85allograft inflammatory factor 1-like [Source:ZFIN;... [more]
back to top
BLAST of EF-hand domain family, member D1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
alg66.965e-5052.98ALG6, alpha-1,3-glucosyltransferase [Source:Xenbas... [more]
gja53.795e-4748.30gap junction protein alpha 5 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of EF-hand domain family, member D1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Efhd21.436e-4652.87EF hand domain containing 2 [Source:MGI Symbol;Acc... [more]
Efhd11.483e-4649.70EF hand domain containing 1 [Source:MGI Symbol;Acc... [more]
Efhd11.483e-4649.70EF hand domain containing 1 [Source:MGI Symbol;Acc... [more]
Aif1l5.575e-738.60allograft inflammatory factor 1-like [Source:MGI S... [more]
Calm47.690e-732.00calmodulin 4 [Source:MGI Symbol;Acc:MGI:1931464][more]
back to top
BLAST of EF-hand domain family, member D1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BUP0|EFHD1_HUMAN6.346e-4852.41EF-hand domain-containing protein D1 OS=Homo sapie... [more]
sp|Q17QM6|EFHD1_BOVIN1.630e-4752.41EF-hand domain-containing protein D1 OS=Bos taurus... [more]
sp|Q96C19|EFHD2_HUMAN3.789e-4754.49EF-hand domain-containing protein D2 OS=Homo sapie... [more]
sp|A5D7A0|EFHD2_BOVIN3.205e-4654.90EF-hand domain-containing protein D2 OS=Bos taurus... [more]
sp|Q9D8Y0|EFHD2_MOUSE5.457e-4652.87EF-hand domain-containing protein D2 OS=Mus muscul... [more]
back to top
BLAST of EF-hand domain family, member D1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210R5H02.242e-5153.80EF-hand domain-containing protein D2 OS=Mizuhopect... [more]
A0A3Q2XZP01.017e-5047.00EF-hand domain family, member D1 OS=Hippocampus co... [more]
A0A0L8GSR95.202e-4956.41Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A1A8EHS81.140e-4847.29EF-hand domain family, member D1 OS=Nothobranchius... [more]
A0A1A8NGP81.972e-4847.29EF-hand domain family, member D1 OS=Nothobranchius... [more]
back to top
BLAST of EF-hand domain family, member D1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
efhd17.689e-2845.28EF-hand domain family, member D1 [Source:ZFIN;Acc:... [more]
efhd17.123e-2745.63EF-hand domain family, member D1 [Source:ZFIN;Acc:... [more]
efhd21.764e-2552.00EF-hand domain family, member D2 [Source:ZFIN;Acc:... [more]
aif1l3.969e-735.94allograft inflammatory factor 1 like [Source:NCBI ... [more]
back to top
BLAST of EF-hand domain family, member D1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
efhd12.380e-2548.48EF-hand domain family, member D1 [Source:ZFIN;Acc:... [more]
aif1l1.849e-632.93allograft inflammatory factor 1-like [Source:ZFIN;... [more]
back to top
BLAST of EF-hand domain family, member D1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain family, member D1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO334251.022e-2035.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433912.003e-637.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498683.520e-627.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335806.216e-628.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of EF-hand domain family, member D1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
efhd12.026e-4944.22EF-hand domain-containing protein D1 [Source:NCBI ... [more]
efhd21.138e-4649.10EF-hand domain family member D2 [Source:NCBI gene;... [more]
aif1l1.014e-735.94allograft inflammatory factor 1-like [Source:NCBI ... [more]
aif1l1.068e-735.94allograft inflammatory factor 1-like [Source:NCBI ... [more]
aif1l1.717e-735.94allograft inflammatory factor 1-like [Source:NCBI ... [more]
back to top
BLAST of EF-hand domain family, member D1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000009754.13.514e-15299.52SMESG000009754.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003944 ID=SMED30003944|Name=EF-hand domain family, member D1|organism=Schmidtea mediterranea sexual|type=transcript|length=965bp
TTAAAATTCAACAGAAATAGTTGATGGATCCACAACTAGCAGAAAAATTA
TCAAACAGAAAAGGGGCATCAGAAAATGAGGCAGAGACTTCAGAAAACAT
CGATAAATTAATAACTAATAAGAAAGAAATCAATTCAGATCAACCTACTA
ATGAATTAAGTTCCAAGTTAAATCGAAGAATCGATACAATTGAAAATGCA
ACTGGCGCAGATGGAGATGTAGTTCCTACGCAATTTAAAGTTTTTAATCC
TTATACCGAATTCAAAGAGTTCAGTAGAAAAGAAATCAAAAATTTGGAAA
ATAATTTTAAAAAATATGATCAAGATCGGGACAGTTTTCTTGGATTTGAT
GATTTAAAATACATGATGGAAAAGTTAGGCGTTCCTCAAACTCATTTAGG
ATTGAAACAAATGATTAAAGATATCGACGAAGACCATGATAATAAAATAA
GCTTCAGAGACTTTATGACGTTATTTCGTAAAGCGAAAGCCGGTGATATA
GGCCATGACAATCCGTTGATGAGTCTTTATGATAAATATATGGAGCTAGA
ATCAGTCGCCGTTGAAGATATTGGTGTCAAAGGTGCAAAATCATTTTTTG
AATCCAAAGTTGCCAAAATTGCCAGAGATCAAGAAATGACCAATGAGATT
CTTAAAGAACAAGAAGAAAAGAAAGCTTTAGAAGAGGAGAAGAAACGTCG
TCGAGAAGAATTTAAAGCAAAGCAAAAATCGTTTCAATCCTAATTACTTA
TTATTATTTTTTAAATCAAATCTTGCTATTTAAAATTTAATGATTAATTG
CTGATATTAGTGCACTAGTGTTTCGAGCATGACATGCTTCGGTTATGCGT
TTCTTAGATATTGATATTTTAATTCCCAACATTTGTCATCAAAGCAATGA
TTCTGCTCAATTACTTTTTAGAATATTTTTAATTTTAATAAATGTTTATC
AATTTTCAAAAAAAA
back to top

protein sequence of SMED30003944-orf-1

>SMED30003944-orf-1 ID=SMED30003944-orf-1|Name=SMED30003944-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=240bp
MDPQLAEKLSNRKGASENEAETSENIDKLITNKKEINSDQPTNELSSKLN
RRIDTIENATGADGDVVPTQFKVFNPYTEFKEFSRKEIKNLENNFKKYDQ
DRDSFLGFDDLKYMMEKLGVPQTHLGLKQMIKDIDEDHDNKISFRDFMTL
FRKAKAGDIGHDNPLMSLYDKYMELESVAVEDIGVKGAKSFFESKVAKIA
RDQEMTNEILKEQEEKKALEEEKKRRREEFKAKQKSFQS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR040365EFHD1/2
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0045296cadherin binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0045121membrane raft
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 81..101
NoneNo IPR availableCOILSCoilCoilcoord: 202..236
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 62..181
e-value: 6.1E-25
score: 89.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 215..239
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..46
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 12..34
NoneNo IPR availablePANTHERPTHR13025:SF8EF-HAND DOMAIN FAMILY, MEMBER D1coord: 4..238
IPR002048EF-hand domainSMARTSM00054efh_1coord: 126..154
e-value: 0.0071
score: 25.6
coord: 90..118
e-value: 0.81
score: 18.5
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 91..152
e-value: 3.8E-8
score: 33.7
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 86..121
score: 12.477
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 122..157
score: 10.748
IPR002048EF-hand domainCDDcd00051EFhcoord: 95..152
e-value: 2.87419E-10
score: 52.5501
IPR040365EF-hand domain-containing protein D1/2PANTHERPTHR13025SWIPROSINcoord: 4..238
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 135..147
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 72..158