Cytochrome P450 2K1-like protein

Overview
NameCytochrome P450 2K1-like protein
Smed IDSMED30003937
Length (bp)900
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytochrome P450 2K1-like protein (SMED30003937) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytochrome P450 2K1-like protein (SMED30003937) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003937

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30003937SMESG000072594.1 SMESG000072586.1 SmedASXL_061476SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30003937SMESG000072594.1 SMESG000072586.1 dd_Smed_v4_9870_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30003937SMESG000072594.1 SMESG000072586.1 dd_Smed_v6_9870_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30003937SMESG000072594.1 SMESG000072586.1 dd_Smed_v4_9870_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30003937SMESG000072594.1 SMESG000072586.1 dd_Smed_v4_9870_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2R1 (cytochrome P450 family 2 subfamily R member 1 [Source:HGNC Symbol;Acc:HGNC:20580])

HSP 1 Score: 124.02 bits (310), Expect = 4.709e-33
Identity = 55/121 (45.45%), Postives = 80/121 (66.12%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEEL 363
            T+AV+ E+LR  ++VPL +FH T EDA + GY IPK + +  NL++ H D   W +P  F PE FL    D +  +  ++ L+PFS+G+R C+GE LAR+E F+FFT ++QRF + F  EL
Sbjct:  128 TEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVFHPERFL----DSSGYFAKKEALVPFSLGRRHCLGEHLARMEMFLFFTALLQRFHLHFPHEL 244          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2R1 (cytochrome P450 family 2 subfamily R member 1 [Source:HGNC Symbol;Acc:HGNC:20580])

HSP 1 Score: 124.405 bits (311), Expect = 1.222e-31
Identity = 55/121 (45.45%), Postives = 80/121 (66.12%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEEL 363
            T+AV+ E+LR  ++VPL +FH T EDA + GY IPK + +  NL++ H D   W +P  F PE FL    D +  +  ++ L+PFS+G+R C+GE LAR+E F+FFT ++QRF + F  EL
Sbjct:  361 TEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVFHPERFL----DSSGYFAKKEALVPFSLGRRHCLGEHLARMEMFLFFTALLQRFHLHFPHEL 477          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2J2 (cytochrome P450 family 2 subfamily J member 2 [Source:HGNC Symbol;Acc:HGNC:2634])

HSP 1 Score: 114.39 bits (285), Expect = 4.170e-28
Identity = 52/113 (46.02%), Postives = 76/113 (67.26%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRF 339
            T AV+ E+ R+ +++PL+V      D  + GY++PK ++I  NL A H DP  W  P TF+P+HFL+   +G  +++ R+  +PFSIGKR C+GE LAR E FIFFT +MQ+F
Sbjct:  362 TNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDTFNPDHFLE---NG--QFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKF 469          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2U1 (cytochrome P450 family 2 subfamily U member 1 [Source:HGNC Symbol;Acc:HGNC:20582])

HSP 1 Score: 106.686 bits (265), Expect = 4.234e-26
Identity = 51/120 (42.50%), Postives = 73/120 (60.83%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEE 360
            T+A + E+ RL+ VVPL++ H T E+  + GY IPK +LI PNL++ H DP +W  P  F P  FL    D   +   ++  IPF IGKR C+GE LA++E F+ F  +MQ F  +  E+
Sbjct:  194 TEATIMEVQRLTVVVPLAIPHMTSENTVLQGYTIPKGTLILPNLWSVHRDPAIWEKPEDFYPNRFL----DDQGQLIKKETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQSFAFALPED 309          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2U1 (cytochrome P450 family 2 subfamily U member 1 [Source:HGNC Symbol;Acc:HGNC:20582])

HSP 1 Score: 106.686 bits (265), Expect = 2.972e-25
Identity = 51/120 (42.50%), Postives = 73/120 (60.83%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEE 360
            T+A + E+ RL+ VVPL++ H T E+  + GY IPK +LI PNL++ H DP +W  P  F P  FL    D   +   ++  IPF IGKR C+GE LA++E F+ F  +MQ F  +  E+
Sbjct:  403 TEATIMEVQRLTVVVPLAIPHMTSENTVLQGYTIPKGTLILPNLWSVHRDPAIWEKPEDFYPNRFL----DDQGQLIKKETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQSFAFALPED 518          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-33E1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27482])

HSP 1 Score: 104.375 bits (259), Expect = 5.754e-25
Identity = 50/118 (42.37%), Postives = 78/118 (66.10%), Query Frame = 1
Query:    4 QAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAE 357
             A ++E  RL++++P+++   T  D  I GY IPK+++I P + +   DP+++  P  F PE FL  E+DG+LK    +EL+PFSIGKRQC+GE LA++E F++F  +  +F I F E
Sbjct:  353 NATVNESQRLANLLPMNLSRSTNADVEIAGYRIPKDTVITPQISSVMYDPEIFPEPYEFKPERFL--ESDGSLK--KVEELVPFSIGKRQCLGEGLAKMELFLYFANLFNKFDIKFHE 466          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-33E1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27482])

HSP 1 Score: 104.375 bits (259), Expect = 5.754e-25
Identity = 50/118 (42.37%), Postives = 78/118 (66.10%), Query Frame = 1
Query:    4 QAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAE 357
             A ++E  RL++++P+++   T  D  I GY IPK+++I P + +   DP+++  P  F PE FL  E+DG+LK    +EL+PFSIGKRQC+GE LA++E F++F  +  +F I F E
Sbjct:  353 NATVNESQRLANLLPMNLSRSTNADVEIAGYRIPKDTVITPQISSVMYDPEIFPEPYEFKPERFL--ESDGSLK--KVEELVPFSIGKRQCLGEGLAKMELFLYFANLFNKFDIKFHE 466          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-23A1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27465])

HSP 1 Score: 101.293 bits (251), Expect = 7.197e-24
Identity = 53/144 (36.81%), Postives = 87/144 (60.42%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEEQYSKVLISDDAPVK-SCQIT 429
             QA ++EI R+++++P+++     ED  I+GY   K  LI P +     DP+++ NP  F+P  FL  + D  +K     E +PFSIG+RQC+GESLAR E ++ F  ++Q F    A++++ E+   + +S   PV+ SC+IT
Sbjct:  386 VQATINEIQRIANILPINLLRTVAEDIEIDGYNFKKGDLIIPQISILMNDPEIFENPEEFNPSRFL--DEDNNVK--KIDEFLPFSIGRRQCLGESLARAELYLVFANLIQNFNFEVADDVTTERVLGLTVS---PVEYSCKIT 522          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: daf-9 (Cytochrome P450 daf-9 [Source:UniProtKB/Swiss-Prot;Acc:H2KYS3])

HSP 1 Score: 99.3673 bits (246), Expect = 4.593e-23
Identity = 48/114 (42.11%), Postives = 70/114 (61.40%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFR 342
             +A + EI RL++V+P ++ H+T E+ NI GY IP N+ I P L A   DP+++ +P  F PE FL  E     KYR  +E  PF +G R C+GE +AR E ++ F  ++Q FR
Sbjct:  424 VRATLSEIQRLANVLPWAIPHKTIEECNIGGYDIPVNTEIIPALGAVLFDPNVFESPKQFKPERFLDEEG----KYRVMEEFRPFGLGPRVCLGERIARTELYLIFASLLQNFR 533          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: daf-9 (Cytochrome P450 daf-9 [Source:UniProtKB/Swiss-Prot;Acc:H2KYS3])

HSP 1 Score: 98.9821 bits (245), Expect = 4.841e-23
Identity = 48/114 (42.11%), Postives = 70/114 (61.40%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFR 342
             +A + EI RL++V+P ++ H+T E+ NI GY IP N+ I P L A   DP+++ +P  F PE FL  E     KYR  +E  PF +G R C+GE +AR E ++ F  ++Q FR
Sbjct:  409 VRATLSEIQRLANVLPWAIPHKTIEECNIGGYDIPVNTEIIPALGAVLFDPNVFESPKQFKPERFLDEEG----KYRVMEEFRPFGLGPRVCLGERIARTELYLIFASLLQNFR 518          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074610)

HSP 1 Score: 99.3673 bits (246), Expect = 4.972e-23
Identity = 48/119 (40.34%), Postives = 71/119 (59.66%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAE 357
            T++ + E +R SS+VPL+  H    D  +NGY IP  S + P + + H+DP+LW  P  F P  F  ++T+G  K R  +  IPF +G+R C+G+ LAR+E F+FF   M  F I+  E
Sbjct:  379 TESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRF--IDTEG--KVRKPEYFIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIALPE 493          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074609)

HSP 1 Score: 99.3673 bits (246), Expect = 4.972e-23
Identity = 48/119 (40.34%), Postives = 71/119 (59.66%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAE 357
            T++ + E +R SS+VPL+  H    D  +NGY IP  S + P + + H+DP+LW  P  F P  F  ++T+G  K R  +  IPF +G+R C+G+ LAR+E F+FF   M  F I+  E
Sbjct:  379 TESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRF--IDTEG--KVRKPEYFIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIALPE 493          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp304a1 (gene:FBgn0038095 transcript:FBtr0082691)

HSP 1 Score: 89.3521 bits (220), Expect = 1.139e-19
Identity = 46/113 (40.71%), Postives = 66/113 (58.41%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRF 339
            T+A + E LR+ ++VP  V H+  ED  + GY IPK++++ P+L+A H D  +W++P  F PE F  L+ DG L  +    L PF  GKR C GE+ AR   F+    M Q F
Sbjct:  366 TEATIREGLRIETLVPSDVPHKALEDTELLGYRIPKDTIVVPSLYAFHSDARIWSDPEQFRPERF--LDADGKLCLKLDVSL-PFGAGKRLCAGETFARNMLFLVTATMCQHF 475          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: phm (gene:FBgn0004959 transcript:FBtr0074603)

HSP 1 Score: 78.1814 bits (191), Expect = 6.894e-16
Identity = 42/116 (36.21%), Postives = 65/116 (56.03%), Query Frame = 1
Query:    4 QAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISF 351
            +A + E +R+ SVVPL + H   E+  +  Y+I   S+I  + +A H+DP  +  P  F PE FL    DG   Y++  + IPFS G R C GE +AR+   +F  R+++RF +  
Sbjct:  419 RACISETMRIRSVVPLGIPHGCKENFVVGDYFIKGGSMIVCSEWAIHMDPVAFPEPEEFRPERFLT--ADGA--YQAPPQFIPFSSGYRMCPGEEMARMILTLFTGRILRRFHLEL 530          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: phm (gene:FBgn0004959 transcript:FBtr0342846)

HSP 1 Score: 78.1814 bits (191), Expect = 6.894e-16
Identity = 42/116 (36.21%), Postives = 65/116 (56.03%), Query Frame = 1
Query:    4 QAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISF 351
            +A + E +R+ SVVPL + H   E+  +  Y+I   S+I  + +A H+DP  +  P  F PE FL    DG   Y++  + IPFS G R C GE +AR+   +F  R+++RF +  
Sbjct:  419 RACISETMRIRSVVPLGIPHGCKENFVVGDYFIKGGSMIVCSEWAIHMDPVAFPEPEEFRPERFLT--ADGA--YQAPPQFIPFSSGYRMCPGEEMARMILTLFTGRILRRFHLEL 530          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2r1 (cytochrome P450, family 2, subfamily R, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-110114-1])

HSP 1 Score: 120.553 bits (301), Expect = 1.765e-30
Identity = 58/143 (40.56%), Postives = 87/143 (60.84%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEEQYSKVLIS-DDAPVKSCQI 426
             +AV+ E+LRL ++VPL +F  T +DA + GY IPK +++  NL++ H D   W++P  F PE FL    D   K+   +  +PFSIGKR C+GE LAR+E F+FFT ++QRF + F+E       +K+ ++    P   C I
Sbjct:  364 VEAVLHEVLRLCNIVPLGIFRATSQDAVVRGYTIPKGTMVITNLYSVHFDEKYWSDPSIFCPERFL----DCNGKFIRHEAFLPFSIGKRHCLGEQLARLEMFLFFTTLLQRFHLQFSEGFIPSLSAKLGMTLQPQPYSICAI 502          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2k19 (cytochrome P450, family 2, subfamily k, polypeptide 19 [Source:ZFIN;Acc:ZDB-GENE-091211-1])

HSP 1 Score: 109.768 bits (273), Expect = 4.810e-27
Identity = 59/146 (40.41%), Postives = 87/146 (59.59%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEEQYS-KVLIS---DDAPVKSCQI 426
            T AV+ EI RL+++VPLS+ H+T  D   NGY+I K + + P L +   D   W  P +F PEHFL    D   ++  R   IPFS G+R C+GESLAR+E F+FFT ++Q +R +    +SE++   K ++    + +P K C I
Sbjct:  243 TDAVIHEIQRLANIVPLSLPHKTTSDITFNGYFIKKGTTVVPLLTSVLKDESEWEKPNSFYPEHFL----DEKGQFVKRDAFIPFSAGRRVCLGESLARMELFLFFTSLLQSYRFTTPPGVSEDELDLKGIVGITLNPSPHKLCAI 384          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2k21 (cytochrome P450, family 2, subfamily k, polypeptide 21 [Source:ZFIN;Acc:ZDB-GENE-091113-17])

HSP 1 Score: 109.768 bits (273), Expect = 1.269e-26
Identity = 59/146 (40.41%), Postives = 87/146 (59.59%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEEQYS-KVLIS---DDAPVKSCQI 426
            T AV+ EI RL+++VPLS+ HRT  D   NGY+I K + + P L +   D   W  P +F PEHFL    D   ++  R   +PFS G+R C+GESLAR+E F+FFT ++Q +R +    +SE++   K ++    + +P K C I
Sbjct:  363 TDAVIHEIQRLANIVPLSLPHRTTSDITFNGYFIKKGTTVVPLLTSVLKDESEWEKPNSFYPEHFL----DEKGQFVRRDAFMPFSAGRRVCLGESLARMELFLFFTSLLQSYRFTTPPGVSEDELDLKGIVGITLNPSPHKLCAI 504          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2k20 (cytochrome P450, family 2, subfamily k, polypeptide 20 [Source:ZFIN;Acc:ZDB-GENE-091113-5])

HSP 1 Score: 109.383 bits (272), Expect = 1.888e-26
Identity = 59/146 (40.41%), Postives = 86/146 (58.90%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEEQYS-KVLIS---DDAPVKSCQI 426
            T AV+ EI RL+++VPLS+ HRT  D   NGY+I K + + P L +   D   W  P +F PEHFL    D   ++  R   +PFS G+R C+GESLAR+E F+FFT ++Q +R +    +SE+    K ++    + +P K C I
Sbjct:  384 TDAVIHEIQRLANIVPLSLPHRTTSDITFNGYFIKKGTTVVPLLTSVLKDESEWEKPNSFYPEHFL----DEKGQFVKRDAFMPFSAGRRVCLGESLARMELFLFFTSLLQSYRFTTPPGVSEDALDLKGIVGITLNPSPHKLCAI 525          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2p7 (cytochrome P450, family 2, subfamily P, polypeptide 7 [Source:ZFIN;Acc:ZDB-GENE-041001-155])

HSP 1 Score: 108.612 bits (270), Expect = 2.942e-26
Identity = 53/116 (45.69%), Postives = 73/116 (62.93%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRIS 348
            T AV+ EI R+ ++VPL+VF  T ED  I  Y IPK +L+  +L +   D   W  P +F+P HFL    D   K+R R   +PFS+GKR C+GE LAR+E F+FF+ ++QRF  S
Sbjct:  356 TNAVIHEIQRMGNIVPLNVFRITVEDTQIGEYSIPKGTLVIGSLTSVLFDESEWETPHSFNPGHFL----DAEGKFRRRDAFLPFSLGKRVCLGEQLARMELFLFFSSLLQRFTFS 467          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: cyp2r1 (cytochrome P450 family 2 subfamily R member 1 [Source:NCBI gene;Acc:100127674])

HSP 1 Score: 114.39 bits (285), Expect = 3.211e-28
Identity = 49/119 (41.18%), Postives = 76/119 (63.87%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAE 357
            T+AV+ EILR  ++ PL +FH T  D  + GY IP+ + +  NL++ H D   WT+P  F PE FL    D   ++  ++  +PFS+G+R C+GE LAR+E ++FFT ++QRF + F +
Sbjct:  341 TEAVLHEILRYCNIAPLGIFHATSRDTVVRGYSIPEGTTVITNLYSVHFDEKYWTDPEIFYPERFL----DSAGQFTKKEAFVPFSLGRRHCLGEQLARMEMYLFFTALLQRFHLHFPQ 455          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: ENSXETT00000042668.1 (cytochrome P450 family 2 subfamily J member 2 [Source:NCBI gene;Acc:100492305])

HSP 1 Score: 104.76 bits (260), Expect = 3.461e-27
Identity = 56/136 (41.18%), Postives = 78/136 (57.35%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEEQYSKVLISDDAP 408
            TQAV+ E+ R +SVVPL V H T +D  ++ + IPK +LI  +L + H D   W  P  F+PE+FL  E +  LK  S    +PFS G R C+GE+LAR+E F+FFT M+Q F     +      ++ V     AP
Sbjct:    4 TQAVLQEVQRFASVVPLGVPHSTIKDVQLHDFTIPKGTLIITDLSSVHYDETHWKYPHEFNPENFLNEEGE-LLKIES---FLPFSAGPRVCLGENLARMEIFLFFTAMLQHFEFHLPDPTCRPDFTPVFGLTQAP 135          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: ENSXETT00000049111.1 (cytochrome P450 family 21 subfamily A member 2 [Source:NCBI gene;Acc:100489813])

HSP 1 Score: 109.383 bits (272), Expect = 2.760e-26
Identity = 51/113 (45.13%), Postives = 71/113 (62.83%), Query Frame = 1
Query:    4 QAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFR 342
             A + E+LRL  VVPL+V H T  D +I GY IPK + + PN++A H+D  +W NP  F PE FL    +      S + L+PFS+G R CIGE+LAR+E F F + +++ FR
Sbjct:  365 NATVSEMLRLRPVVPLAVPHCTIRDTSIAGYTIPKGTTVIPNIYAAHLDETIWDNPTQFYPERFLSPSENS----HSSRALLPFSVGARLCIGETLARMEVFFFLSHLLRDFR 473          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: ENSXETT00000042623.1 (cytochrome P450 family 2 subfamily J member 2 [Source:NCBI gene;Acc:100492305])

HSP 1 Score: 104.375 bits (259), Expect = 3.796e-25
Identity = 56/136 (41.18%), Postives = 78/136 (57.35%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEEQYSKVLISDDAP 408
            TQAV+ E+ R +SVVPL V H T +D  ++ + IPK +LI  +L + H D   W  P  F+PE+FL  E +  LK  S    +PFS G R C+GE+LAR+E F+FFT M+Q F     +      ++ V     AP
Sbjct:  203 TQAVLQEVQRFASVVPLGVPHSTIKDVQLHDFTIPKGTLIITDLSSVHYDETHWKYPHEFNPENFLNEEGE-LLKIES---FLPFSAGPRVCLGENLARMEIFLFFTAMLQHFEFHLPDPTCRPDFTPVFGLTQAP 334          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: ENSXETT00000056214.1 (cytochrome P450 2D20-like [Source:NCBI gene;Acc:100494106])

HSP 1 Score: 105.916 bits (263), Expect = 4.092e-25
Identity = 50/113 (44.25%), Postives = 67/113 (59.29%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRF 339
            T AV+ E  R  +++P ++FH  + D NI G+ IPK + I PNL +   D  +W  P  F PEHFL    D   K+  R+  IPFS GKR C GE+LA+ E F+FF  + QRF
Sbjct:  343 TNAVIHETQRYGNILPTALFHMAYRDTNIQGFNIPKGTTIIPNLTSVLKDETIWERPYQFYPEHFL----DSEGKFVKREAFIPFSAGKRMCAGEALAKTELFLFFVSLFQRF 451          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2r1 (cytochrome P450, family 2, subfamily r, polypeptide 1 [Source:MGI Symbol;Acc:MGI:2449771])

HSP 1 Score: 121.324 bits (303), Expect = 4.398e-32
Identity = 55/121 (45.45%), Postives = 79/121 (65.29%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEEL 363
            T+AV+ E+LR  ++VPL +FH T EDA + GY IPK + +  NL++ H D   W +P  F PE FL    D    +  ++ LIPFS+G+R C+GE LAR+E F+FFT ++Q+F + F  EL
Sbjct:  152 TEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWKDPDMFYPERFL----DSNGYFTKKEALIPFSLGRRHCLGEQLARMEMFLFFTSLLQQFHLHFPHEL 268          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2r1 (cytochrome P450, family 2, subfamily r, polypeptide 1 [Source:MGI Symbol;Acc:MGI:2449771])

HSP 1 Score: 120.939 bits (302), Expect = 7.726e-32
Identity = 55/121 (45.45%), Postives = 79/121 (65.29%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEEL 363
            T+AV+ E+LR  ++VPL +FH T EDA + GY IPK + +  NL++ H D   W +P  F PE FL    D    +  ++ LIPFS+G+R C+GE LAR+E F+FFT ++Q+F + F  EL
Sbjct:  150 TEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWKDPDMFYPERFL----DSNGYFTKKEALIPFSLGRRHCLGEQLARMEMFLFFTSLLQQFHLHFPHEL 266          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2r1 (cytochrome P450, family 2, subfamily r, polypeptide 1 [Source:MGI Symbol;Acc:MGI:2449771])

HSP 1 Score: 121.324 bits (303), Expect = 1.167e-30
Identity = 55/121 (45.45%), Postives = 79/121 (65.29%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEEL 363
            T+AV+ E+LR  ++VPL +FH T EDA + GY IPK + +  NL++ H D   W +P  F PE FL    D    +  ++ LIPFS+G+R C+GE LAR+E F+FFT ++Q+F + F  EL
Sbjct:  361 TEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWKDPDMFYPERFL----DSNGYFTKKEALIPFSLGRRHCLGEQLARMEMFLFFTSLLQQFHLHFPHEL 477          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2j6 (cytochrome P450, family 2, subfamily j, polypeptide 6 [Source:MGI Symbol;Acc:MGI:1270148])

HSP 1 Score: 115.546 bits (288), Expect = 1.136e-28
Identity = 51/113 (45.13%), Postives = 77/113 (68.14%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRF 339
            T AV+ E+ R+ +++PL+V      D N+NG+++PK +++  NL A H DP  W  P  F+PEHFL+   +G  +++ R+  +PFS+GKR C+GE LAR E FIFFT +MQ+F
Sbjct:  361 TNAVIHEVQRMGNIIPLNVPREVAMDTNLNGFHLPKGTMVLTNLTALHRDPKEWATPDVFNPEHFLE---NG--QFKKRESFLPFSMGKRACLGEQLARSELFIFFTSLMQKF 468          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2j7 (cytochrome P450, family 2, subfamily j, polypeptide 7 [Source:MGI Symbol;Acc:MGI:2449816])

HSP 1 Score: 113.62 bits (283), Expect = 5.560e-28
Identity = 61/142 (42.96%), Postives = 87/142 (61.27%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQR--FRISFAEELSEEQYSKVLISDDAPVKSC 420
            T AV+ E+LR+ ++VPL+V      D+ + G+++PK  +I  NL A H DP  W  P  F+PEHFL+   +G  +++ R+  +PFS+GKR C GE LAR E FIFFT +MQ+  F+    E+LS +    V IS   PV  C
Sbjct:  364 TNAVIHEVLRMGNIVPLNVPREVTADSTLAGFHLPKGKMILTNLTALHRDPKEWATPDIFNPEHFLE---NG--QFKKRESFLPFSMGKRACPGEQLARTELFIFFTALMQKFTFKAPVNEKLSLKFRMSVPIS---PVSYC 497          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|Q6VVX0|CP2R1_HUMAN (Vitamin D 25-hydroxylase OS=Homo sapiens OX=9606 GN=CYP2R1 PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 5.871e-31
Identity = 55/121 (45.45%), Postives = 80/121 (66.12%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEEL 363
            T+AV+ E+LR  ++VPL +FH T EDA + GY IPK + +  NL++ H D   W +P  F PE FL    D +  +  ++ L+PFS+G+R C+GE LAR+E F+FFT ++QRF + F  EL
Sbjct:  361 TEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVFHPERFL----DSSGYFAKKEALVPFSLGRRHCLGEHLARMEMFLFFTALLQRFHLHFPHEL 477          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|Q6VVW9|CP2R1_MOUSE (Vitamin D 25-hydroxylase OS=Mus musculus OX=10090 GN=Cyp2r1 PE=1 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 8.164e-30
Identity = 55/121 (45.45%), Postives = 79/121 (65.29%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEEL 363
            T+AV+ E+LR  ++VPL +FH T EDA + GY IPK + +  NL++ H D   W +P  F PE FL    D    +  ++ LIPFS+G+R C+GE LAR+E F+FFT ++Q+F + F  EL
Sbjct:  361 TEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWKDPDMFYPERFL----DSNGYFTKKEALIPFSLGRRHCLGEQLARMEMFLFFTSLLQQFHLHFPHEL 477          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|O54750|CP2J6_MOUSE (Cytochrome P450 2J6 OS=Mus musculus OX=10090 GN=Cyp2j6 PE=2 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 7.947e-28
Identity = 51/113 (45.13%), Postives = 77/113 (68.14%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRF 339
            T AV+ E+ R+ +++PL+V      D N+NG+++PK +++  NL A H DP  W  P  F+PEHFL+   +G  +++ R+  +PFS+GKR C+GE LAR E FIFFT +MQ+F
Sbjct:  361 TNAVIHEVQRMGNIIPLNVPREVAMDTNLNGFHLPKGTMVLTNLTALHRDPKEWATPDVFNPEHFLE---NG--QFKKRESFLPFSMGKRACLGEQLARSELFIFFTSLMQKF 468          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P51589|CP2J2_HUMAN (Cytochrome P450 2J2 OS=Homo sapiens OX=9606 GN=CYP2J2 PE=1 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 2.003e-27
Identity = 52/113 (46.02%), Postives = 76/113 (67.26%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRF 339
            T AV+ E+ R+ +++PL+V      D  + GY++PK ++I  NL A H DP  W  P TF+P+HFL+   +G  +++ R+  +PFSIGKR C+GE LAR E FIFFT +MQ+F
Sbjct:  362 TNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDTFNPDHFLE---NG--QFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKF 469          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P52786|CP2J1_RABIT (Cytochrome P450 2J1 OS=Oryctolagus cuniculus OX=9986 GN=CYP2J1 PE=1 SV=2)

HSP 1 Score: 113.235 bits (282), Expect = 6.476e-27
Identity = 51/113 (45.13%), Postives = 77/113 (68.14%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRF 339
            T AV+ E+ R+ +++PL+V      D  + GY++PK +++  NL A H DP+ W  P TF+PEHFL+   +G  +++ ++  IPFSIGKR C+GE LA+ E FIFFT +MQ+F
Sbjct:  361 TNAVIHEVQRMGNILPLNVPREVTVDTTLAGYHLPKGTVVLTNLTALHKDPEEWATPDTFNPEHFLE---NG--QFKKKEAFIPFSIGKRACLGEQLAKSELFIFFTSLMQKF 468          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A4P8NYX5 (P450 2B-like protein OS=Dugesia japonica OX=6161 GN=p4502B PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.240e-57
Identity = 89/149 (59.73%), Postives = 115/149 (77.18%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEEQYSKVLISDDAPVKSCQITDYIFHR 447
            TQAVMDEI R+SSV PL++ HRT  DANI+GY+IPKN+LIFPNL+ACH D D+W  PM F PEHFL  + +G LKY  R ELI FSIGKRQC+GESLAR+EFFIFFT ++QRFR+   +EL+E++Y + L+  D  ++   + D+IF +
Sbjct:  357 TQAVMDEIFRMSSVAPLALIHRTLNDANIDGYFIPKNTLIFPNLYACHFDRDIWEKPMIFYPEHFLTEDDNGNLKYTPRDELILFSIGKRQCLGESLARMEFFIFFTSILQRFRVKLVKELNEKEYEEALLGKDGIIRGSIVNDFIFTK 505          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A2U8U473 (Cytochrome P450 2K1-like protein OS=Dugesia japonica OX=6161 GN=P450 PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 3.922e-51
Identity = 84/148 (56.76%), Postives = 113/148 (76.35%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFL-KLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEEQYSKVLISDDAPVKSCQITDYIF 441
            TQAVMDEILRLSSV PL +FHRTF D +++ Y+IPKNSL+F N +ACH DPD+W  P+ F PEHFL K E D  LKY  R+ELIPF IGKRQCIGESLAR+E+FIFF  ++QR+++ F+E +S+  + + L  ++  ++  +I ++IF
Sbjct:  357 TQAVMDEILRLSSVAPLGIFHRTFNDTSVDNYFIPKNSLVFANYYACHTDPDIWLKPVEFYPEHFLIKCEND-ELKYSPREELIPFGIGKRQCIGESLARMEYFIFFVSILQRYQVDFSENISDSLFEETLRGNEGIIRYSKIKNFIF 503          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A452RJM9 (Cytochrome P450 family 2 subfamily R member 1 OS=Ursus americanus OX=9643 GN=CYP2R1 PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 4.073e-31
Identity = 57/121 (47.11%), Postives = 79/121 (65.29%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEEL 363
            T+AV+ E+LR  ++VPL +FH T EDA + GY IPK + I  NL++ H D   W NP  F PE FL    D +  +  ++ L+PFS+GKR C+GE LAR+E F+FFT ++QRF + F   L
Sbjct:   78 TEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTIITNLYSVHFDEKYWRNPEIFSPERFL----DSSGYFAKKEALVPFSLGKRHCLGEQLARMEMFLFFTALLQRFHLHFPHGL 194          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A452UR60 (Cytochrome P450 family 2 subfamily R member 1 OS=Ursus maritimus OX=29073 GN=CYP2R1 PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 6.876e-31
Identity = 57/121 (47.11%), Postives = 79/121 (65.29%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEEL 363
            T+AV+ E+LR  ++VPL +FH T EDA + GY IPK + I  NL++ H D   W NP  F PE FL    D +  +  ++ L+PFS+GKR C+GE LAR+E F+FFT ++QRF + F   L
Sbjct:   81 TEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTIITNLYSVHFDEKYWRNPEIFSPERFL----DSSGYFAKKEALVPFSLGKRHCLGEQLARMEMFLFFTALLQRFHLHFPHGL 197          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A452RJM3 (Cytochrome P450 family 2 subfamily R member 1 OS=Ursus americanus OX=9643 GN=CYP2R1 PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 7.405e-31
Identity = 57/121 (47.11%), Postives = 79/121 (65.29%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEEL 363
            T+AV+ E+LR  ++VPL +FH T EDA + GY IPK + I  NL++ H D   W NP  F PE FL    D +  +  ++ L+PFS+GKR C+GE LAR+E F+FFT ++QRF + F   L
Sbjct:   81 TEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTIITNLYSVHFDEKYWRNPEIFSPERFL----DSSGYFAKKEALVPFSLGKRHCLGEQLARMEMFLFFTALLQRFHLHFPHGL 197          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000040098.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000139.1:3224382:3228426:1 gene:ENSAMXG00000029602.1 transcript:ENSAMXT00000040098.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.309 bits (277), Expect = 5.426e-30
Identity = 55/134 (41.04%), Postives = 83/134 (61.94%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAE--ELSEEQYSKVLIS 396
            T+AV+ EI R+ +++PL + H    D  +  Y+IPK +++  NL +   D   W  P  F PEHFL    D   K+R+R+  +P+S GKR C+GE+LAR+E F+FFT ++QRF IS  +  +LS E +   L+S
Sbjct:    4 TEAVLHEIQRVGNILPLGIPHSAGRDTTVCNYFIPKGTVVVTNLASVLNDKTQWERPQQFYPEHFL----DDQGKFRNREAFLPYSAGKRACLGENLARMEIFLFFTSVLQRFTISAPQGVKLSMEAHGASLLS 133          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: cyp2r1 (vitamin D 25-hydroxylase [Source:NCBI gene;Acc:103038630])

HSP 1 Score: 114.775 bits (286), Expect = 1.506e-29
Identity = 49/119 (41.18%), Postives = 74/119 (62.18%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAE 357
             +AV+ E+LR  ++VPL +F  T +D  + GY IP+ +++  NL++ H D   W  P  F PE FL    D    +  R   +PFS+G+R C+GE LAR+E F+FFT ++QRFR+ F +
Sbjct:  158 VEAVLHEVLRFCNIVPLGIFRATSQDTVVRGYTIPRGTMVITNLYSVHFDEKYWREPGVFCPERFL----DNNGNFMRRDAFVPFSVGRRHCLGEQLARMEMFLFFTTLLQRFRLQFPQ 272          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: cyp2r1 (vitamin D 25-hydroxylase [Source:NCBI gene;Acc:103038630])

HSP 1 Score: 115.161 bits (287), Expect = 1.589e-28
Identity = 49/119 (41.18%), Postives = 74/119 (62.18%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAE 357
             +AV+ E+LR  ++VPL +F  T +D  + GY IP+ +++  NL++ H D   W  P  F PE FL    D    +  R   +PFS+G+R C+GE LAR+E F+FFT ++QRFR+ F +
Sbjct:  368 VEAVLHEVLRFCNIVPLGIFRATSQDTVVRGYTIPRGTMVITNLYSVHFDEKYWREPGVFCPERFL----DNNGNFMRRDAFVPFSVGRRHCLGEQLARMEMFLFFTTLLQRFRLQFPQ 482          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000030247.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000410.1:296333:320922:-1 gene:ENSAMXG00000031596.1 transcript:ENSAMXT00000030247.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.227 bits (269), Expect = 7.922e-28
Identity = 56/143 (39.16%), Postives = 82/143 (57.34%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISF-AEELSEEQYSKVLISDDAPVKSCQI 426
            T AV+ E+ R+ ++VPLS+     +   I  + IPK + I PNL +   D   W  P TF+P+HFL  E     K+  R   IPF  GKR C+GE+LA++E F+FFT ++QRF  SF A  +   +YS  +  + AP + C +
Sbjct:   84 TDAVLHEVQRIGNIVPLSLHRTAAKGIQIGKHIIPKGTEIIPNLTSVMFDKSEWETPDTFNPQHFLDKEG----KFVKRTAFIPFGAGKRVCLGENLAKMELFLFFTSLLQRFSFSFPAGVMPSMEYSLGVTLNPAPYEICAV 222          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000016766.2 (pep primary_assembly:Astyanax_mexicanus-2.0:11:11445979:11462938:-1 gene:ENSAMXG00000016265.2 transcript:ENSAMXT00000016766.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.538 bits (275), Expect = 6.895e-27
Identity = 56/122 (45.90%), Postives = 78/122 (63.93%), Query Frame = 1
Query:    7 AVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEE 372
            AV++E+LRL  V PL+V H    D++I GY+IPKN++I PNLF  H DP +W+ P TF PE F  LE  G     S + L+PF  G R C+GES+A++E F+F   +++ F+  F  E  EE
Sbjct:  361 AVINEVLRLRPVAPLAVPHTAKRDSSIAGYFIPKNTVIIPNLFGAHHDPAVWSEPFTFRPERF--LEGGGG----SLRALMPFGGGARLCLGESVAKMELFLFTAYLLRDFQ--FLPEQPEE 474          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: cyp2u1 (cytochrome P450, family 2, subfamily U, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-070730-1])

HSP 1 Score: 114.39 bits (285), Expect = 4.703e-30
Identity = 55/130 (42.31%), Postives = 79/130 (60.77%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDAN--INGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEEQYSK 384
            T A + E+ RLSSVVPL++ H         + G+ IP+ S++  NL+ACHVDP +W  P+ FDPE FL    D   + R R   +PF IG+R C+GESLAR+E F+FF+ +MQ F  + +   S +   +
Sbjct:  161 TVATIMEVQRLSSVVPLAIPHSATRSVRTELRGFTIPRGSVVLLNLWACHVDPRVWARPLLFDPERFL----DPHGRLRRRDAFMPFGIGRRSCLGESLARVELFLFFSALMQEFTFTSSAPHSPDSAPR 286          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008590.1 (pep scaffold:Pmarinus_7.0:GL483327:8497:10357:1 gene:ENSPMAG00000007780.1 transcript:ENSPMAT00000008590.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.908 bits (250), Expect = 1.572e-26
Identity = 47/113 (41.59%), Postives = 71/113 (62.83%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRF 339
            T AV+ E+ R +S+VPL++ H T  DA   GY++P+ +++F  L +   DP  W  P  F+P HF  L+ DG  K+R R   +PFS G+R C+GE LA+ E F+F   ++Q+F
Sbjct:   17 TNAVLYEVQRFASIVPLALPHATTRDALFQGYFLPEGTIVFAVLDSVLKDPSQWETPEEFNPSHF--LDRDG--KFRKRDAFLPFSAGRRVCLGEQLAKAELFLFLVALLQKF 125          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002462.1 (pep scaffold:Pmarinus_7.0:GL485824:2571:10389:-1 gene:ENSPMAG00000002249.1 transcript:ENSPMAT00000002462.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.5969 bits (244), Expect = 4.106e-24
Identity = 51/137 (37.23%), Postives = 73/137 (53.28%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEEQYSKVLISDDAPV 411
            T AV+ E  R+++V PL V H T  D    GY IPK + +  NL +   D   W  P  F+P+HFL    D T ++      + FS G R C+GE+LAR+E F+FFT ++QRF+  + +  S   +        APV
Sbjct:  188 TDAVIHEAQRMANVAPLGVLHSTTTDVKFRGYNIPKGTKVLLNLTSVLHDETQWKTPNEFNPDHFL----DNTGQFVKPDAFLAFSAGPRVCLGENLARMELFLFFTSLLQRFKFHWPDATSRPNFVAAEGLSRAPV 320          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: cyp17a1 (cytochrome P450, family 17, subfamily A, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-040213-2])

HSP 1 Score: 97.4413 bits (241), Expect = 4.596e-23
Identity = 48/117 (41.03%), Postives = 69/117 (58.97%), Query Frame = 1
Query:    7 AVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKE-LIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFA 354
            A + EILRL  V PL++ HR   D+++ G++I K S +  NL+A H D   W NP  F P  FL      +L+ R+    L+PF  GKR C+GESLA+ E F+F   +++R R+  A
Sbjct:  369 ATIKEILRLCPVAPLAIPHRALRDSSVGGFFICKGSTVIANLWAAHRDHAHWDNPSVFQPGRFL----GESLERRNPASLLLPFGAGKRVCLGESLAKAEIFLFLGHVLRRLRLQPA 481          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011254.1 (pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 gene:ENSPMAG00000010227.1 transcript:ENSPMAT00000011254.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.6633 bits (226), Expect = 4.654e-21
Identity = 47/120 (39.17%), Postives = 67/120 (55.83%), Query Frame = 1
Query:    7 AVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELS 366
            AV+ EI R  +V+PL V H T +D   N Y  PK + +  NL +   D   W  P  F+P+HF  L+ DG  +       +PFS G R C+GESLA++E F+FFT ++Q F   +   +S
Sbjct:  358 AVIHEIQRFGNVLPLGVLHATSKDVQFNDYLFPKGTHVMVNLMSALHDDIHWKTPNKFNPDHF--LDKDG--QCIQSDAFLPFSAGPRVCLGESLAKMEIFLFFTSLLQHFEFYWPNSVS 473          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO37670 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF10])

HSP 1 Score: 113.62 bits (283), Expect = 5.298e-29
Identity = 49/118 (41.53%), Postives = 77/118 (65.25%), Query Frame = 1
Query:    4 QAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAE 357
            +A + EILR+ S+VPL++ H+   D  ++GY +PK + +  NL+A H DP+ W NP  FDP  F  L+ DG+ +    K  +PFS G+R C+GE+LA++E F+  +R++ +FR S  E
Sbjct:  243 EATIAEILRIRSIVPLALPHKATCDTTLSGYDVPKGTTVIVNLWAIHHDPEEWLNPEEFDPSRF--LDADGSYRAAGEKSFLPFSAGRRSCLGEALAKMELFLVCSRILHQFRFSHLE 358          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO28446 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6F9])

HSP 1 Score: 105.916 bits (263), Expect = 8.068e-26
Identity = 48/115 (41.74%), Postives = 77/115 (66.96%), Query Frame = 1
Query:    4 QAVMDEILRLSSVVPLSVFHR-TFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRI 345
            +A + E+LR+++V+P+ V H+ T  +  + GY IPK+++I  NL+A H DP  W NP  FDP+ F+    DG  +   ++  +PFS G+R C+GESLA+IE F+  TR++Q+F +
Sbjct:  314 EATIAEVLRIATVLPMGVPHKATTNNVPLMGYNIPKDTIIVMNLWAIHHDPREWPNPDKFDPDRFIN--EDGKFEVPGQRSYLPFSAGRRVCVGESLAKIELFLVMTRLLQQFTL 426          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO41250 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S508])

HSP 1 Score: 105.916 bits (263), Expect = 9.659e-26
Identity = 48/115 (41.74%), Postives = 77/115 (66.96%), Query Frame = 1
Query:    4 QAVMDEILRLSSVVPLSVFHR-TFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRI 345
            +A + E+LR+++V+P+ V H+ T  +  + GY IPK+++I  NL+A H DP  W NP  FDP+ F+    DG  +   ++  +PFS G+R C+GESLA+IE F+  TR++Q+F +
Sbjct:  348 EATIAEVLRIATVLPMGVPHKATTNNVPLMGYNIPKDTIIVMNLWAIHHDPREWPNPDKFDPDRFIN--EDGKFEVPGQRSYLPFSAGRRVCVGESLAKIELFLVMTRLLQQFTL 460          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO46999 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN35])

HSP 1 Score: 103.99 bits (258), Expect = 3.487e-25
Identity = 51/119 (42.86%), Postives = 74/119 (62.18%), Query Frame = 1
Query:    4 QAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRS-RKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAE 357
            +AV+ E LRLSSVV L+V H+T +D  + GY IPK + +  N++A H +   WT P+ FDP  F  L++DG     S  +  +PF  G+R CIGE+LA+ E F+  +R+M +F    AE
Sbjct:  313 EAVIAETLRLSSVVALAVPHKTIQDTTLEGYDIPKGTTVLLNIWAMHHNETEWTCPLKFDPSRF--LDSDGNFSAGSGSRSYLPFGAGRRVCIGEALAKQELFVVISRLMHKFVNETAE 429          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO41284 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S507])

HSP 1 Score: 103.99 bits (258), Expect = 3.861e-25
Identity = 47/115 (40.87%), Postives = 76/115 (66.09%), Query Frame = 1
Query:    4 QAVMDEILRLSSVVPLSVFHR-TFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRI 345
            +A + E+LR+++V P+ + H+ T  +  + GY IPK+++I  NL+A H DP  W NP  FDP+ F+    DG  +   ++  +PFS G+R C+GESLA+IE F+  TR++Q+F +
Sbjct:  348 EATIAEVLRIATVAPMGLPHKATTNNVPLMGYNIPKDTIIVMNLWAIHHDPREWPNPDKFDPDRFIN--EDGKFEVPGQRSYLPFSAGRRVCVGESLAKIELFLVMTRLLQQFTL 460          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: cyp2r1 (vitamin D 25-hydroxylase [Source:NCBI gene;Acc:101164878])

HSP 1 Score: 118.627 bits (296), Expect = 8.155e-30
Identity = 51/117 (43.59%), Postives = 76/117 (64.96%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISF 351
             +AV+ EILR  ++VPL +F  T ++A +NGY IPK +++  NL++ H D   W  P  F P+ FL    D +  +  R+  +PFS+GKR C+GE LAR+E F+FFT ++QRF + F
Sbjct:  365 VEAVLHEILRFCNIVPLGIFRATSQEAKVNGYTIPKGTMVITNLYSVHFDEKYWNEPGVFSPQRFL----DSSGNFVRREAFLPFSLGKRHCLGEQLARMEMFLFFTTLLQRFHLQF 477          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: cyp21a2 (steroid 21-hydroxylase [Source:NCBI gene;Acc:101157155])

HSP 1 Score: 110.153 bits (274), Expect = 6.201e-27
Identity = 51/117 (43.59%), Postives = 76/117 (64.96%), Query Frame = 1
Query:    7 AVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAE 357
            A+++E+LRL  V PL+V HR   +++I G++IPKNS+I PNLF  H DP +W+ P +F PE F  LE  G     S + L+PF  G R C+GES+A++E F+F   +++ F+    E
Sbjct:  308 ALVNEVLRLRPVAPLAVPHRAIRNSSIAGFFIPKNSVIIPNLFGAHHDPAVWSEPYSFKPERF--LEGGGG----STRALVPFGGGARLCLGESVAKMELFLFTAYLLRDFQFILPE 418          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: cyp21a2 (steroid 21-hydroxylase [Source:NCBI gene;Acc:101157155])

HSP 1 Score: 110.538 bits (275), Expect = 6.964e-27
Identity = 51/117 (43.59%), Postives = 76/117 (64.96%), Query Frame = 1
Query:    7 AVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAE 357
            A+++E+LRL  V PL+V HR   +++I G++IPKNS+I PNLF  H DP +W+ P +F PE F  LE  G     S + L+PF  G R C+GES+A++E F+F   +++ F+    E
Sbjct:  376 ALVNEVLRLRPVAPLAVPHRAIRNSSIAGFFIPKNSVIIPNLFGAHHDPAVWSEPYSFKPERF--LEGGGG----STRALVPFGGGARLCLGESVAKMELFLFTAYLLRDFQFILPE 486          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000020799.2 (cytochrome P450 2J6 [Source:NCBI gene;Acc:101155419])

HSP 1 Score: 108.997 bits (271), Expect = 2.460e-26
Identity = 55/116 (47.41%), Postives = 71/116 (61.21%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRIS 348
            T AV+ E+ R+ ++VPLS+ H T +D  + G+ IPK  LI PNL +   D   W  P  F+P HFL    DG  K+  R   IPFS GKR C+GE+LAR+E F+FFT  MQ F  S
Sbjct:  383 TDAVIHEVQRIGNIVPLSLPHATNKDVQLGGFTIPKGVLIIPNLTSVLFDEKEWETPHAFNPGHFLN--KDG--KFVKRGAFIPFSAGKRLCLGENLARMELFLFFTSFMQHFSFS 494          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000019638.2 (cytochrome P450 2K1 [Source:NCBI gene;Acc:101157991])

HSP 1 Score: 108.612 bits (270), Expect = 3.287e-26
Identity = 56/127 (44.09%), Postives = 81/127 (63.78%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEEQYS 381
            T AV+ EI RL+S+VP ++ H+T +D    GY+I K + +FP L +   D + W  P TF P HF  L+ DG  K+  R+  IPFS G+R C+GESLAR+E F+FFT ++Q F  +    +S+E+ S
Sbjct:  359 TDAVIHEIQRLASIVPTALPHKTSKDVTFQGYFIKKGTTVFPLLTSVLHDANEWEKPHTFYPAHF--LDKDG--KFVKREAFIPFSAGRRICLGESLARMELFMFFTTLLQNFCFTPPPGVSKEELS 481          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000072586.1 (SMESG000072586.1)

HSP 1 Score: 306.22 bits (783), Expect = 7.878e-106
Identity = 145/150 (96.67%), Postives = 148/150 (98.67%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEEQYSKVLISDDAPVKSCQITDYIFHRL 450
            TQAVMDEILRLSSVVPLS+FHRTFEDANINGYYIPKNS+IFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYR R+ELIPF IGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEEQYSKVLISDDAPVKSCQITDYIFHRL
Sbjct:   36 TQAVMDEILRLSSVVPLSIFHRTFEDANINGYYIPKNSMIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRPREELIPFGIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEEQYSKVLISDDAPVKSCQITDYIFHRL 185          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000072594.1 (SMESG000072594.1)

HSP 1 Score: 315.079 bits (806), Expect = 1.049e-104
Identity = 150/150 (100.00%), Postives = 150/150 (100.00%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEEQYSKVLISDDAPVKSCQITDYIFHRL 450
            TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEEQYSKVLISDDAPVKSCQITDYIFHRL
Sbjct:  356 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEEQYSKVLISDDAPVKSCQITDYIFHRL 505          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000078091.1 (SMESG000078091.1)

HSP 1 Score: 218.779 bits (556), Expect = 1.848e-67
Identity = 94/149 (63.09%), Postives = 128/149 (85.91%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEEQYSKVLISDDAPVKSCQITDYIFHR 447
            TQAVMDE+LRLSSV P+ + HRTF+DANING+YIPK+SLIFPNL+ACH+DP++W +P TF PEHFL L+++G  KY+ R+ELIPFS+GKRQC+GESLAR E+FIFF  M+QRF+ISFAEE+SE++YS+ +I ++  +++  I +++F R
Sbjct:  357 TQAVMDEVLRLSSVAPMGLIHRTFDDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVSMVQRFQISFAEEISEDKYSQTIIGNEGVIRTSDIKNFLFKR 505          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000078100.1 (SMESG000078100.1)

HSP 1 Score: 215.312 bits (547), Expect = 4.042e-66
Identity = 95/147 (64.63%), Postives = 124/147 (84.35%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEEQYSKVLISDDAPVKSCQITDYIF 441
            TQAVMDE+LRLSSV P+ + HRTF DANING+YIPK+SLIFPNL+ACH+DP++W +P TF PEHFL L+++G  KY+ R+ELIPFS+GKRQCIGESLAR E+FIFF  M+QRF+ISFAEE+SEE+Y + +I ++  +++  IT + F
Sbjct:  357 TQAVMDEVLRLSSVAPMGLMHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCIGESLARSEYFIFFVSMVQRFQISFAEEISEEKYLQTIIGNEGHIRTSDITKFKF 503          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000078092.1 (SMESG000078092.1)

HSP 1 Score: 215.312 bits (547), Expect = 5.444e-66
Identity = 94/149 (63.09%), Postives = 126/149 (84.56%), Query Frame = 1
Query:    1 TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVDPDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARIEFFIFFTRMMQRFRISFAEELSEEQYSKVLISDDAPVKSCQITDYIFHR 447
            TQAVMDE+LRLSSVVP+++ HRTF DANING+YIPK+SLIFPNL+ACH+DP++W  P T  PEHFL L+++G  KY+ R+ELIPFS+GKRQCIGESLAR E+FIFF  M+QRF+ISF EE+SE++YS+ +I ++  +++  I +++F R
Sbjct:  357 TQAVMDEVLRLSSVVPMALIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWEFPKTLYPEHFLSLDSNGISKYQPREELIPFSVGKRQCIGESLARSEYFIFFVSMVQRFQISFGEEISEDRYSQTIIGNEGLIRTSDIKNFLFKR 505          
The following BLAST results are available for this feature:
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CYP2R14.709e-3345.45cytochrome P450 family 2 subfamily R member 1 [Sou... [more]
CYP2R11.222e-3145.45cytochrome P450 family 2 subfamily R member 1 [Sou... [more]
CYP2J24.170e-2846.02cytochrome P450 family 2 subfamily J member 2 [Sou... [more]
CYP2U14.234e-2642.50cytochrome P450 family 2 subfamily U member 1 [Sou... [more]
CYP2U12.972e-2542.50cytochrome P450 family 2 subfamily U member 1 [Sou... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp-33E15.754e-2542.37CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33E15.754e-2542.37CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-23A17.197e-2436.81CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
daf-94.593e-2342.11Cytochrome P450 daf-9 [Source:UniProtKB/Swiss-Pro... [more]
daf-94.841e-2342.11Cytochrome P450 daf-9 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp18a14.972e-2340.34gene:FBgn0010383 transcript:FBtr0074610[more]
Cyp18a14.972e-2340.34gene:FBgn0010383 transcript:FBtr0074609[more]
Cyp304a11.139e-1940.71gene:FBgn0038095 transcript:FBtr0082691[more]
phm6.894e-1636.21gene:FBgn0004959 transcript:FBtr0074603[more]
phm6.894e-1636.21gene:FBgn0004959 transcript:FBtr0342846[more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2r11.765e-3040.56cytochrome P450, family 2, subfamily R, polypeptid... [more]
cyp2k194.810e-2740.41cytochrome P450, family 2, subfamily k, polypeptid... [more]
cyp2k211.269e-2640.41cytochrome P450, family 2, subfamily k, polypeptid... [more]
cyp2k201.888e-2640.41cytochrome P450, family 2, subfamily k, polypeptid... [more]
cyp2p72.942e-2645.69cytochrome P450, family 2, subfamily P, polypeptid... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2r13.211e-2841.18cytochrome P450 family 2 subfamily R member 1 [Sou... [more]
ENSXETT00000042668.13.461e-2741.18cytochrome P450 family 2 subfamily J member 2 [Sou... [more]
ENSXETT00000049111.12.760e-2645.13cytochrome P450 family 21 subfamily A member 2 [So... [more]
ENSXETT00000042623.13.796e-2541.18cytochrome P450 family 2 subfamily J member 2 [Sou... [more]
ENSXETT00000056214.14.092e-2544.25cytochrome P450 2D20-like [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp2r14.398e-3245.45cytochrome P450, family 2, subfamily r, polypeptid... [more]
Cyp2r17.726e-3245.45cytochrome P450, family 2, subfamily r, polypeptid... [more]
Cyp2r11.167e-3045.45cytochrome P450, family 2, subfamily r, polypeptid... [more]
Cyp2j61.136e-2845.13cytochrome P450, family 2, subfamily j, polypeptid... [more]
Cyp2j75.560e-2842.96cytochrome P450, family 2, subfamily j, polypeptid... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6VVX0|CP2R1_HUMAN5.871e-3145.45Vitamin D 25-hydroxylase OS=Homo sapiens OX=9606 G... [more]
sp|Q6VVW9|CP2R1_MOUSE8.164e-3045.45Vitamin D 25-hydroxylase OS=Mus musculus OX=10090 ... [more]
sp|O54750|CP2J6_MOUSE7.947e-2845.13Cytochrome P450 2J6 OS=Mus musculus OX=10090 GN=Cy... [more]
sp|P51589|CP2J2_HUMAN2.003e-2746.02Cytochrome P450 2J2 OS=Homo sapiens OX=9606 GN=CYP... [more]
sp|P52786|CP2J1_RABIT6.476e-2745.13Cytochrome P450 2J1 OS=Oryctolagus cuniculus OX=99... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4P8NYX51.240e-5759.73P450 2B-like protein OS=Dugesia japonica OX=6161 G... [more]
A0A2U8U4733.922e-5156.76Cytochrome P450 2K1-like protein OS=Dugesia japoni... [more]
A0A452RJM94.073e-3147.11Cytochrome P450 family 2 subfamily R member 1 OS=U... [more]
A0A452UR606.876e-3147.11Cytochrome P450 family 2 subfamily R member 1 OS=U... [more]
A0A452RJM37.405e-3147.11Cytochrome P450 family 2 subfamily R member 1 OS=U... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000040098.15.426e-3041.04pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
cyp2r11.506e-2941.18vitamin D 25-hydroxylase [Source:NCBI gene;Acc:103... [more]
cyp2r11.589e-2841.18vitamin D 25-hydroxylase [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000030247.17.922e-2839.16pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000016766.26.895e-2745.90pep primary_assembly:Astyanax_mexicanus-2.0:11:114... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2u14.703e-3042.31cytochrome P450, family 2, subfamily U, polypeptid... [more]
ENSPMAT00000008590.11.572e-2641.59pep scaffold:Pmarinus_7.0:GL483327:8497:10357:1 ge... [more]
ENSPMAT00000002462.14.106e-2437.23pep scaffold:Pmarinus_7.0:GL485824:2571:10389:-1 g... [more]
cyp17a14.596e-2341.03cytochrome P450, family 17, subfamily A, polypepti... [more]
ENSPMAT00000011254.14.654e-2139.17pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 ge... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO376705.298e-2941.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO284468.068e-2641.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412509.659e-2641.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469993.487e-2542.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412843.861e-2540.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2r18.155e-3043.59vitamin D 25-hydroxylase [Source:NCBI gene;Acc:101... [more]
cyp21a26.201e-2743.59steroid 21-hydroxylase [Source:NCBI gene;Acc:10115... [more]
cyp21a26.964e-2743.59steroid 21-hydroxylase [Source:NCBI gene;Acc:10115... [more]
ENSORLT00000020799.22.460e-2647.41cytochrome P450 2J6 [Source:NCBI gene;Acc:10115541... [more]
ENSORLT00000019638.23.287e-2644.09cytochrome P450 2K1 [Source:NCBI gene;Acc:10115799... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072586.17.878e-10696.67SMESG000072586.1[more]
SMESG000072594.11.049e-104100.00SMESG000072594.1[more]
SMESG000078091.11.848e-6763.09SMESG000078091.1[more]
SMESG000078100.14.042e-6664.63SMESG000078100.1[more]
SMESG000078092.15.444e-6663.09SMESG000078092.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003937 ID=SMED30003937|Name=Cytochrome P450 2K1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=900bp
ACTCAAGCTGTAATGGATGAAATATTGAGATTAAGCTCGGTGGTCCCTTT
GTCTGTTTTCCACAGAACCTTCGAAGACGCAAATATAAATGGATATTACA
TTCCTAAAAATTCATTGATATTCCCTAATTTGTTTGCATGTCATGTTGAT
CCGGATCTCTGGACGAATCCGATGACATTTGATCCAGAACACTTCCTCAA
ATTGGAAACTGACGGCACCTTAAAATACCGCTCAAGAAAGGAATTAATTC
CATTTAGTATTGGAAAACGGCAGTGCATTGGAGAGTCACTAGCTAGAATA
GAATTTTTTATTTTCTTTACGAGAATGATGCAACGATTCCGAATAAGTTT
CGCGGAAGAGCTAAGCGAGGAACAATATTCTAAAGTTCTAATCAGTGATG
ATGCACCTGTCAAAAGTTGTCAAATCACTGACTATATATTTCACAGATTA
TAATTGAGCAAAAGTTTTGCATTGTGGAAAAGTGATTATTAGGTGGAGAC
TGGACGCTTCCTTATATTTGTTAATATCTTTGTTATATTATCGTGAAACT
TTATATGCATTATTGCATTCATATTTTGTGATGCTTATTGTAATGGACAA
CAATCTACTTTATTCAATGAGGCCGGATCAGACATCTTTAACCTGCTGCT
CTTTTCACAATTTTCTGTAGTTCTCCAAGTTTTATAGATTATATACTATT
TTCGACTAAAACAAGAAATATTTTAGCTTCAGCTTGATTTTTATTTTGGT
TATTAACAGCAATGCTTTCCTACAGGTTCGCATCGGTTCGCGCGAACTGT
TCGTTCTAAATCTTTTGTTTCATGATCACATAAATTAAATTTACTTTGAT
AAATTTAAAAAAGTATAAAAATTTAAACCTAAAGGATGTAGCGAAAACCA
back to top

protein sequence of SMED30003937-orf-1

>SMED30003937-orf-1 ID=SMED30003937-orf-1|Name=SMED30003937-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=151bp
TQAVMDEILRLSSVVPLSVFHRTFEDANINGYYIPKNSLIFPNLFACHVD
PDLWTNPMTFDPEHFLKLETDGTLKYRSRKELIPFSIGKRQCIGESLARI
EFFIFFTRMMQRFRISFAEELSEEQYSKVLISDDAPVKSCQITDYIFHRL
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036396Cyt_P450_sf
IPR002401Cyt_P450_E_grp-I
IPR001128Cyt_P450
IPR017972Cyt_P450_CS
Vocabulary: molecular function
TermDefinition
GO:0016705oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0005506iron ion binding
GO:0020037heme binding
GO:0004497monooxygenase activity
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001128Cytochrome P450PRINTSPR00385P450coord: 83..92
score: 58.44
coord: 92..103
score: 48.89
coord: 3..14
score: 40.58
IPR001128Cytochrome P450PFAMPF00067p450coord: 1..122
e-value: 4.9E-40
score: 137.6
IPR002401Cytochrome P450, E-class, group IPRINTSPR00463EP450Icoord: 92..115
score: 43.06
coord: 82..92
score: 56.31
coord: 43..67
score: 39.98
coord: 2..20
score: 36.91
IPR036396Cytochrome P450 superfamilyGENE3DG3DSA:1.10.630.10coord: 1..143
e-value: 4.5E-44
score: 153.1
IPR036396Cytochrome P450 superfamilySUPERFAMILYSSF48264Cytochrome P450coord: 1..122
NoneNo IPR availablePANTHERPTHR24299:SF2coord: 1..121
NoneNo IPR availablePANTHERPTHR24299FAMILY NOT NAMEDcoord: 1..121
IPR017972Cytochrome P450, conserved sitePROSITEPS00086CYTOCHROME_P450coord: 85..94