AAA domain-containing protein

Overview
NameAAA domain-containing protein
Smed IDSMED30003935
Length (bp)5304
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of AAA domain-containing protein (SMED30003935) t-SNE clustered cells

Violin plots show distribution of expression levels for AAA domain-containing protein (SMED30003935) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of AAA domain-containing protein (SMED30003935) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for AAA domain-containing protein (SMED30003935) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003935

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30003935SMESG000012845.1 SmedASXL_017742SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30003935SMESG000012845.1 dd_Smed_v6_9637_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30003935SMESG000012845.1 dd_Smed_v4_9637_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30003935SMESG000012845.1 dd_Smed_v4_9637_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30003935SMESG000012845.1 dd_Smed_v4_9637_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of AAA domain-containing protein vs. Ensembl Human
Match: NWD2 (NACHT and WD repeat domain containing 2 [Source:HGNC Symbol;Acc:HGNC:29229])

HSP 1 Score: 146.362 bits (368), Expect = 2.557e-34
Identity = 215/995 (21.61%), Postives = 411/995 (41.31%), Query Frame = 1
Query:   40 TSLPFTAASLPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCV--------EPEMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSP-VIFNREIIDIKNFI----------VISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILWRDDTGVSEAHHQIYIDQFEAFITAKVVEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKF---GCGYEDIVYAMLDYLTDDDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHD----SECHFITRFVTSNCTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSF-----QQQSNKKFIIILHDFEKCSEVGSQSLVTDLIPKFLPKNLKLIVSSTDSFDTRKPYFLNVLVPEFTQTEF--------NIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLGEFYALNLNRWY----KRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDV-IKDGYLLV--DLATTVSVESLIDDKNSHLKDFHQILAGYFNGAW--------------------------VDQTISF----HFDLKNPEMSY--NCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNGGKEIVLLEESINNSALVIENDL----DSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSP 2778
            T+LP  +  +P    +  F+ ++ ED   ER+ L   ++PKL+E C + +G+E ++ID+  G++     +   Q+   + L          C + LLG+KYGN+  P  +    F+++L+     K    +E   LE++Y  D N V        + EM+  +  A+ P    ++       ++ W++    +  +F+   K+    G +      +   +  E  F   + K   +     V + R+I +I+ F+          +   + +  +   A EKLI +       +V + +L+      +      Y        I      G+ +  ++  ID  +A I             + N D     L  YD I         +A F    C   +IV+  +        N P+I+YG P +GK+++ A    +    L  D    S+   I RF+ +   ++    ++ L +          E +  N + +  + P+ I  +   F     +    +  +II    E+ SE    +     +P  LP+ +++++S+  +          ++  E    E         +  ++ QL    + +T  Q + +++N L       T  + V+  + +   + S +++   +L      ++ + +    K+ G+ L+S  L YI  +  GL++ E+ +VL LD  VM+E+  N   S     + ++ P      +K+ LS  L++  +K+  LLV  +    +  + L    ++ L++ H ILA YF G W                          +++   F     FD + P+  +   C P    ++       F N+RK  +L+ HL      D+L+  +I +F +LY   K  +  ++L D +LA N  +E  L  + + N+   I+N +     SL+ EL  +LLP VS  P LR L+  CDK  PK+ + VP++ S  +  SP
Sbjct:   28 TALP--SHLVPAGRSVRVFISANPEDTGAERQALRENVYPKLREFCRENYGLEFQVIDLYWGVEEDEWDSPELQKTRMKLLENCLKTSAGPCFVGLLGEKYGNIRIPGEVEASEFEMILDAAIEAK----LETKLLEEWYCRDENSVPAAYYLRPKSEMLRSNRNAMQPSTNAEN-------EKTWQEISDEIKKIFKAAVKLLHEKGKMKHSQAKRYLFSAIEDEFDFALGKQTPAFLKKCVCYIRKIANIERFVKIPEMGKYMDITGTEPRIIRDPEAQEKLIKLRDEFIPTIVASSNLRVYTSVTHCDMKLGYSQEIENHYI-----EGLGKQFYEDMIDIIQATI-------------QQNFDTETDTL--YDEILQHSSLCKTYASFYEYKCESLNIVHNYILPSKAGHIN-PLIIYGGPCTGKTLLLAEVAKKAYGWLHEDTGPESDPVVIVRFLGTT-DMSSDLRTLLLSVC---------EQLAVNYRCLVQSYPKKIHDLCDLFINLLNESSLQRPLVIIFDALEQLSE-NDDARKLWWLPAHLPRFVRIVLSTLPNKHGILQKLRCLIHEEDNYIELIPRDRKMCSQVLKHQLLRVKRKVTSGQ-QIYVNNALSKC----TLPMFVNLTFREVRHWRSHKDVDESSLSVTVHESIEQLFWSLEKKCGQKLVSRALGYITMAKMGLSEMELEDVLALDNSVMSELKENTRPS-----NPLRVPYLYIARLKEGLSGYLIERHVKNVTLLVWANRHLQLIAQKLYLQDDNDLREMHTILADYFLGVWSGGRRKAFCLEDPYLNGCLDLENRSLLEEEKHFMEQASFDRQAPDQPWVFQCNPLEPDIF-------FVNHRKMSELLYHLTRCGKTDDLLYGIIMNFSWLYTMIKIGQFDKVLSDIELAYNYSQEKEL--KFLANTLRSIKNKVTAFPGSLSAELQQRLLPVVSSLPKLRHLLLECDKDGPKYCSIVPLHSSMDVTYSP 958          
BLAST of AAA domain-containing protein vs. Ensembl Human
Match: NWD1 (NACHT and WD repeat domain containing 1 [Source:HGNC Symbol;Acc:HGNC:27619])

HSP 1 Score: 90.5077 bits (223), Expect = 2.429e-17
Identity = 89/376 (23.67%), Postives = 169/376 (44.95%), Query Frame = 1
Query: 1876 IPCQTLGEFYALNL-NRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLVDLATTVSVESLIDD--KNSHLKDFHQILAGYFNGAWVDQT---ISFHFDLKNPEMSYNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARN--GGKEIVLLEESINNSALVIE---NDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAP-----KHNAFVPIYPSNKLPGSPLASTIN-CPEAIESVLVIQNKESMNKELLIKLKNDSRAYFYDLSFGAISYNTLLSSGEV 2952
            +P  T  E     L  R  +  G+ L++H L YI  S  GL++ E+ +VL+LD +V+ +VY + +      + +++FP  LW+ ++++L   L     DG+ L+ +A    VE + +     S     H +LA +F+G W   T   I+     K   +     P  Q ++     +   N RK ++L  HL+     +EL + V+    ++  +  +  + +LLDDF L        E+ L+ E++      +E    +   L  EL+ +L  + + +P L  + + C +         H   VP+    + PG PL +T++ C + I ++        + ++LL+    D     +D+    + +     +GEV
Sbjct:  553 VPLATTAEEATHQLCTRLEQTHGQLLVAHVLGYIVSSRHGLSEAELKDVLSLDDEVLQDVYRDWTPP---SKELLRFPPLLWVRLRRDLGYYLARRPVDGFTLLAIAHRQLVEVVRERYLSGSERAKRHGVLADFFSGTWSQGTKKLITLPLVGKPLNLDRKVAP--QPLWFS---HTVANLRKLKELPYHLLHSGRLEELKQEVLGSMSWISCRGISGGIEDLLDDFDLCAPHLDSPEVGLVREALQLCRPAVELRGMERSLLYTELLARLHFFATSHPAL--VGQLCQQAQSWFQLCAHPVLVPLGGFLQPPGGPLRATLSGCHKGITAM-----AWGVEEKLLVIGTQDGIMAVWDMEEQHVIHMLTGHTGEV 913          

HSP 2 Score: 67.3958 bits (163), Expect = 2.577e-10
Identity = 82/398 (20.60%), Postives = 161/398 (40.45%), Query Frame = 1
Query:  148 RIFPKLQEQCF-DEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYN-CPIF--LLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILW-RDDTGVSEAHHQIYIDQFEAFITAKVVEGVAERAKKINLDLSASFLKC-YDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDDT--NVPIILYGPPNSGKSIVFARTIFEFQSSLPHDS 1317
            R  P L+ Q F    G+  +++D++ G+ +   T     ++  E +++   C K +  P F  L+G +YG    P  IP++I +   E L++H      +   + +Y+  D N   P  +L            Q   +   C+ E     S+L +  Q   ++    G +  E       +  E     ++  S D +    +F REI D+   I+      +D     +++L        AD  ++ D Q++L    +   +++       R+ W RD        H  Y+ +       +    V  R ++  LD +   L   Y  I +   Q ++  +  CG ++++  +   L  DD+  + P++L+GPP  GK+ +  +   +    L H +
Sbjct:    8 RALPTLKCQTFCQRHGLMFEVVDLRWGIRNIEATDHLTTELCLEEVDR---CWKTSIGPAFVALIGDQYG----PCLIPSRIDEKEWEVLRDHLTARPSDLELVARYFQRDENAFPPTYVL------------QAPGTGEACEPEEATLTSVLRSGAQEARRL----GLITQEQWQHYHRSVIEWEIERSLLSSEDREQGATVFLREIQDLHKHIL------EDCALRMVDRL--------ADGCLDADAQNLLSSLKSHITDMHPGVLKTHRLPWSRDLVNPKNKTHACYLKELGEQFVVRANHQVLTRLRE--LDTAGQELAWLYQEIRHHLWQSSEVIQTFCGRQELLARLGQQLRHDDSKQHTPLVLFGPPGIGKTALMCKLAEQMPRLLGHKT 366          
BLAST of AAA domain-containing protein vs. Ensembl Human
Match: NWD1 (NACHT and WD repeat domain containing 1 [Source:HGNC Symbol;Acc:HGNC:27619])

HSP 1 Score: 90.5077 bits (223), Expect = 2.629e-17
Identity = 89/376 (23.67%), Postives = 168/376 (44.68%), Query Frame = 1
Query: 1876 IPCQTLGEFYALNL-NRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLVDLATTVSVESLIDD--KNSHLKDFHQILAGYFNGAWVDQT---ISFHFDLKNPEMSYNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARN--GGKEIVLLEESINNSALVIE---NDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAP-----KHNAFVPIYPSNKLPGSPLASTI-NCPEAIESVLVIQNKESMNKELLIKLKNDSRAYFYDLSFGAISYNTLLSSGEV 2952
            +P  T  E     L  R  +  G+ L++H L YI  S  GL++ E+ +VL+LD +V+ +VY + +      + +++FP  LW+ ++++L   L     DG+ L+ +A    VE + +     S     H +LA +F+G W   T   I+     K   +     P  Q ++     +   N RK ++L  HL+     +EL + V+    ++  +  +  + +LLDDF L        E+ L+ E++      +E    +   L  EL+ +L  + + +P L  + + C +         H   VP+    + PG PL +T+  C + I ++        + ++LL+    D     +D+    + +     +GEV
Sbjct:  553 VPLATTAEEATHQLCTRLEQTHGQLLVAHVLGYIVSSRHGLSEAELKDVLSLDDEVLQDVYRDWTPP---SKELLRFPPLLWVRLRRDLGYYLARRPVDGFTLLAIAHRQLVEVVRERYLSGSERAKRHGVLADFFSGTWSQGTKKLITLPLVGKPLNLDRKVAP--QPLWFS---HTVANLRKLKELPYHLLHSGRLEELKQEVLGSMSWISCRGISGGIEDLLDDFDLCAPHLDSPEVGLVREALQLCRPAVELRGMERSLLYTELLARLHFFATSHPAL--VGQLCQQAQSWFQLCAHPVLVPLGGFLQPPGGPLRATLSGCHKGITAM-----AWGVEEKLLVIGTQDGIMAVWDMEEQHVIHMLTGHTGEV 913          

HSP 2 Score: 67.3958 bits (163), Expect = 2.883e-10
Identity = 82/398 (20.60%), Postives = 161/398 (40.45%), Query Frame = 1
Query:  148 RIFPKLQEQCF-DEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYN-CPIF--LLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILW-RDDTGVSEAHHQIYIDQFEAFITAKVVEGVAERAKKINLDLSASFLKC-YDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDDT--NVPIILYGPPNSGKSIVFARTIFEFQSSLPHDS 1317
            R  P L+ Q F    G+  +++D++ G+ +   T     ++  E +++   C K +  P F  L+G +YG    P  IP++I +   E L++H      +   + +Y+  D N   P  +L            Q   +   C+ E     S+L +  Q   ++    G +  E       +  E     ++  S D +    +F REI D+   I+      +D     +++L        AD  ++ D Q++L    +   +++       R+ W RD        H  Y+ +       +    V  R ++  LD +   L   Y  I +   Q ++  +  CG ++++  +   L  DD+  + P++L+GPP  GK+ +  +   +    L H +
Sbjct:    8 RALPTLKCQTFCQRHGLMFEVVDLRWGIRNIEATDHLTTELCLEEVDR---CWKTSIGPAFVALIGDQYG----PCLIPSRIDEKEWEVLRDHLTARPSDLELVARYFQRDENAFPPTYVL------------QAPGTGEACEPEEATLTSVLRSGAQEARRL----GLITQEQWQHYHRSVIEWEIERSLLSSEDREQGATVFLREIQDLHKHIL------EDCALRMVDRL--------ADGCLDADAQNLLSSLKSHITDMHPGVLKTHRLPWSRDLVNPKNKTHACYLKELGEQFVVRANHQVLTRLRE--LDTAGQELAWLYQEIRHHLWQSSEVIQTFCGRQELLARLGQQLRHDDSKQHTPLVLFGPPGIGKTALMCKLAEQMPRLLGHKT 366          
BLAST of AAA domain-containing protein vs. Ensembl Human
Match: NWD1 (NACHT and WD repeat domain containing 1 [Source:HGNC Symbol;Acc:HGNC:27619])

HSP 1 Score: 90.5077 bits (223), Expect = 2.629e-17
Identity = 89/376 (23.67%), Postives = 168/376 (44.68%), Query Frame = 1
Query: 1876 IPCQTLGEFYALNL-NRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLVDLATTVSVESLIDD--KNSHLKDFHQILAGYFNGAWVDQT---ISFHFDLKNPEMSYNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARN--GGKEIVLLEESINNSALVIE---NDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAP-----KHNAFVPIYPSNKLPGSPLASTI-NCPEAIESVLVIQNKESMNKELLIKLKNDSRAYFYDLSFGAISYNTLLSSGEV 2952
            +P  T  E     L  R  +  G+ L++H L YI  S  GL++ E+ +VL+LD +V+ +VY + +      + +++FP  LW+ ++++L   L     DG+ L+ +A    VE + +     S     H +LA +F+G W   T   I+     K   +     P  Q ++     +   N RK ++L  HL+     +EL + V+    ++  +  +  + +LLDDF L        E+ L+ E++      +E    +   L  EL+ +L  + + +P L  + + C +         H   VP+    + PG PL +T+  C + I ++        + ++LL+    D     +D+    + +     +GEV
Sbjct:  553 VPLATTAEEATHQLCTRLEQTHGQLLVAHVLGYIVSSRHGLSEAELKDVLSLDDEVLQDVYRDWTPP---SKELLRFPPLLWVRLRRDLGYYLARRPVDGFTLLAIAHRQLVEVVRERYLSGSERAKRHGVLADFFSGTWSQGTKKLITLPLVGKPLNLDRKVAP--QPLWFS---HTVANLRKLKELPYHLLHSGRLEELKQEVLGSMSWISCRGISGGIEDLLDDFDLCAPHLDSPEVGLVREALQLCRPAVELRGMERSLLYTELLARLHFFATSHPAL--VGQLCQQAQSWFQLCAHPVLVPLGGFLQPPGGPLRATLSGCHKGITAM-----AWGVEEKLLVIGTQDGIMAVWDMEEQHVIHMLTGHTGEV 913          

HSP 2 Score: 67.3958 bits (163), Expect = 2.883e-10
Identity = 82/398 (20.60%), Postives = 161/398 (40.45%), Query Frame = 1
Query:  148 RIFPKLQEQCF-DEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYN-CPIF--LLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILW-RDDTGVSEAHHQIYIDQFEAFITAKVVEGVAERAKKINLDLSASFLKC-YDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDDT--NVPIILYGPPNSGKSIVFARTIFEFQSSLPHDS 1317
            R  P L+ Q F    G+  +++D++ G+ +   T     ++  E +++   C K +  P F  L+G +YG    P  IP++I +   E L++H      +   + +Y+  D N   P  +L            Q   +   C+ E     S+L +  Q   ++    G +  E       +  E     ++  S D +    +F REI D+   I+      +D     +++L        AD  ++ D Q++L    +   +++       R+ W RD        H  Y+ +       +    V  R ++  LD +   L   Y  I +   Q ++  +  CG ++++  +   L  DD+  + P++L+GPP  GK+ +  +   +    L H +
Sbjct:    8 RALPTLKCQTFCQRHGLMFEVVDLRWGIRNIEATDHLTTELCLEEVDR---CWKTSIGPAFVALIGDQYG----PCLIPSRIDEKEWEVLRDHLTARPSDLELVARYFQRDENAFPPTYVL------------QAPGTGEACEPEEATLTSVLRSGAQEARRL----GLITQEQWQHYHRSVIEWEIERSLLSSEDREQGATVFLREIQDLHKHIL------EDCALRMVDRL--------ADGCLDADAQNLLSSLKSHITDMHPGVLKTHRLPWSRDLVNPKNKTHACYLKELGEQFVVRANHQVLTRLRE--LDTAGQELAWLYQEIRHHLWQSSEVIQTFCGRQELLARLGQQLRHDDSKQHTPLVLFGPPGIGKTALMCKLAEQMPRLLGHKT 366          
BLAST of AAA domain-containing protein vs. Ensembl Human
Match: NWD1 (NACHT and WD repeat domain containing 1 [Source:HGNC Symbol;Acc:HGNC:27619])

HSP 1 Score: 90.5077 bits (223), Expect = 2.629e-17
Identity = 89/376 (23.67%), Postives = 168/376 (44.68%), Query Frame = 1
Query: 1876 IPCQTLGEFYALNL-NRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLVDLATTVSVESLIDD--KNSHLKDFHQILAGYFNGAWVDQT---ISFHFDLKNPEMSYNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARN--GGKEIVLLEESINNSALVIE---NDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAP-----KHNAFVPIYPSNKLPGSPLASTI-NCPEAIESVLVIQNKESMNKELLIKLKNDSRAYFYDLSFGAISYNTLLSSGEV 2952
            +P  T  E     L  R  +  G+ L++H L YI  S  GL++ E+ +VL+LD +V+ +VY + +      + +++FP  LW+ ++++L   L     DG+ L+ +A    VE + +     S     H +LA +F+G W   T   I+     K   +     P  Q ++     +   N RK ++L  HL+     +EL + V+    ++  +  +  + +LLDDF L        E+ L+ E++      +E    +   L  EL+ +L  + + +P L  + + C +         H   VP+    + PG PL +T+  C + I ++        + ++LL+    D     +D+    + +     +GEV
Sbjct:  553 VPLATTAEEATHQLCTRLEQTHGQLLVAHVLGYIVSSRHGLSEAELKDVLSLDDEVLQDVYRDWTPP---SKELLRFPPLLWVRLRRDLGYYLARRPVDGFTLLAIAHRQLVEVVRERYLSGSERAKRHGVLADFFSGTWSQGTKKLITLPLVGKPLNLDRKVAP--QPLWFS---HTVANLRKLKELPYHLLHSGRLEELKQEVLGSMSWISCRGISGGIEDLLDDFDLCAPHLDSPEVGLVREALQLCRPAVELRGMERSLLYTELLARLHFFATSHPAL--VGQLCQQAQSWFQLCAHPVLVPLGGFLQPPGGPLRATLSGCHKGITAM-----AWGVEEKLLVIGTQDGIMAVWDMEEQHVIHMLTGHTGEV 913          

HSP 2 Score: 67.3958 bits (163), Expect = 2.883e-10
Identity = 82/398 (20.60%), Postives = 161/398 (40.45%), Query Frame = 1
Query:  148 RIFPKLQEQCF-DEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYN-CPIF--LLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILW-RDDTGVSEAHHQIYIDQFEAFITAKVVEGVAERAKKINLDLSASFLKC-YDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDDT--NVPIILYGPPNSGKSIVFARTIFEFQSSLPHDS 1317
            R  P L+ Q F    G+  +++D++ G+ +   T     ++  E +++   C K +  P F  L+G +YG    P  IP++I +   E L++H      +   + +Y+  D N   P  +L            Q   +   C+ E     S+L +  Q   ++    G +  E       +  E     ++  S D +    +F REI D+   I+      +D     +++L        AD  ++ D Q++L    +   +++       R+ W RD        H  Y+ +       +    V  R ++  LD +   L   Y  I +   Q ++  +  CG ++++  +   L  DD+  + P++L+GPP  GK+ +  +   +    L H +
Sbjct:    8 RALPTLKCQTFCQRHGLMFEVVDLRWGIRNIEATDHLTTELCLEEVDR---CWKTSIGPAFVALIGDQYG----PCLIPSRIDEKEWEVLRDHLTARPSDLELVARYFQRDENAFPPTYVL------------QAPGTGEACEPEEATLTSVLRSGAQEARRL----GLITQEQWQHYHRSVIEWEIERSLLSSEDREQGATVFLREIQDLHKHIL------EDCALRMVDRL--------ADGCLDADAQNLLSSLKSHITDMHPGVLKTHRLPWSRDLVNPKNKTHACYLKELGEQFVVRANHQVLTRLRE--LDTAGQELAWLYQEIRHHLWQSSEVIQTFCGRQELLARLGQQLRHDDSKQHTPLVLFGPPGIGKTALMCKLAEQMPRLLGHKT 366          
BLAST of AAA domain-containing protein vs. Ensembl Celegans
Match: T05C3.2 (pep chromosome:WBcel235:V:5493747:5503010:1 gene:WBGene00020254.1 transcript:T05C3.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T05C3.2)

HSP 1 Score: 200.29 bits (508), Expect = 3.226e-51
Identity = 218/944 (23.09%), Postives = 403/944 (42.69%), Query Frame = 1
Query:  124 IERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGL-DSYLETTAAYQQIFYEYLNKHGICDKYNCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIY--------PDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFR--ILWRDDTGVSEAHHQIYIDQF----EAFITAKVVEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFVTSN---CTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSFQQQSN-----KKFIIILHDFEKCSEV-GSQSLVTDLIPKFLPKNLKLIVSSTDS-----------FDTRKPYFLNVLVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNS----MEEIPCQTLGEFYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLVDLA----TTVSVESLIDDKNSHLKDFHQILAGYFNGAWVDQTISFHFD---------LKNPEMSYNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNG------GKEIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSPL 2781
            +ER  L   I+PKL+E C + +G++ +++D++ G+ D   +     +    E  N   +    N  +FL  QKYG    P  IP++I    LE LK   +    + + L+ +Y+ D N V P  +L  I +I         P L +QD        ++W + ++ +  L +  ++ C   G LD E +   F++  E      I K  +     + + R I    N I +S  K          K +D+ ++      +N + Q +L    +       A +   R  + W    G+   +H  YI QF       IT+ V   + + A+  +   +         I  +++   +  +  C  + ++          ++ +PIIL G    GK+ + A+   + +    +  E   + RF+ ++     IA +  S+  QI++       ++  LKNS       P ++  +   F++ +N     K  +II    +  S + G+  L+    P  LP  +KL  S T              + ++ Y   ++VP   +      ++  L++ G+ L+E Q      N +       T  + V   Y     + S     E I   +L E   +  +R   + GK L+SH L YI  +  G++D EV ++++LD KV+++++  H         + + P  LW  I+ +L   L +   DG ++++        V++E    + N HL+  H  +A YF G W      + +           +N  ++    PK   +++ K GN  YN RK  +L  HL+     DEL+   +FD+++L+ K  +  +  L+ D++ A          +++ L  +++  SA ++  +   LA EL+ +LLP V+    +  L+  CDK  P+HN+FVP +     PG PL
Sbjct:  114 VERNALMEEIYPKLKEYCRETYGLDFQVVDMRWGVRDESTDDHMTTKLCLSEIANCQRLSVGANFVVFLC-QKYG--YRP--IPSEILSTELEMLKRTLREEHEDISLLDNWYIEDSNSVPPMFVLQQISSILVNFNNKRIPKLQEQD-------AKQWWECEAKMQQLLRKGARSCYEKGFLDREAMHNYFMSVTEREVVHGILKVKNPNEHCLCYIRHI----NNIALSQMK-------TASKFVDIAHNH-----VNSEAQKLLANLRDERVPAKLAMQNIRRSTVEWVGRDGIDVQYHAEYIRQFCTDFYKSITSMVDNAMEKHARFRDQLFTEVLTHLTTGITVSNMFFGRNEQLDCAKQYVL---------GNSTLPIILQGENGCGKTSLMAKIATKIREWYDNSCEPVVLLRFLGTSPDSSNIAPLLTSVCDQIAS------NYDESLKNSS------PTELSKLFQHFKKITNLATREKPLVIIFDSLDLLSRIDGAHELL--WFPPSLPPFVKLFASLTPGGSLIYSKMQRLIEDKRQY---LMVPSLGKDLGFQVVREWLSDKGRTLSERQ-----WNTVSKALDKCTLPLFVKLIYATVARWKSYSRPQETILFSSLQESINVLFHRTESQHGKLLVSHALSYISAARSGISDSEVEDLISLDDKVLDDIFQYHLPP------VRRIPPLLWSRIRSDLPGYLSERAADGVIVLNWYHQQFRQVAIERYFKNVN-HLETCHSAMAEYFLGVWGGVPKPYQYTEMQKQRFGVTENEGLADRKVPKQPNVFSSKDGNHRYNTRKLNELPYHLLRSGRVDELLTLCLFDYEFLHAKVSSFPLQSLIADYEDAIQNVRDVEISRQLSLAVDALRLSASILSRNPSMLAFELLGRLLPLVATNKYVSKLLIKCDKEGPQHNSFVPAHHCFHAPGGPL 991          
BLAST of AAA domain-containing protein vs. Ensembl Celegans
Match: qui-1 (QUInine non-avoider [Source:UniProtKB/TrEMBL;Acc:N1NTL8])

HSP 1 Score: 53.9138 bits (128), Expect = 1.391e-6
Identity = 95/435 (21.84%), Postives = 175/435 (40.23%), Query Frame = 1
Query: 1423 FETILKNSKEIENNIPRDI------EGILLSFQ---QQSNKKFIIILHDFEKC------SEVGSQSLVTDLIPKFLPKNLKLIVSSTDSFDTRKPYFLN--VLVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLGEFYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLVDLATTVSVESLID---DKNSHLKDFHQILAGYFNGAWVDQTISFHFDLKNPEMSYNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNG--GKEIVLLEESINNSALV-IENDLDSLAGELIMQL 2658
            + TI  N   I N  P+++       GIL S +   Q+++K   I + D          S++G ++       +  P NL L ++S++       + +   V V   ++ E    +Q       K LT EQ    +   +   DGIL A       +    ++N    +     G      + R  K FGK  + + + +I  SS GLT  E+ + ++ D++V+ E+ ++   SL+    I+           + L  IL  VI D   ++ +A +  +  L +     +  ++  H  L+  F    +D   S   ++     S             K  N   N+R+ R L  H +   N D L +  +  F+Y+   T+   +S LL  ++         ++ ++ E +   ALV +  D + LA E+I +L
Sbjct:  151 WRTICLNICSISNIDPKEVLEHFKLGGILKSLEELVQKADKPVCIFIDDVHLLKFGHLLSQIGRRT-------ETAPDNLSLFMTSSNVAPVNAVFAVTQTVNVDVISENEVVGMVQKMAEKVDKKLTNEQISA-IRPLMAAKDGILIAKS-----FTHEILFNGNSSMKGGMDGR-----MTRIEKEFGKLAVGNAVKFIAASSHGLTRLEIHDAISADREVLEEMNMSIVYSLLTLDGII-----------EALGPILRKVIIDDRQIIGIAHSGLISWLRNRYLTSSQDIRSAHLQLSDLFADLLIDNEQSPRHEIAYQSFSQGI----------KRDNGSPNFRRLRLLWYHCLHSGNLDRLKELSLCHFEYVDYVTRYFGISHLLSLYEECATQILHHDLQVISEQVLVPALVTMARDSEQLAAEVIGRL 546          
BLAST of AAA domain-containing protein vs. Ensembl Celegans
Match: qui-1 (QUInine non-avoider [Source:UniProtKB/TrEMBL;Acc:N1NTL8])

HSP 1 Score: 53.5286 bits (127), Expect = 1.993e-6
Identity = 95/435 (21.84%), Postives = 175/435 (40.23%), Query Frame = 1
Query: 1423 FETILKNSKEIENNIPRDI------EGILLSFQ---QQSNKKFIIILHDFEKC------SEVGSQSLVTDLIPKFLPKNLKLIVSSTDSFDTRKPYFLN--VLVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLGEFYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLVDLATTVSVESLID---DKNSHLKDFHQILAGYFNGAWVDQTISFHFDLKNPEMSYNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNG--GKEIVLLEESINNSALV-IENDLDSLAGELIMQL 2658
            + TI  N   I N  P+++       GIL S +   Q+++K   I + D          S++G ++       +  P NL L ++S++       + +   V V   ++ E    +Q       K LT EQ    +   +   DGIL A       +    ++N    +     G      + R  K FGK  + + + +I  SS GLT  E+ + ++ D++V+ E+ ++   SL+    I+           + L  IL  VI D   ++ +A +  +  L +     +  ++  H  L+  F    +D   S   ++     S             K  N   N+R+ R L  H +   N D L +  +  F+Y+   T+   +S LL  ++         ++ ++ E +   ALV +  D + LA E+I +L
Sbjct:  416 WRTICLNICSISNIDPKEVLEHFKLGGILKSLEELVQKADKPVCIFIDDVHLLKFGHLLSQIGRRT-------ETAPDNLSLFMTSSNVAPVNAVFAVTQTVNVDVISENEVVGMVQKMAEKVDKKLTNEQISA-IRPLMAAKDGILIAKS-----FTHEILFNGNSSMKGGMDGR-----MTRIEKEFGKLAVGNAVKFIAASSHGLTRLEIHDAISADREVLEEMNMSIVYSLLTLDGII-----------EALGPILRKVIIDDRQIIGIAHSGLISWLRNRYLTSSQDIRSAHLQLSDLFADLLIDNEQSPRHEIAYQSFSQGI----------KRDNGSPNFRRLRLLWYHCLHSGNLDRLKELSLCHFEYVDYVTRYFGISHLLSLYEECATQILHHDLQVISEQVLVPALVTMARDSEQLAAEVIGRL 811          
BLAST of AAA domain-containing protein vs. Ensembl Fly
Match: CG10185 (gene:FBgn0038397 transcript:FBtr0083235)

HSP 1 Score: 149.058 bits (375), Expect = 1.838e-35
Identity = 219/945 (23.17%), Postives = 399/945 (42.22%), Query Frame = 1
Query:  124 IERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGL-DSYLETTAAYQQIFYEYLNKHGICDKYNCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAI--------YPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILWRDDTGVSEAHHQIYIDQFEAFITAKVVEGVAERAKKINLDLSASFLKCYDII-----CNADLQINKFAKFGCGYEDIVYAMLDYLTDDDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFVTS---NCTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSFQQ-----QSNKKFIIILHDFEKCSEVGSQSLVTDLIPKFLPKNLKLIVS-STDSFDTRKPYFLNVLVPEFTQTEFNIFIQTQLN-----NTGKLLTEEQNERFLSNYLK--FTDGILTAS--VIVDYFYNQNFIYNS----MEEIPCQTLGEFYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLVDLATTVSVESLIDDKNSHLKD------FHQILAGYFNGAW---VDQTISF------HFDLKNPEMSYNC-CPKSQKMYAKKSG-NVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLA------RNGGKEIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSPL 2781
            +ER  L  + +P++++ C ++ G+E +++D++ G+ D   +     +    E  N   +    N  +FL GQKYG    P  I +    L+ E L +      V+   L+ +Y  D N V P  +L  I +I         P L  +D       Q  W  T + +  L +  +    ++  +  E V   F++  E      I    ++K   + + R I    N I + N KK       I + +D   +++A L+   DL+ V         +I   +  K+ + W    G+    H+ Y++ F +     VV+ V    +K   D SA      +I+     CN  ++I    +  C  E I   ML      D++ P++L+G    GK+ + ++++    +          + RF+ +   +  +    +SI  QIS   +    FE           NIP D+  +   F+Q        +   I L   ++ +     + V+  IP  LP + K+I+S + +  +    +  +VL  +    E N    T L      N  K+  +    R L+NY      + I   S  + V   + +   + S     E     T+ +   L   R  K+ G+ L+ H L YI  S  GL++ E+ ++++LD KV+++VY  H           + P  LW  I+ +L   L +   DG   V++      +     K  + K+      FH ++A Y+ G W   V +   F       F L + E S +   P    +++ K G +  YN RKF +L  H V    + +L ++V+F++D+L+ K  +  +  +L DF+ A      +   +E++L+ +++     ++    + LA +L+ +LLP +   PN++ L+  CD+  PK  A +P+      PG PL
Sbjct:   38 MERNTLMAKCYPRIKDYCREKHGLEFQVVDMRWGVRDEATDDHMTTELCMREIKNCQRLSMGPNFIVFL-GQKYGYRPIPTYIVSSELALICEELTS----MGVDRAILDLWYKKDSNAVPPISVLQPISSILINFNNKRVPKLQAED-------QAVWWDTLNKMQKLLRKAAASLGASNKMSKEDVHNYFMSVTEREVINGILNVKNTKNHCLSYVRYI----NNINLQNLKKASLFVDIINRSLD---TESAKLL--SDLRDVRLPA-----KIEAVNAQKYTVEWIGREGLDIETHEEYLNHFISHFYKNVVKLVDRAMRK--EDSSAQGQIVTEILQHLHACNNSVKIFYGREESC--ERIKRYMLG-----DSDKPLVLFGDGGCGKTSLLSKSVSLVATEWFAHVRPINVIRFLGTTPDSSALTATLISICQQISYNYML--PFE-----------NIPDDLVPLTAHFKQLLTYASPTQPLTIYLDSVDQLTGTQDSNKVS-WIPTRLPPHCKIIISCANEPANPTVSHEYHVLC-KMIDVEENFIEVTALGEDLAMNVIKMWMKTAC-RDLNNYQWRLVANAISKCSLPIFVKLVFAEICRWRSYTRPQETHLANTVMDSIMLLFERVEKQHGRILVFHALAYITASKSGLSESELEDLISLDDKVLDDVYQYHLPP------TRRIPPLLWTRIRNDLPNYLSEREADG---VNVMNWYHRQFRDTAKERYFKNMNMAIYFHSMIADYYLGIWGGGVPKPFKFTEIQRHRFGLADKEGSADRKVPIQPLVFSSKDGLSKRYNLRKFGELPFHFVRSRRFKDLFEHVLFNYDWLHAKLSSCPLQAVLADFEDASSNTDDKEAKRELMLVSDALRLGGAILAIYPNMLAPQLVGRLLPEIGGNPNIKMLLRACDRSGPKDCALIPVNHCLHTPGGPL 922          
BLAST of AAA domain-containing protein vs. Ensembl Zebrafish
Match: nwd1 (NACHT and WD repeat domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-071116-8])

HSP 1 Score: 151.754 bits (382), Expect = 4.259e-36
Identity = 228/965 (23.63%), Postives = 408/965 (42.28%), Query Frame = 1
Query:   70 PERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKY-NCPIF--LLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQD------RNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVN----EFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILWRDDTGVSEAHHQIYIDQFEAFITAKVVEGVAERA---KKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIV--YAMLDYLTDDDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFVTSNCT-IAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSFQQQSNKKFIIILHDFEKCSEVGSQSLVTDLIPKFLPKNLKLIVS-STDSFDTRKPYFL---NVLVPEF-TQTEFNIFIQTQLNNTGKLLTEEQNERFL------SNYLKFTDGILTASVIVDYF-YNQNFIYNSMEEIPCQTLGEFYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLVD-----LATTVSVESLIDDKNSHLKDFHQILAGYFNGAWVDQTISFHFDLKNPEMS--YNCCPK--SQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARN--GGKEIVLLEESINNSALVIENDLD---------SLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAF-----VPIYPSNKLPGSPLASTIN 2796
            P   ++  F+ S+  D + ER     + + +LQ  C    G+  +++D K G+    + TA+   I    + +   C +  + P F  L+G +YG+ L P  IP   F+LLL  L    +        L Q++  D N + P  IL+ I   YP   ++D      R++ +I    W  T+S L  + ++ +     +G    +   K F +    E E  F  T R +     S V+F RE+  +          K D +K+  + L+DVT     D    E L  + ++  N+        +P    L +     S   H+ Y+ +    +T+++ E ++  A      ++D   S+LK  +I  +A L   K A F  G +DI+   ++  + ++D ++ P++++GPP  GK+ +  +   E ++ + +           +   + +  +   + LQ+   +   + +  I          + R    +L    +Q +   ++IL   E+  E      + D IPK +P N++++ S S +  D  K       N+   E  T+ +    I   ++   + LT EQ +  L       N L     + TA +   Y   +   +  S EE+  Q +    +L +N      GK L+SH L +I  S  GL++ E+ +VL+LD  V+ E+Y      L    ++++FP   W  ++ +LS  L +  + G LL+       A  V    L  D  +   D H ILA YF+G W    +     +  P +S   N   K   Q ++  +      N RK  +L  HL     +DEL ++V+   D+L  KT    VS ++ D  L  +     EI LL+E+     L+++  LD          L  E+  +L     +YP++  + + C +      ++     VP     + PG PL ST+ 
Sbjct:   25 PTSRMVRVFISSTHSDMKNERNAFWEKTYSELQTHC-QSLGLVFEVVDFKCGMR---DITASDHLITELCIKEIETCQRISDGPTFIALIGNQYGHRLVPRLIPEAEFELLLSKLSKDPESL----KLLNQWFYKDSNSIPPTYILLPITVHYPHYNERDSENAQLRDNDVI---SWNLTESRLLQVLRSAALQAERDGDFTADSKHKFFKSVLEYEMEHGFLRTQRDA-----SAVLFFRELPRLS---------KRDCKKNFAKFLLDVTADGLLDTQARELLTDLKQRICNTGR-----LQPLCMELSKGAMDPSRKEHKEYLGKLCEQVTSQLKELISRNALQTSGTSVDPVWSWLK-QEIFHHAKLSEEKCAVFK-GRDDILGKISITLWESNDVSHGPLLVHGPPGVGKTALLCKLAKEMRAVVDNRGVVLLRLLGTSLLSSDVDSVLRGVCLQVCGALGLQSPYSHIAYT----HEGLVRFFHSMLEDVSKQGDT-LLLILDSLEQLLETNKLHKL-DWIPKIIPPNVQIVFSTSNECLDKCKSLVSAEENIFKLELLTKDQGRDVIDAYMSAAERKLTAEQQDAILRYFEQSGNPLHLKLMLDTAKLWSSYTPMSSVHLDKSAEEVMTQFV---ESLEVNH-----GKKLVSHALSFILLSRYGLSEAELQDVLSLDNDVLAEIY---KCWLPPSHTLMRFPRFHWSRLRHDLSAHLTERWEAGVLLLGFTHRQFAELVRRRYLSRDVKA---DMHTILAEYFSGQWSKGQLR---PILLPSLSAFLNADRKVSPQPLWFSEE---LANLRKIHELPYHLAHAGKWDELRQSVLGSLDWLCCKTLQCGVSCVIQDLTLCTDLTDCPEIQLLKETF----LLLKPSLDFSDGRVDPSLLVTEIFARLQGLADHYPSM--IGQLCSQCMDWFESYSDPLLVPKCSFFEAPGGPLKSTLR 925          
BLAST of AAA domain-containing protein vs. Ensembl Zebrafish
Match: nwd2 (NACHT and WD repeat domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-161213-1])

HSP 1 Score: 90.1225 bits (222), Expect = 2.238e-17
Identity = 91/367 (24.80%), Postives = 157/367 (42.78%), Query Frame = 1
Query: 1813 TASVIVDYFYNQNFIYNSMEEIP----CQTLGE-----FYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLVDLATT---VSVESLIDDKNSHLKDFHQILAGYFNGAWVD-QTISFHFD-----------LKNPE-----MSYNCCPKSQKMYAKKSGN--------------VFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARN--GGKEIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSP 2778
            T  + V+  Y +   + S +++     C T+ E     FY++       + G   +   L YI  +  GLT+ E+ ++L+LD  V+ ++ +  S +L   +S ++        +K+EL   LV+       L+  A     +  + L       +   H +LA YF GAW   +   FH D            +NP        ++     +  Y +++                 F N+RK  +L  HL      D+L+  VI +F +LY   K  +  + L D  LA +    KE+  L  ++ +  L +  +  SL+ EL  +LLP V+  P LR L+  CDK  PK+ + VP++ S  +  SP
Sbjct:  610 TLPMFVNLIYREVVHWRSHKDVDDKSLCSTVHESIEQLFYSVE-----NKLGSRFVFRALGYITMARAGLTELELEDILSLDNSVLGDIMV--SSNL---KSPLRISYDFIARLKEELEGYLVERQVHNVTLMVWANRHLHLIAQKLYLSNEEDVHQMHSLLAEYFLGAWAGGRKKIFHCDNNHFASLNISQHRNPHNQQSLHGHDKASADKHSYDRQTPEQPWVFQCNLLEPDIFFVNHRKMTELTYHLTRSGRTDDLMYGVIMNFSWLYTMIKIGQFDKALSDIDLAYSYTQEKELKFLATTLRSIKLKVTKNPASLSAELQQRLLPVVTSLPKLRHLLLECDKDGPKYCSIVPLHSSMDVTYSP 966          

HSP 2 Score: 71.2478 bits (173), Expect = 1.357e-11
Identity = 39/144 (27.08%), Postives = 74/144 (51.39%), Query Frame = 1
Query:   67 LPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNF----LEQYYVLDVNCVEP 486
            +P    +  F+C++ +D E ER  L   ++PKL++ C + +GIE +++D+  G+D     +   Q++  + L +        C + L+G+KYG++  P  + +  F+++L+         AVE       LE++Y  D N V P
Sbjct:   35 VPTGRSVRVFICANPDDTEAERNALKEHVYPKLRDFCRENYGIEFQVVDLYWGIDPEEWDSPELQRLRMKLLEECLKTSAGPCFVGLIGEKYGSIRVPGEVESAEFEMILDA--------AVEAGLDTRILEEWYCRDENSVPP 170          
BLAST of AAA domain-containing protein vs. Ensembl Zebrafish
Match: CU570791.3 (NACHT and WD repeat domain-containing protein 2-like [Source:NCBI gene;Acc:108179119])

HSP 1 Score: 63.5438 bits (153), Expect = 3.164e-9
Identity = 47/204 (23.04%), Postives = 90/204 (44.12%), Query Frame = 1
Query:   85 INFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNCPIF---LLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFE 687
            +  ++CS+ ED  +ER ++  ++FP+L+E C   +G++ ++I      D Y  T         E L     C   +   F   L+G++YG+   P ++    F+L+L+      +R   + + LE+ Y  D N + P   +++          Q  N     ++ W K    +  +  ++   C+  GTL +E   K F +  E
Sbjct:    4 VQVYLCSNPEDSVVERTLIRQKVFPRLREYCRSTYGLDFRVI------DPYEATKPKNWPTQQERLRILEDCWNNSLHSFFVGLVGEQYGDACLPEQVEASEFQLILQVC----QRMGFKTDVLEKCYRRDENTIPPSFCMLEPSRRCKQTSVQQENPTE--EKNWCKVFPEVRRILHDVVNQCIQEGTLALEKAQKYFQSSLE 195          

HSP 2 Score: 60.4622 bits (145), Expect = 2.515e-8
Identity = 119/522 (22.80%), Postives = 219/522 (41.95%), Query Frame = 1
Query: 1195 DYLTDDDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPH-DSECHFITRFVTSNCTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSFQQQSNKKFIIILHDFEKCSEVGSQSLVTDLIPKFLPKNLKLIVSSTDS----FDTRKPYFLN-VLVPEFTQTE---FNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLG-EFY---ALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFP----------LSLWLLIKQELSVILVDVIKDGYLLVDLATTVSVESLIDDKNSHLKDFHQILAGYFNGAWVDQTISFHFDLK-----------------NPEMSYNCCPKSQKMYAKKSGNVFY--NYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNG----GKEIVLLEESINNSALVIEND 2622
             YL   +T  P IL G P SGK+++ A    +    L + D E   +  F+  N ++ ++       +  I  R +   T + +  +++ N  R     LL+ +  S    +II+   ++  +   Q  +T L PK L  N+KL++S + +        K Y+ +  L  E  Q +    N  + T L  + + +T  Q + +++  LK      T  + V+  Y Q   ++S  EI  +TL  E +    L  +   ++ GK+L+S  L Y+  +  G+T  E+ +VL+ D +V+ E ++   E +    + ++ P          L  +L+ +  L    +  +   + LV     V  + L  ++   LK  H +L+ YF+G+W + T   HF +                  + ++    C  SQ  Y   +       N RK   L  HL+     +EL   +I   +YL     A+   EL     L +       +E+ LL   + +SA ++ N+
Sbjct:  336 SYLEGKNTLFPFILNGGPYSGKTVLLAHCASQVSVWLKNLDPE--ILVFFIDVNSSLRQL-------LKYICERADSSNTNINSIFQLKENFKR-----LLTVRSTSKNPLVIIIDGLDQLPKTDGQPDLTCL-PKALAPNVKLLISVSANRHALLAALKQYYPDSALFCELQQVDTKSCNQLLTTLLQGSNRKITSGQ-QVYVNEALKKC----TVPLYVELLYRQAVCWHSEFEITEETLDLEVHNSIVLIFDHMERKHGKSLVSKALSYLTLARYGMTTAELTDVLSCDDEVV-ESFLPQGEGV---PATLRVPEVSVETLLSDLKGFLVQRNILGTQTLSWVNRHFPLV-----VCKQYLCSEETC-LK-IHHVLSDYFSGSWANGT-KKHFIINKDTQIQSSSDVPRNIYIDRQVPSQPCIFSQPFYISTAMRTPTRPNLRKLHTLSFHLLKSGRIEELGSQMISQ-EYLQVMLHAMLADELF--LWLEKTSQLIFPRELQLLHAILKSSACLLRNN 822          
BLAST of AAA domain-containing protein vs. Ensembl Xenopus
Match: hsp90ab1 (heat shock protein 90kDa alpha family class B member 1 [Source:Xenbase;Acc:XB-GENE-495311])

HSP 1 Score: 138.272 bits (347), Expect = 7.188e-32
Identity = 210/979 (21.45%), Postives = 390/979 (39.84%), Query Frame = 1
Query:   67 LPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYK-QDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSP-VIFNREIIDIKNFI----------VISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILWRDDTGVSEAHHQIYIDQFEAFITAKVVEGVAERAKKI--NLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDDTNVPIILYGPPNSGKSIVFA----RTIFEFQSSLPHDSECHFITRFVTSNCTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSFQQQS--NKKFIIILHDFEKCSEVGSQSLVTDLIPKFLPKNLKLIVSSTDS-----------FDTRKPYFLNVLVPEFTQTEFNIFIQTQLNNTGKLLTEEQ---NERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLGEFYALNLNRWY----KRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDV-IKDGYLLV--DLATTVSVESLIDDKNSHLKDFHQILAGYFNGAW--------------------------VDQTISFH----FDLKNPE--MSYNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNGG--KEIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSP 2778
            +P    +  F+ S++   E ER  L   ++PKL+E C + +G+E ++ID+  G+      +   Q+     L +        C + LLG+KYG +  P  + +  F+++L+     K    +E   LE++Y  D N V P   L     +  + +   D  +    ++ W+     + ++F    K+    G L    V +   +  E  F   + K   +     V + R+I +I+  +          VI  + K  +   A+EKL  +       +V + +L+      +      Y        +      G+ +  ++  ID  +A +             +I  +L L  ++   Y+  C A   +NK+ +  C    I               P+I+YG P +GK+++ A    +     Q  +  DS+   I RF+ S  T     L+  LQ     L  N    +    K+I N     +  + L+   +S  ++  +IIL   E+ S+      +   +P  LP+ +++I+S+  +                 Y    L+P   +    I     L    K+ + +Q   NE F            T  + V+  + +   + S +++   TL      N+ + +     + G   +S  L YI  ++ GL++ E+ ++L LD  VM+EV  N    +      ++ P  +   +K++L+  LV+  +++  LLV  +    +  +         L++ H  +A YF G W                          +D+   ++    FD + PE   ++ C P    ++       F N+RK  +L+ HL      +EL+  +  +F +LY   K  +    L D  +A N    KE+  L  ++ +    I  +  SL+ EL   LLP VS  P  R L+  CDK  PK+ + VP++ S  +  SP
Sbjct:   35 IPTGRSVRVFIMSTYHT-EAERNELREHVYPKLREFCRENYGMEFQVIDLYWGIPEEDWDSPDLQKTRMRLLEECLKTSAGPCFVGLLGEKYGTIRIPGEVESSEFEMILDAAIEAK----LETRTLEEWYCRDENAVPPAYYLRPKSEMLKNHHNPGDSTTGSANEKTWRTVAEEIKHIFSTSVKLLQEKGKLKNNQVKRYLSSALEDEFDFALGKQTAAFLKKCVCYIRKISNIERHVKIPEMARYTDVIKVENKYIRDPEALEKLAKLRDEFIPTIVASSNLRVYTSVTHCDMKLGYSQEVENHYV-----DGLGKQFYEDMIDIIQATVQQNFETETDPLYDEILQHLSLCKTYASFYEYRCEALNLVNKYLR-PCRSGHI--------------YPLIIYGGPCTGKTLLLAEVAKKACSWLQEEMGPDSDPVVIVRFLGS--TDMSSALNCLLQSICEQLAVNYRCLLQSRPKKILN-----LHELFLNLLNESSFHRPLVIILDGVEQLSDSDDARKLW-WLPVHLPRTVRIIISTLPNKHGILQKLRCLIHNEDSYI--ELIPRDKKMCSQILKHQLLRVKRKVTSGQQIYVNEAF---------SKCTLPMFVNLTFREVRNWRSHKDVDGSTLCVTVHRNIEQLFWSLENKCGPRFVSRALGYITMATTGLSEVELEDILALDNTVMSEVLSNMKPYI-----PLRIPYIMIAQLKEDLTGYLVERQVRNVTLLVWANRHLQLVAQKFYLQNADDLQEMHSNMAEYFLGVWAGGIKKPFYNEPQYFENCIRKETRSILDENKHYNEQTSFDRQPPEQPWAFQCNPLEPDIF-------FVNHRKMTELLHHLTRSGMMEELMTGITMNFSWLYTMIKIGQFERALSDIAVAYNYSQQKELKFLASTLQSIKHKILKNPGSLSAELQQILLPVVSSLPKFRNLLVQCDKDGPKYCSIVPLHSSMDVTYSP 957          
BLAST of AAA domain-containing protein vs. Ensembl Xenopus
Match: ppp1r3c.1 (protein phosphatase 1, regulatory (inhibitor) subunit 3C, gene 1 [Source:Xenbase;Acc:XB-GENE-969181])

HSP 1 Score: 101.293 bits (251), Expect = 1.286e-20
Identity = 125/571 (21.89%), Postives = 248/571 (43.43%), Query Frame = 1
Query: 1165 GYEDIVYAMLDYLTDDDTNV--PIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFVTS--NCTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSFQQQSNKKFIIILHDFEKCSEV-GSQSLVTDLIPKFLPKNLKLIVSS-----------TDSFDTRKPYFLNVLVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLGEFYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLVDLATTVSVESLIDD--KNSHLKDFHQILAGYFNGAWVDQT-ISFHFDLKNPEMSYNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARN--GGKEIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYP-NLRFLIENCDKVAP-----KHNAFVPIYPSNKLPGSPLASTIN 2796
            G +D++  ++ Y+ +  + V  P+I++G   SGK+ +  +  FE      + S    +    TS  +  I ++  SI  Q+  I L      + + N   I N   R    +L +  ++  +  ++     ++ S   G+  L    +PK  P N+ ++VS+            DS    + Y   + V   +  + +  I+  + + G+ LT +Q E  L ++ K    +L   +  D     +      E +   +  E  +L      +  GK L+SH L YI  S  GL++ E+ ++L+LD +V+ ++Y   +        +++FP   W  ++ +L   LV+   DG  ++ L     +E   D    N+   + H  LA YF G W   T       L N  ++ +    SQ ++   +     N RK  +L  HL+     DEL   ++ + D++ +K  +  +  ++ DF+++      +EI+LL +++  S L + ++ D +   +  ++L  + ++  + R + E C +         H  F+P     + PG PL +T+ 
Sbjct:  306 GRQDLLQKIMSYIQERHSQVYPPLIIHGVSGSGKTALMCKA-FEMLKQTNNGSSLMVLRLLGTSPQSSEIHDVLKSICYQL-CIALELQPPSSQITN---IYNETVRFFHQLLTTVSERKVENLVLFFDSLDQLSPSEGAHRL--HWLPKECPANVCIVVSTLPEEGGILKTLKDSVTDPECY---IEVKPLSAEQGSQMIEMLMASAGRRLTNDQQEIVLGSFRKCGQPLLL-KLAFDEAKRWSSYTPITELMIATSTKEAVSLLYQCLEQLHGKLLVSHALGYIVASRSGLSEAELKDILSLDDEVLADIYQYWAPP---SNDLIRFPTLPWTRLRNDLEGYLVERQADGSTVLGLYHRQFIEVARDTYLTNTEKSNRHGTLADYFMGKWSMGTKRPILLPLINKSLNADRKVASQPLWFSDN---MPNRRKMSELPYHLLNAGCIDELQGEILGNMDWISSKIVSCGIQSVIKDFEMSVKLISSREIMLLRDTL--STLCLPSNTDPVI--VFTEMLARMHFFQLSYRLIDELCQQCTGWLHQYPHPTFIPTCGFFQPPGGPLQTTVT 855          
BLAST of AAA domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000003639.1 (uncharacterized LOC101730828 [Source:NCBI gene;Acc:101730828])

HSP 1 Score: 63.5438 bits (153), Expect = 3.655e-9
Identity = 131/551 (23.77%), Postives = 227/551 (41.20%), Query Frame = 1
Query: 1165 GYEDIVYAMLDYLTDDDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFV--TSNCTIAEIFL-SIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGI------LLSFQQQSNKKFIIILHDFEKCSEVGSQSLVTDLIPKFLPKNLKLIV-----SSTDSFDTRKPYFL--NV-LVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFI-YNSMEEIPCQ-TLGEFYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEV--YINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLVDLA----TTVSVESLIDDKNSHLKDFHQILAGYFNGAWVDQTISFHFDLKNPEMSYNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNGGK---EIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDK-VAPKH 2730
            G E  +  + D +T  +  + ++++G   SGKS + A+        +  D     +TRF+  T       + L S+  QI+ I                I  +   D++G+      LL F  +  +  ++ +   ++ S V   SL    IP+ LP+++  IV     S+  SF T +   +  NV  +P     E    I+  +    + LT  Q +             L   V+  Y  +  +  Y+S  +   Q  L + Y+  L R  K  G+ ++     YI  S  G+T +E++++L+LD  VM EV  Y N + S+        FP +LW+ ++ ++   LV+   D   +++ A      V +   +  K   L   H   A Y+      ++ S H    +PE      P    M+        +N RK   +  HL+  + +  LI   +F+++YL +K  A  V  L +D + A N  +   ++ LL E++  S  V+  D   LA +L  +L             IE  DK VAP H
Sbjct:    2 GRESFLQELQDCITSANKQL-VVVHGESGSGKSSIIAKIATLASQWIGRD--IRVVTRFIGRTGESRNPRMLLYSLCFQIAEIY--------------NITMDFSEDLKGLINEFSTLLEFANKC-RPLMVAVDGIDELS-VHEDSL--SWIPRVLPRHVYFIVCASTESACSSFRTLQKLTMQQNVHQIPPLDSEEIRNMIEVWMERDNRRLTGRQKKVLFDACAACP---LPLYVVSSYMESCLWTSYSSESDSYLQPNLHKLYSAVLGRLEKSHGEQVMKMVASYISLSKNGVTLEELLDLLSLDLGVMQEVKQYQNITVSV--------FPEALWIKLQNDIGTHLVEQRTDNTYVINWAHALFRVVCINRYLKSKELQL-SVHSAFANYYL-----ESKSRH---NHPEKVSLMMPL---MWTGTHRKPVFNLRKILGISHHLIHSNQFPRLITECLFNYEYLLHKVWATSVVGLQEDIKAAINPERPAPDLNLLSEALQLSTKVLLRDPTQLASQLKGRL-----------HQIEMLDKPVAPGH 497          
BLAST of AAA domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000022477.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460486.1:142089:157740:1 gene:ENSXETG00000010819.1 transcript:ENSXETT00000022477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 1.505e-6
Identity = 114/549 (20.77%), Postives = 213/549 (38.80%), Query Frame = 1
Query: 1195 DYLTDDDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFVTS---NCTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSFQQQSNKKFIIILHDFEKCSEVGSQSLVTDLIPKFLPKNLKLIVSSTDSFDTRKPYFLNVLVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDG----------ILTASVIVDYFYNQNFIYNSMEEIPCQTLGEFYALNLNRWYK----RFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLVDLATTVSVESLIDDKNSH---LKDFHQILAGYFNGAWV------------------------DQTISFHF-DLKNPEMS--YNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARN--GGKEIVLLEESINNSALVIENDLDSLAGELIMQ--LLPYVSYYPNL 2688
            DY+    +  P++++G    GK+++ A    +  S L    +   + RF+        ++ +   +  Q+S I  R     + L +  E+       ++ I LS +Q      I+I+ D +         +  D +P  +PK  K+IVS             NV+  +        F+  ++    +   +      L  Y K T G            T+ + V   +     + S +++  QTLGE       R +     ++G+ ++S  L YI  S  G+   E++++L  D  V+ + +      L   ++I + P  +   I  +L   L D +  G  LV     +  + ++    S    +++ H  +  +F+G W                         + T + H+ D + P     YN  P  Q+     +GNV    RK  +L  HL      ++L   V   F Y     +A ++  LL+  + A    G +E+  L + +   + +++   DSL  E+I Q  +LP V  YP L
Sbjct:  346 DYIVHGKSPKPMVVFGRSGCGKTVLLASCAKKVHSWL-ETCDPILVVRFICPFREPLHLSRLLGGLCYQLSDIYQR--VIPSHLDDVAELRQCF---VDLISLSSKQ---APLILIIDDVDH--------VPIDWLPSPIPKFTKIIVSVKHQ--------QNVISDQVKSQNKGQFLFLEIKPQRRECNDNLKHCLLGCYRKITSGQQMYVNRSLETNTSPLQVHLLFKLVAEWKSHQDVDNQTLGEDTYEAAERLFHKLEIKYGREIVSRTLSYITLSQSGIGVTELVDLLTADDLVLEKFH-----ELFGTENIPRIPDWIVTGILLDLQGCLADRMSAGCKLVYWNNRMYQQVIMTRYLSSPETVQELHTAMYYFFSGRWTCGKFISKAVQKFKSLLPNRRLANNNHTPNRHYLDYQPPSQPWFYNVLPVCQRAV---TGNV----RKALELPFHLKECGKLEKLYNEVFMAFPYYKVLVQAGQLHLLLNSIEDAAGIMGKQELYFLYDMLKEVSCLLKEKPDSL--EMIFQSKMLPLVLTYPPL 855          
BLAST of AAA domain-containing protein vs. Ensembl Mouse
Match: Nwd2 (NACHT and WD repeat domain containing 2 [Source:MGI Symbol;Acc:MGI:1920464])

HSP 1 Score: 155.221 bits (391), Expect = 4.271e-37
Identity = 229/1000 (22.90%), Postives = 416/1000 (41.60%), Query Frame = 1
Query:   40 TSLPFTAASLPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQQE--WKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSP-VIFNREIIDIKNFIVISNQKK------DDKR----KSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILWRDDTGVSEAHHQIYIDQFEAFITAKVVEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKF---GCGYEDIVYAMLDYLTDDDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHD----SECHFITRFV-TSNCTI--AEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPR---DIEGILLSFQQQSN--KKFIIILHDFEKCSEVGSQSLVTDLIPKFLPKNLKLIVSSTDSFDTRKPYFLNVLVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDG----------ILTASVIVDYFYNQNFIYNSMEEIP----CQTLGE-----FYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDV-IKDGYLLV--DLATTVSVESLIDDKNSHLKDFHQILAGYFNGAW--------------------------VDQTISF----HFDLKNPEMSY--NCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNGG--KEIVLLE---ESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSP 2778
            T+LP  +  +P    +  F+ ++ ED   ER+ L   ++PKL+E C + +G+E ++ID+  G++     +   Q++  + L +        C + LLG+KYGN+  P  +    F+++L+     K    +E   LE +Y  D N V P    +  +   P   K         +QE  W++    +  +F+   K+    G +      +   +  E  F   + K   +     V + R+I +I+ F+ I    K       D R      A EKLI +       +V + +L+      +      Y        I      G+ +  ++  ID  +A +             + N D     L  YD I         +A F    C   +I++  +        N P+++YG P +GK+++ A    +    L  D    S+   I RF+ T++ +I    + LS+  Q++              N + +  + P+   D+  + ++   +S+  +  +IIL   E+ SE   ++     +P  LP+ +++I+S+  +    K   L  L     + +  I +   +    K+ ++    + L    K T G            T  + V+  + +   + S +++     C T+ E     F++L      K+ G+ L+S  L YI  +  GL++ E+ +VL LD  VMNE+  N   S     + ++ P      +K+ L+  L++  +K+  LLV  +    +  + L   ++S+L++ H ILA YF G W                          +++   F     FD + P+  +   C P    ++       F N+RK  +L+ HL      D+L+  +I +F +LY   K  +  ++L D +LA N    KE+  L     SI N  +       SL+ EL  +LLP VS  P LR L+  CDK  PK+ + VP++ S  +  SP
Sbjct:   28 TALP--SHLVPAGRSVRVFISANPEDTGAERQALRETVYPKLREFCRENYGLEFQVIDLYWGIEEDEWDSPELQKMRMKLLEECLKTSAGPCFVGLLGEKYGNIRIPGEVEASEFEMILDAAVEAK----LETKLLEDWYCRDENSV-PAAYYLRPRLEVPRSNKNSTQPSASSEQERPWQEISDEIKTIFKAAVKLLHEQGKMKQSQAKRYLFSAIEDEFDFALGKQTPAFLKKCVCYIRKIANIERFVKIPEMGKYMDITGTDPRIVRDPEAQEKLIKLRDEFIPTIVASSNLRVYTSVTHCDMKLGYSQEIENHYI-----EGLGKQFYEDMIDIIQATV-------------QQNFDTETDTL--YDEILQHSSLCKTYASFYEYKCESLNILHKYILPSKTGHIN-PLVVYGGPCTGKTLLLAEVAKKAYGWLHEDTGPDSDPVVIVRFLGTTDMSIDLRTLLLSVCEQLAV-------------NYRCLVQSFPKKIHDLRDLFINLLNESSLQRPLVIILDALEQLSE-ADEARKLWWLPAHLPRFVRIILSTLPN----KHGILQKLRCLIHEEDNYIEL---IPRDRKMCSQVLKHQLLRVKRKVTSGQQIYVNNAFSKCTLPMFVNLTFREVRHWRSHKDVDESSLCVTVHESIEQLFWSLE-----KKCGQKLVSRALGYITMAKMGLSEMELEDVLALDNSVMNELNENTRPS-----NPLRVPYLYIARLKEGLNGYLIERHVKNVTLLVWANRHLQLIAQKLYLQEDSNLREMHTILADYFLGVWSGGRRKAFCLEDPYLNGCLDLENRSLLEEEKHFMEQASFDRQAPDQPWVFQCNPLEPDIF-------FVNHRKMSELLYHLTRCGKTDDLLYGIIMNFSWLYTMIKIGQFDKVLADIELAYNYSQEKELKFLASTLRSIRNKVIAFPG---SLSAELQQRLLPVVSSLPKLRHLLLECDKDGPKYCSIVPLHSSMDVTYSP 958          
BLAST of AAA domain-containing protein vs. Ensembl Mouse
Match: Nwd1 (NACHT and WD repeat domain containing 1 [Source:MGI Symbol;Acc:MGI:2442268])

HSP 1 Score: 87.8113 bits (216), Expect = 1.307e-16
Identity = 85/357 (23.81%), Postives = 165/357 (46.22%), Query Frame = 1
Query: 1939 GKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLV-----DLATTVSVESLIDDKNSHLKDFHQILAGYFNGAW---VDQTISFHFDLKNPEMSYNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLA--RNGGKEIVLLEESINNSALVIE-NDLDS--LAGELIMQLLPYVSYYPNLRFLIENCDKV-----APKHNAFVPIYPSNKLPGSPLASTI-NCPEAIESVLVIQNKESMNKELLIKLKNDSRAYFYDLSFGAISYNTLLSSGEV 2952
            G  L++H L YI  S  GL++ E+ +VL+LD +V+  VY + +      + +++FP  LW+ ++++L   LV    DG +L+      L+  + V  L   + +     H +LA +F+GAW   + + I+     K   +     P  Q ++     +   N RK  +L  HL+     +EL + V+ +  ++  +  +  +  LLDDF +        E+ L+ E+I      +E   L+   L  EL+ +LL + + +P +  + + C +      A  +   VP+    + PG PL +T+  C + I ++       S+ ++LL+    D     +D+    + +  +  + EV
Sbjct:  616 GALLVAHVLGYIVSSRYGLSEAELKDVLSLDDEVLQAVYRDWTPP---SKELLRFPPLLWVRLRRDLGHCLVRRPVDGCMLLAIAHRQLSQVIQVRYLSGPERA---KRHGVLAEFFSGAWSQGIKKLITLPLVGKPLNLDRKVAP--QPLWFS---STVANLRKLTELPFHLLHAGRLEELKQEVLGNMSWISCRGISGGIEVLLDDFDMCAPHMNSPEVDLVREAIQLCGPAVELRGLEKSVLYTELLARLLFFAASHPAM--IGQLCQQAQSWFRACPYPMLVPLAGFLQPPGGPLRATLTGCHKGITAI-----AWSLEEKLLVVGTQDGAMVVWDVEEQQVVHVLMGHTAEV 954          

HSP 2 Score: 74.7146 bits (182), Expect = 1.295e-12
Identity = 85/417 (20.38%), Postives = 162/417 (38.85%), Query Frame = 1
Query:   85 INFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYN-CPIF--LLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILW-RDDTGVSEAHHQIYIDQFEAFITAKVVEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDD--TNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDS 1317
            +  F+ S+  D + ER+ L    +P++Q  C    G+  +++D++ G+ +   T     ++  E L +   C K +  P F  LLG +YG    P RI  K ++ L   L +  +        + +++  D N + P  +L            Q   S+++   E     S+L    Q   ++    G +  E       +  E      +  S        +F R++ D+   I+      DD     +++L+D     NA        QS+L        +    +     + W RD        H  Y+ Q      A+    V E+ +++ L         Y  I +   Q  +  K  CG+++++  +   L  D+  T+ P++L+GPP  GK+ +  +   +    L H +
Sbjct:   31 VVIFISSTISDMDTEREALQCTAYPEVQSFC-QRHGLAFEVVDLRWGIPNTQATDYLTTELCLEELER---CQKTSIGPAFVALLGDQYGPCPVPRRIEEKEWEALRAQLTSRPRDL----ELVTRHFQRDDNTIPPTYVL------------QPSGSLVVPGPEEATLTSVLRGGAQEAWRL----GLISQEQWMCYHRSVIEWEIELGLLSSARGDQGATVFLRDVQDLNKHIL------DDCSLKMVDRLVDGCLDTNA--------QSLLSGLKGRILDAQPGALKSHHLSWSRDLVNPKNKAHARYLKQLSEQFVARTNHQVLEQLRELELA-RQELGWLYQEIRHHLWQSTESTKVFCGHQELLAQLRQQLRQDESRTHTPLVLFGPPGIGKTSLMCKLAQQVPELLGHKT 408          
BLAST of AAA domain-containing protein vs. Ensembl Mouse
Match: Nwd1 (NACHT and WD repeat domain containing 1 [Source:MGI Symbol;Acc:MGI:2442268])

HSP 1 Score: 87.8113 bits (216), Expect = 1.341e-16
Identity = 83/341 (24.34%), Postives = 159/341 (46.63%), Query Frame = 1
Query: 1939 GKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLV-----DLATTVSVESLIDDKNSHLKDFHQILAGYFNGAW---VDQTISFHFDLKNPEMSYNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLA--RNGGKEIVLLEESINNSALVIE-NDLDS--LAGELIMQLLPYVSYYPNLRFLIENCDKV-----APKHNAFVPIYPSNKLPGSPLASTI-NCPEAIESVLVIQNKESMNKELLIKLKNDSRAYFYDL 2904
            G  L++H L YI  S  GL++ E+ +VL+LD +V+  VY + +      + +++FP  LW+ ++++L   LV    DG +L+      L+  + V  L   + +     H +LA +F+GAW   + + I+     K   +     P  Q ++     +   N RK  +L  HL+     +EL + V+ +  ++  +  +  +  LLDDF +        E+ L+ E+I      +E   L+   L  EL+ +LL + + +P +  + + C +      A  +   VP+    + PG PL +T+  C + I ++       S+ ++LL+    D     +D+
Sbjct:  575 GALLVAHVLGYIVSSRYGLSEAELKDVLSLDDEVLQAVYRDWTPP---SKELLRFPPLLWVRLRRDLGHCLVRRPVDGCMLLAIAHRQLSQVIQVRYLSGPERA---KRHGVLAEFFSGAWSQGIKKLITLPLVGKPLNLDRKVAP--QPLWFS---STVANLRKLTELPFHLLHAGRLEELKQEVLGNMSWISCRGISGGIEVLLDDFDMCAPHMNSPEVDLVREAIQLCGPAVELRGLEKSVLYTELLARLLFFAASHPAM--IGQLCQQAQSWFRACPYPMLVPLAGFLQPPGGPLRATLTGCHKGITAI-----AWSLEEKLLVVGTQDGAMVVWDV 897          

HSP 2 Score: 67.3958 bits (163), Expect = 1.969e-10
Identity = 82/406 (20.20%), Postives = 156/406 (38.42%), Query Frame = 1
Query:  118 FEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYN-CPIF--LLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILW-RDDTGVSEAHHQIYIDQFEAFITAKVVEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDD--TNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDS 1317
             + ER+ L    +P++Q  C    G+  +++D++ G+ +   T     ++  E L +   C K +  P F  LLG +YG    P RI  K ++ L   L +  +        + +++  D N + P  +L            Q   S+++   E     S+L    Q   ++    G +  E       +  E      +  S        +F R++ D+   I+      DD     +++L+D     NA        QS+L        +    +     + W RD        H  Y+ Q      A+    V E+ +++ L         Y  I +   Q  +  K  CG+++++  +   L  D+  T+ P++L+GPP  GK+ +  +   +    L H +
Sbjct:    1 MDTEREALQCTAYPEVQSFC-QRHGLAFEVVDLRWGIPNTQATDYLTTELCLEELER---CQKTSIGPAFVALLGDQYGPCPVPRRIEEKEWEALRAQLTSRPRDL----ELVTRHFQRDDNTIPPTYVL------------QPSGSLVVPGPEEATLTSVLRGGAQEAWRL----GLISQEQWMCYHRSVIEWEIELGLLSSARGDQGATVFLRDVQDLNKHIL------DDCSLKMVDRLVDGCLDTNA--------QSLLSGLKGRILDAQPGALKSHHLSWSRDLVNPKNKAHARYLKQLSEQFVARTNHQVLEQLRELELA-RQELGWLYQEIRHHLWQSTESTKVFCGHQELLAQLRQQLRQDESRTHTPLVLFGPPGIGKTSLMCKLAQQVPELLGHKT 367          
BLAST of AAA domain-containing protein vs. Ensembl Mouse
Match: Nwd1 (NACHT and WD repeat domain containing 1 [Source:MGI Symbol;Acc:MGI:2442268])

HSP 1 Score: 87.8113 bits (216), Expect = 1.398e-16
Identity = 85/357 (23.81%), Postives = 165/357 (46.22%), Query Frame = 1
Query: 1939 GKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLV-----DLATTVSVESLIDDKNSHLKDFHQILAGYFNGAW---VDQTISFHFDLKNPEMSYNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLA--RNGGKEIVLLEESINNSALVIE-NDLDS--LAGELIMQLLPYVSYYPNLRFLIENCDKV-----APKHNAFVPIYPSNKLPGSPLASTI-NCPEAIESVLVIQNKESMNKELLIKLKNDSRAYFYDLSFGAISYNTLLSSGEV 2952
            G  L++H L YI  S  GL++ E+ +VL+LD +V+  VY + +      + +++FP  LW+ ++++L   LV    DG +L+      L+  + V  L   + +     H +LA +F+GAW   + + I+     K   +     P  Q ++     +   N RK  +L  HL+     +EL + V+ +  ++  +  +  +  LLDDF +        E+ L+ E+I      +E   L+   L  EL+ +LL + + +P +  + + C +      A  +   VP+    + PG PL +T+  C + I ++       S+ ++LL+    D     +D+    + +  +  + EV
Sbjct:  575 GALLVAHVLGYIVSSRYGLSEAELKDVLSLDDEVLQAVYRDWTPP---SKELLRFPPLLWVRLRRDLGHCLVRRPVDGCMLLAIAHRQLSQVIQVRYLSGPERA---KRHGVLAEFFSGAWSQGIKKLITLPLVGKPLNLDRKVAP--QPLWFS---STVANLRKLTELPFHLLHAGRLEELKQEVLGNMSWISCRGISGGIEVLLDDFDMCAPHMNSPEVDLVREAIQLCGPAVELRGLEKSVLYTELLARLLFFAASHPAM--IGQLCQQAQSWFRACPYPMLVPLAGFLQPPGGPLRATLTGCHKGITAI-----AWSLEEKLLVVGTQDGAMVVWDVEEQQVVHVLMGHTAEV 913          

HSP 2 Score: 67.3958 bits (163), Expect = 2.184e-10
Identity = 82/406 (20.20%), Postives = 156/406 (38.42%), Query Frame = 1
Query:  118 FEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYN-CPIF--LLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILW-RDDTGVSEAHHQIYIDQFEAFITAKVVEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDD--TNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDS 1317
             + ER+ L    +P++Q  C    G+  +++D++ G+ +   T     ++  E L +   C K +  P F  LLG +YG    P RI  K ++ L   L +  +        + +++  D N + P  +L            Q   S+++   E     S+L    Q   ++    G +  E       +  E      +  S        +F R++ D+   I+      DD     +++L+D     NA        QS+L        +    +     + W RD        H  Y+ Q      A+    V E+ +++ L         Y  I +   Q  +  K  CG+++++  +   L  D+  T+ P++L+GPP  GK+ +  +   +    L H +
Sbjct:    1 MDTEREALQCTAYPEVQSFC-QRHGLAFEVVDLRWGIPNTQATDYLTTELCLEELER---CQKTSIGPAFVALLGDQYGPCPVPRRIEEKEWEALRAQLTSRPRDL----ELVTRHFQRDDNTIPPTYVL------------QPSGSLVVPGPEEATLTSVLRGGAQEAWRL----GLISQEQWMCYHRSVIEWEIELGLLSSARGDQGATVFLRDVQDLNKHIL------DDCSLKMVDRLVDGCLDTNA--------QSLLSGLKGRILDAQPGALKSHHLSWSRDLVNPKNKAHARYLKQLSEQFVARTNHQVLEQLRELELA-RQELGWLYQEIRHHLWQSTESTKVFCGHQELLAQLRQQLRQDESRTHTPLVLFGPPGIGKTSLMCKLAQQVPELLGHKT 367          
BLAST of AAA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6P5U7|NWD2_MOUSE (NACHT and WD repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Nwd2 PE=1 SV=2)

HSP 1 Score: 155.221 bits (391), Expect = 2.988e-36
Identity = 229/1000 (22.90%), Postives = 416/1000 (41.60%), Query Frame = 1
Query:   40 TSLPFTAASLPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQQE--WKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSP-VIFNREIIDIKNFIVISNQKK------DDKR----KSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILWRDDTGVSEAHHQIYIDQFEAFITAKVVEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKF---GCGYEDIVYAMLDYLTDDDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHD----SECHFITRFV-TSNCTI--AEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPR---DIEGILLSFQQQSN--KKFIIILHDFEKCSEVGSQSLVTDLIPKFLPKNLKLIVSSTDSFDTRKPYFLNVLVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDG----------ILTASVIVDYFYNQNFIYNSMEEIP----CQTLGE-----FYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDV-IKDGYLLV--DLATTVSVESLIDDKNSHLKDFHQILAGYFNGAW--------------------------VDQTISF----HFDLKNPEMSY--NCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNGG--KEIVLLE---ESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSP 2778
            T+LP  +  +P    +  F+ ++ ED   ER+ L   ++PKL+E C + +G+E ++ID+  G++     +   Q++  + L +        C + LLG+KYGN+  P  +    F+++L+     K    +E   LE +Y  D N V P    +  +   P   K         +QE  W++    +  +F+   K+    G +      +   +  E  F   + K   +     V + R+I +I+ F+ I    K       D R      A EKLI +       +V + +L+      +      Y        I      G+ +  ++  ID  +A +             + N D     L  YD I         +A F    C   +I++  +        N P+++YG P +GK+++ A    +    L  D    S+   I RF+ T++ +I    + LS+  Q++              N + +  + P+   D+  + ++   +S+  +  +IIL   E+ SE   ++     +P  LP+ +++I+S+  +    K   L  L     + +  I +   +    K+ ++    + L    K T G            T  + V+  + +   + S +++     C T+ E     F++L      K+ G+ L+S  L YI  +  GL++ E+ +VL LD  VMNE+  N   S     + ++ P      +K+ L+  L++  +K+  LLV  +    +  + L   ++S+L++ H ILA YF G W                          +++   F     FD + P+  +   C P    ++       F N+RK  +L+ HL      D+L+  +I +F +LY   K  +  ++L D +LA N    KE+  L     SI N  +       SL+ EL  +LLP VS  P LR L+  CDK  PK+ + VP++ S  +  SP
Sbjct:   28 TALP--SHLVPAGRSVRVFISANPEDTGAERQALRETVYPKLREFCRENYGLEFQVIDLYWGIEEDEWDSPELQKMRMKLLEECLKTSAGPCFVGLLGEKYGNIRIPGEVEASEFEMILDAAVEAK----LETKLLEDWYCRDENSV-PAAYYLRPRLEVPRSNKNSTQPSASSEQERPWQEISDEIKTIFKAAVKLLHEQGKMKQSQAKRYLFSAIEDEFDFALGKQTPAFLKKCVCYIRKIANIERFVKIPEMGKYMDITGTDPRIVRDPEAQEKLIKLRDEFIPTIVASSNLRVYTSVTHCDMKLGYSQEIENHYI-----EGLGKQFYEDMIDIIQATV-------------QQNFDTETDTL--YDEILQHSSLCKTYASFYEYKCESLNILHKYILPSKTGHIN-PLVVYGGPCTGKTLLLAEVAKKAYGWLHEDTGPDSDPVVIVRFLGTTDMSIDLRTLLLSVCEQLAV-------------NYRCLVQSFPKKIHDLRDLFINLLNESSLQRPLVIILDALEQLSE-ADEARKLWWLPAHLPRFVRIILSTLPN----KHGILQKLRCLIHEEDNYIEL---IPRDRKMCSQVLKHQLLRVKRKVTSGQQIYVNNAFSKCTLPMFVNLTFREVRHWRSHKDVDESSLCVTVHESIEQLFWSLE-----KKCGQKLVSRALGYITMAKMGLSEMELEDVLALDNSVMNELNENTRPS-----NPLRVPYLYIARLKEGLNGYLIERHVKNVTLLVWANRHLQLIAQKLYLQEDSNLREMHTILADYFLGVWSGGRRKAFCLEDPYLNGCLDLENRSLLEEEKHFMEQASFDRQAPDQPWVFQCNPLEPDIF-------FVNHRKMSELLYHLTRCGKTDDLLYGIIMNFSWLYTMIKIGQFDKVLADIELAYNYSQEKELKFLASTLRSIRNKVIAFPG---SLSAELQQRLLPVVSSLPKLRHLLLECDKDGPKYCSIVPLHSSMDVTYSP 958          
BLAST of AAA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9ULI1|NWD2_HUMAN (NACHT and WD repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NWD2 PE=2 SV=3)

HSP 1 Score: 146.362 bits (368), Expect = 1.228e-33
Identity = 215/995 (21.61%), Postives = 411/995 (41.31%), Query Frame = 1
Query:   40 TSLPFTAASLPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCV--------EPEMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSP-VIFNREIIDIKNFI----------VISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILWRDDTGVSEAHHQIYIDQFEAFITAKVVEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKF---GCGYEDIVYAMLDYLTDDDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHD----SECHFITRFVTSNCTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSF-----QQQSNKKFIIILHDFEKCSEVGSQSLVTDLIPKFLPKNLKLIVSSTDSFDTRKPYFLNVLVPEFTQTEF--------NIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLGEFYALNLNRWY----KRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDV-IKDGYLLV--DLATTVSVESLIDDKNSHLKDFHQILAGYFNGAW--------------------------VDQTISF----HFDLKNPEMSY--NCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNGGKEIVLLEESINNSALVIENDL----DSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSP 2778
            T+LP  +  +P    +  F+ ++ ED   ER+ L   ++PKL+E C + +G+E ++ID+  G++     +   Q+   + L          C + LLG+KYGN+  P  +    F+++L+     K    +E   LE++Y  D N V        + EM+  +  A+ P    ++       ++ W++    +  +F+   K+    G +      +   +  E  F   + K   +     V + R+I +I+ F+          +   + +  +   A EKLI +       +V + +L+      +      Y        I      G+ +  ++  ID  +A I             + N D     L  YD I         +A F    C   +IV+  +        N P+I+YG P +GK+++ A    +    L  D    S+   I RF+ +   ++    ++ L +          E +  N + +  + P+ I  +   F     +    +  +II    E+ SE    +     +P  LP+ +++++S+  +          ++  E    E         +  ++ QL    + +T  Q + +++N L       T  + V+  + +   + S +++   +L      ++ + +    K+ G+ L+S  L YI  +  GL++ E+ +VL LD  VM+E+  N   S     + ++ P      +K+ LS  L++  +K+  LLV  +    +  + L    ++ L++ H ILA YF G W                          +++   F     FD + P+  +   C P    ++       F N+RK  +L+ HL      D+L+  +I +F +LY   K  +  ++L D +LA N  +E  L  + + N+   I+N +     SL+ EL  +LLP VS  P LR L+  CDK  PK+ + VP++ S  +  SP
Sbjct:   28 TALP--SHLVPAGRSVRVFISANPEDTGAERQALRENVYPKLREFCRENYGLEFQVIDLYWGVEEDEWDSPELQKTRMKLLENCLKTSAGPCFVGLLGEKYGNIRIPGEVEASEFEMILDAAIEAK----LETKLLEEWYCRDENSVPAAYYLRPKSEMLRSNRNAMQPSTNAEN-------EKTWQEISDEIKKIFKAAVKLLHEKGKMKHSQAKRYLFSAIEDEFDFALGKQTPAFLKKCVCYIRKIANIERFVKIPEMGKYMDITGTEPRIIRDPEAQEKLIKLRDEFIPTIVASSNLRVYTSVTHCDMKLGYSQEIENHYI-----EGLGKQFYEDMIDIIQATI-------------QQNFDTETDTL--YDEILQHSSLCKTYASFYEYKCESLNIVHNYILPSKAGHIN-PLIIYGGPCTGKTLLLAEVAKKAYGWLHEDTGPESDPVVIVRFLGTT-DMSSDLRTLLLSVC---------EQLAVNYRCLVQSYPKKIHDLCDLFINLLNESSLQRPLVIIFDALEQLSE-NDDARKLWWLPAHLPRFVRIVLSTLPNKHGILQKLRCLIHEEDNYIELIPRDRKMCSQVLKHQLLRVKRKVTSGQ-QIYVNNALSKC----TLPMFVNLTFREVRHWRSHKDVDESSLSVTVHESIEQLFWSLEKKCGQKLVSRALGYITMAKMGLSEMELEDVLALDNSVMSELKENTRPS-----NPLRVPYLYIARLKEGLSGYLIERHVKNVTLLVWANRHLQLIAQKLYLQDDNDLREMHTILADYFLGVWSGGRRKAFCLEDPYLNGCLDLENRSLLEEEKHFMEQASFDRQAPDQPWVFQCNPLEPDIF-------FVNHRKMSELLYHLTRCGKTDDLLYGIIMNFSWLYTMIKIGQFDKVLSDIELAYNYSQEKEL--KFLANTLRSIKNKVTAFPGSLSAELQQRLLPVVSSLPKLRHLLLECDKDGPKYCSIVPLHSSMDVTYSP 958          
BLAST of AAA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q149M9|NWD1_HUMAN (NACHT domain- and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=NWD1 PE=1 SV=3)

HSP 1 Score: 90.5077 bits (223), Expect = 1.394e-16
Identity = 89/376 (23.67%), Postives = 169/376 (44.95%), Query Frame = 1
Query: 1876 IPCQTLGEFYALNL-NRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLVDLATTVSVESLIDD--KNSHLKDFHQILAGYFNGAWVDQT---ISFHFDLKNPEMSYNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARN--GGKEIVLLEESINNSALVIE---NDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAP-----KHNAFVPIYPSNKLPGSPLASTIN-CPEAIESVLVIQNKESMNKELLIKLKNDSRAYFYDLSFGAISYNTLLSSGEV 2952
            +P  T  E     L  R  +  G+ L++H L YI  S  GL++ E+ +VL+LD +V+ +VY + +      + +++FP  LW+ ++++L   L     DG+ L+ +A    VE + +     S     H +LA +F+G W   T   I+     K   +     P  Q ++     +   N RK ++L  HL+     +EL + V+    ++  +  +  + +LLDDF L        E+ L+ E++      +E    +   L  EL+ +L  + + +P L  + + C +         H   VP+    + PG PL +T++ C + I ++        + ++LL+    D     +D+    + +     +GEV
Sbjct:  553 VPLATTAEEATHQLCTRLEQTHGQLLVAHVLGYIVSSRHGLSEAELKDVLSLDDEVLQDVYRDWTPP---SKELLRFPPLLWVRLRRDLGYYLARRPVDGFTLLAIAHRQLVEVVRERYLSGSERAKRHGVLADFFSGTWSQGTKKLITLPLVGKPLNLDRKVAP--QPLWFS---HTVANLRKLKELPYHLLHSGRLEELKQEVLGSMSWISCRGISGGIEDLLDDFDLCAPHLDSPEVGLVREALQLCRPAVELRGMERSLLYTELLARLHFFATSHPAL--VGQLCQQAQSWFQLCAHPVLVPLGGFLQPPGGPLRATLSGCHKGITAM-----AWGVEEKLLVIGTQDGIMAVWDMEEQHVIHMLTGHTGEV 913          

HSP 2 Score: 67.3958 bits (163), Expect = 1.576e-9
Identity = 82/398 (20.60%), Postives = 161/398 (40.45%), Query Frame = 1
Query:  148 RIFPKLQEQCF-DEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYN-CPIF--LLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILW-RDDTGVSEAHHQIYIDQFEAFITAKVVEGVAERAKKINLDLSASFLKC-YDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDDT--NVPIILYGPPNSGKSIVFARTIFEFQSSLPHDS 1317
            R  P L+ Q F    G+  +++D++ G+ +   T     ++  E +++   C K +  P F  L+G +YG    P  IP++I +   E L++H      +   + +Y+  D N   P  +L            Q   +   C+ E     S+L +  Q   ++    G +  E       +  E     ++  S D +    +F REI D+   I+      +D     +++L        AD  ++ D Q++L    +   +++       R+ W RD        H  Y+ +       +    V  R ++  LD +   L   Y  I +   Q ++  +  CG ++++  +   L  DD+  + P++L+GPP  GK+ +  +   +    L H +
Sbjct:    8 RALPTLKCQTFCQRHGLMFEVVDLRWGIRNIEATDHLTTELCLEEVDR---CWKTSIGPAFVALIGDQYG----PCLIPSRIDEKEWEVLRDHLTARPSDLELVARYFQRDENAFPPTYVL------------QAPGTGEACEPEEATLTSVLRSGAQEARRL----GLITQEQWQHYHRSVIEWEIERSLLSSEDREQGATVFLREIQDLHKHIL------EDCALRMVDRL--------ADGCLDADAQNLLSSLKSHITDMHPGVLKTHRLPWSRDLVNPKNKTHACYLKELGEQFVVRANHQVLTRLRE--LDTAGQELAWLYQEIRHHLWQSSEVIQTFCGRQELLARLGQQLRHDDSKQHTPLVLFGPPGIGKTALMCKLAEQMPRLLGHKT 366          
BLAST of AAA domain-containing protein vs. UniProt/SwissProt
Match: sp|A6H603|NWD1_MOUSE (NACHT domain- and WD repeat-containing protein 1 OS=Mus musculus OX=10090 GN=Nwd1 PE=2 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 9.377e-16
Identity = 83/341 (24.34%), Postives = 159/341 (46.63%), Query Frame = 1
Query: 1939 GKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLV-----DLATTVSVESLIDDKNSHLKDFHQILAGYFNGAW---VDQTISFHFDLKNPEMSYNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLA--RNGGKEIVLLEESINNSALVIE-NDLDS--LAGELIMQLLPYVSYYPNLRFLIENCDKV-----APKHNAFVPIYPSNKLPGSPLASTI-NCPEAIESVLVIQNKESMNKELLIKLKNDSRAYFYDL 2904
            G  L++H L YI  S  GL++ E+ +VL+LD +V+  VY + +      + +++FP  LW+ ++++L   LV    DG +L+      L+  + V  L   + +     H +LA +F+GAW   + + I+     K   +     P  Q ++     +   N RK  +L  HL+     +EL + V+ +  ++  +  +  +  LLDDF +        E+ L+ E+I      +E   L+   L  EL+ +LL + + +P +  + + C +      A  +   VP+    + PG PL +T+  C + I ++       S+ ++LL+    D     +D+
Sbjct:  575 GALLVAHVLGYIVSSRYGLSEAELKDVLSLDDEVLQAVYRDWTPP---SKELLRFPPLLWVRLRRDLGHCLVRRPVDGCMLLAIAHRQLSQVIQVRYLSGPERA---KRHGVLAEFFSGAWSQGIKKLITLPLVGKPLNLDRKVAP--QPLWFS---STVANLRKLTELPFHLLHAGRLEELKQEVLGNMSWISCRGISGGIEVLLDDFDMCAPHMNSPEVDLVREAIQLCGPAVELRGLEKSVLYTELLARLLFFAASHPAM--IGQLCQQAQSWFRACPYPMLVPLAGFLQPPGGPLRATLTGCHKGITAI-----AWSLEEKLLVVGTQDGAMVVWDV 897          

HSP 2 Score: 67.3958 bits (163), Expect = 1.377e-9
Identity = 82/406 (20.20%), Postives = 156/406 (38.42%), Query Frame = 1
Query:  118 FEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYN-CPIF--LLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILW-RDDTGVSEAHHQIYIDQFEAFITAKVVEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDD--TNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDS 1317
             + ER+ L    +P++Q  C    G+  +++D++ G+ +   T     ++  E L +   C K +  P F  LLG +YG    P RI  K ++ L   L +  +        + +++  D N + P  +L            Q   S+++   E     S+L    Q   ++    G +  E       +  E      +  S        +F R++ D+   I+      DD     +++L+D     NA        QS+L        +    +     + W RD        H  Y+ Q      A+    V E+ +++ L         Y  I +   Q  +  K  CG+++++  +   L  D+  T+ P++L+GPP  GK+ +  +   +    L H +
Sbjct:    1 MDTEREALQCTAYPEVQSFC-QRHGLAFEVVDLRWGIPNTQATDYLTTELCLEELER---CQKTSIGPAFVALLGDQYGPCPVPRRIEEKEWEALRAQLTSRPRDL----ELVTRHFQRDDNTIPPTYVL------------QPSGSLVVPGPEEATLTSVLRGGAQEAWRL----GLISQEQWMCYHRSVIEWEIELGLLSSARGDQGATVFLRDVQDLNKHIL------DDCSLKMVDRLVDGCLDTNA--------QSLLSGLKGRILDAQPGALKSHHLSWSRDLVNPKNKAHARYLKQLSEQFVARTNHQVLEQLRELELA-RQELGWLYQEIRHHLWQSTESTKVFCGHQELLAQLRQQLRQDESRTHTPLVLFGPPGIGKTSLMCKLAQQVPELLGHKT 367          
BLAST of AAA domain-containing protein vs. TrEMBL
Match: A0A267EA39 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033440g1 PE=4 SV=1)

HSP 1 Score: 628.246 bits (1619), Expect = 0.000e+0
Identity = 429/1479 (29.01%), Postives = 723/1479 (48.88%), Query Frame = 1
Query:   31 LIKTSLPFTAASLPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEP----EMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNAD-LVINEDLQSVLRQYYNSCNEIYEASEPKFRILWRDDTGVSEAHHQIYIDQF-EAFITAKVVEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTD--DDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFVTSNCTIAEIFLSIFLQISAIILRNNQ---FETILKNSKEIENNIPRDIEGILLSFQQQSNKKFIIILHDFEKC-----SEVGSQSLVTDLIPKFLPKNLKLIVSSTDS-----FDTRKPYFLNVLVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLGEFYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLL-----VDLATTVSVESLIDDKNSHLKDFHQILAGYFNGAW--VDQTISFHFDLKNPEMSYNCCPKSQKMYA-------------KKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNGGKEIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSPLASTINCPEAIESVLVIQNKESMNKELLIKLKNDSRAYFYDLSFGAISYNTLLSSGEVYYGPNRDIILVLETEYRQIIKVHQRETGDLLGQIIPMNWVVLRPFEERNEYRITNIDMNQTKMALIITNEVSYLFVLNLETLEPILAFNPGLRLEMLKLTPDESTVFTHHVERLVSLNVEKNQLNSAVELQGIPLQMLFANEQSKKAFIVCDQQKSVVVLDLESAGVVRKCYKISFENCLDENDYVLEVSCSEIGNPFLLIMSCHSVILYDWNKEKVLNHITRPSQLPVYFKLPNRLDNQPASLKFNAAKLILSDRVIICALFRDVIVCTVSDNKIIKTLHAPVGGIVSEIHI--ADDYIIGKVEQSQNSAEVMIWKTDPKCLFFKIENNQDKLTRCVKKIQIG--GSVAIASCVESDEMGVIEISTGTLVDLYSHSSVVINCCLSSCGKWALVTV--KNSHNANILWSLETRKIIFEFGSSTNTEFIVPMKSKSGFYCITNHSKSIDAPNFIVTQILCDLGVE 4326
            L    LP ++        I F + S+F DFE ER++L N  +P+L E   + +G++ + +DIKLGL+        Y  +F++   K       + P+ LLGQK+G  L P R+P++ F+L+  TL+ H+     + + L+ +Y  D N   P    E +L+      PD+  +D  +      EWK T  +L+NLF+    ICL  GT+D +   +I   E +A  S  +  S  ++F PV+F R+IID+KN++   N+ K D          DV   +  D  +I++ L  +L Q  N     Y + + +F +LWR   G+ +  H+ Y+  F EAFI A     V  R     +   +  ++ +D    +       A F    E  + A+++Y  D     N   +L G  N+GK    A+   E Q  L        I R V     ++++  S+F QI      +           NS E     PR+++ ++           ++++   E+        +  QSLV    P+  P N+KL++++ D           P+   + +   T   +  F +  L    + LT EQ  R+    L   + +  AS++ D         +  +      L +      +R   +FG+  +SH   Y+  S GGLTD EV ++L+LD  V++E+ +        +  + +FP S+WLL+KQE+ +++ +   DGY +      D+ + V+   L  D     K  H  +A YF G W  V + +S      +   +    P  + MY+              + G+ FYN RKFRQL RHL   D   EL   V+F +D+LY K+ AL + E L DFQL  +   E+ L+EE+I  +  ++ ++L++LA EL   L+ Y   Y N++ L+   D    +HN FVP Y   KLPGS L ST+ CP  ++S+    +  S    L +KLK+D   Y YDL  G +      SSGE++   +    ++++   R  +KVH    G  +G I+P+NW+   PFEE++ +RIT + + +  +A I+ + +S + + +L T +PI  F P  R  +  +TPDE  +FT++ E+++   +      S V+L  +P +++F  + S +AFI+C+ ++ VV+L +++ G +   +KI FEN L  +D + ++  S+     LL+ +  +V++Y++ ++ ++ HI RP ++P  FK+PN        + F+ A     DRV+I ++FRDV+V  V   + +  LHAP  GI++ + +      ++G +E S+   E+ +W        F      D LT  ++ ++       A+A C  SDEMGV+++ TG L DLYSH  VV++C +SSCG +A+ +V  +N +  NI+WSL  R+I+ EFG+      ++P +  S  Y +     +   P  I    L D  V 
Sbjct:    8 LCSGRLPLSSLPTVSPRSITFCIISAFSDFEKEREVLRNEAYPRLYEYFRNTYGLQFRGVDIKLGLEKVNYDELDYWDLFHDIKRKFAFASHDSVPVILLGQKFGLPLLPRRLPSRAFELIRATLRAHRNPLTAQYHILDSWYRRDENAECPDGDTEHVLLPASRQLPDIVGEDPEAKASALAEWKFTARLLANLFKIGVGICLREGTMDDQTAFEILTFELDAGISHLLSHSDLTQFRPVVFERDIIDLKNYL---NEPKADL-------YTDVELDEENDRFLIDKSLADLL-QELNDRLTTYASVDRQFSVLWRFPDGIDKRLHEEYLGDFCEAFIEAAKT-AVESRLAGKQMHADSEVVRVFDDAWTSLEHCRLLAPFSLRQEATIEAVVEYCVDFSARQNYTYLLLGGQNTGKMPAIAQAFIEIQQRLCESPVGVLIPRVVMFERRLSDLTASLFNQIRTCCRLDTGGVVATGAGANSAEQTAPPPRNLQELVDRLSGAG--PVVLLIAGAERLVDDAGDRLPPQSLVP--APRGPPSNVKLVLTALDEAGGSVLSLAGPHLRVLHIGPQTADAYREFARHYLAERSRRLTAEQ-WRWAEQRLAGLESMFHASLLCDRLARLASGDDPADLPASSGLADLLDAEFDRLEAKFGRIAVSHAFAYVSLSGGGLTDIEVKDLLSLDDAVLDEMLVP------IEDGVRQFPSSVWLLMKQEVRLLIHEASFDGYFVNYWANGDVESAVAARYLSSDDLR--KSLHFTMADYFLGTWHGVSKPVSTVSSADDVSSADRLMPTQKLMYSIEGETGGSVTSGGGQQGS-FYNERKFRQLPRHLFLSDRVPELNNLVLFSYDWLYYKSAALGLEETLRDFQLVPSN-TEVSLVEETIRKAFDILGDNLNNLAAELSGSLVLYSHEYKNIKNLVRQADVRGCQHNIFVPCYSYAKLPGSALQSTVECPSNLQSM----HLSSETATLYVKLKDDVSLYKYDLERGTMLGEARTSSGELHLSADERYAVMVDDRKRSHLKVHLCSDGSFVGHILPLNWIDTMPFEEKSMFRITKVRVARRLVACIVASRMSSVIIADLATCQPIHVFKPDRRAALCDITPDERFIFTNNGEQVLVFEIGNGVQTSVVDLLAVPKRLMFTRDGS-RAFIMCEGEQKVVILYMDAKGAIEMSFKIMFENSLG-DDRLQDMRVSQ-AEQLLLVRAEKNVLVYEFGRDAIVAHIRRPPEIPAEFKMPN---ANYERINFSEADFAFGDRVVITSIFRDVLVWEVEQGRPLVMLHAPT-GILTRLLVDQTRSLVVGFIEHSR---EIHLWSLQGA---FTDGTAVDSLTAPIRAVRSARRRPRAVACCDNSDEMGVVDLDTGYLTDLYSHEGVVVDCAISSCGDYAVASVVQRNPNTTNIVWSLSERRILAEFGNVPG--HLLPCRHSSDVYIVDQAEVAFKQPFGITRLALGDGAVR 1440          
BLAST of AAA domain-containing protein vs. TrEMBL
Match: A0A267FKI0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033440g3 PE=4 SV=1)

HSP 1 Score: 626.706 bits (1615), Expect = 0.000e+0
Identity = 427/1479 (28.87%), Postives = 724/1479 (48.95%), Query Frame = 1
Query:   31 LIKTSLPFTAASLPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEP----EMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNAD-LVINEDLQSVLRQYYNSCNEIYEASEPKFRILWRDDTGVSEAHHQIYIDQF-EAFITAKVVEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTD--DDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFVTSNCTIAEIFLSIFLQISAIILRNNQ---FETILKNSKEIENNIPRDIEGILLSFQQQSNKKFIIILHDFEKC-----SEVGSQSLVTDLIPKFLPKNLKLIVSSTDS-----FDTRKPYFLNVLVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLGEFYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLL-----VDLATTVSVESLIDDKNSHLKDFHQILAGYFNGAW--VDQTISFHFDLKNPEMSYNCCPKSQKMYA-------------KKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNGGKEIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSPLASTINCPEAIESVLVIQNKESMNKELLIKLKNDSRAYFYDLSFGAISYNTLLSSGEVYYGPNRDIILVLETEYRQIIKVHQRETGDLLGQIIPMNWVVLRPFEERNEYRITNIDMNQTKMALIITNEVSYLFVLNLETLEPILAFNPGLRLEMLKLTPDESTVFTHHVERLVSLNVEKNQLNSAVELQGIPLQMLFANEQSKKAFIVCDQQKSVVVLDLESAGVVRKCYKISFENCLDENDYVLEVSCSEIGNPFLLIMSCHSVILYDWNKEKVLNHITRPSQLPVYFKLPNRLDNQPASLKFNAAKLILSDRVIICALFRDVIVCTVSDNKIIKTLHAPVGGIVSEIHI--ADDYIIGKVEQSQNSAEVMIWKTDPKCLFFKIENNQDKLTRCVKKIQIG--GSVAIASCVESDEMGVIEISTGTLVDLYSHSSVVINCCLSSCGKWALVTV--KNSHNANILWSLETRKIIFEFGSSTNTEFIVPMKSKSGFYCITNHSKSIDAPNFIVTQILCDLGVE 4326
            L    LP ++        I F + S+F DFE ER++L N  +P+L E   + +G++ + +DIKLGL+        Y  +F++   K       + P+ LLGQK+G  L P R+P++ F+L+  TL+ H+     + + L+ +Y  D N   P    E +L+      PD+  +D  +      EWK T  +L+NLF+    ICL  GT+D +   +I   E +A  S  +  S  ++F P++F R+IID+KN++   N+ K D          DV   +  D  +I++ L  +L Q  N     Y + + +F +LWR   G+ +  H+ Y+  F EAFI A     V  R     +   +  ++ +D    +       A F    E  + A+++Y  D     N   +L G  N+GK    A+   E Q  L        I R V     ++++  S+F QI      +           NS E     PR+++ ++           ++++   E+        +  QSLV    P+  P N+KL++++ D           P+   + +   T   +  F +  L    + LT EQ  R+    L   + +  AS++ D         +  +      L +      +R   +FG+  +SH   Y+  S GGLTD EV ++L+LD  V++E+ +        +  + +FP S+WLL+KQE+ +++ +   DGY +      D+ + V+   L  D     K  H  +A YF G W  V + +S      +   +    P  + MY+              + G+ FYN RKFRQL RHL   D   EL   V+F +D+LY K+ AL + E L DFQL  +   E+ L+EE+I  +  ++ ++L++LA EL   L+ Y   Y N++ L+   D    +HN FVP Y   KLPGS L ST+ CP  ++S+    +  S    L +KLK+D   Y YDL  G +      SSGE++   +    ++++   R  +KVH    G  +G I+P+NW+   PFEE++ +RIT + +++  +A I+ + +S + + +L T +PI  F P  R  +  +TPDE  +FT++ E+++   +      S V+L  +P +++F  + S +AFI+C+ ++ VV+L +++ G +   +KI F+N L  +D + ++  S+     LL+ +  +V++Y++ ++ ++ HI RP ++P  FK+PN        + F+ A     DRV+I ++FRDV+V  V   + +  LHAP  GI++ + +      ++G +E S+   E+ +W        F      D LT  ++ ++       A+A C  SDEMGV+++ TG L DLYSH  VV++C +SSCG +A+ +V  +N +  NI+WSL  R+I+ EFG+      ++P +  S  Y +     +   P  I    L D  V 
Sbjct:    8 LCSGRLPLSSLPTVSPRSITFCIISAFSDFEKEREVLRNEAYPRLYEYFRNTYGLQFRGVDIKLGLEKVNYDELDYWDLFHDIKRKFAFASHDSVPVILLGQKFGLPLLPRRLPSRAFELIRATLRAHRNPLTAQYHILDSWYRRDENAECPDGDTEHVLLPASRQLPDIVGEDPEAKASALAEWKFTARLLANLFKIGVGICLREGTMDDQTAFEILTFELDAGISHLLSHSDLTQFRPIVFERDIIDLKNYL---NEPKADL-------YTDVELDEENDRFLIDKSLADLL-QELNDRLTTYASVDRQFSVLWRFPDGIDKRLHEEYLGDFCEAFIEAAKT-AVESRLAGKQMHADSEVVRVFDDAWTSLEHCRLLAPFSLRQEATIEAVVEYCVDFSARQNYTYLLLGGQNTGKMPAIAQAFIEIQQRLCESPVGVLIPRVVMFERRLSDLTASLFNQIRTCCRLDTGGVVATGAGANSAEQTAPPPRNLQELVDRLSGAG--PVVLLIAGAERLVDDAGDRLPPQSLVP--APRGPPSNVKLVLTALDEAGGSVLSLAGPHLRVLHIGPQTADAYREFARHYLAERSRRLTAEQ-WRWAEQRLAGLESMFHASLLCDRLARLASGDDPADLPASSGLADLLDAEFDRLEAKFGRIAVSHAFAYVSLSGGGLTDIEVKDLLSLDDAVLDEMLVP------IEDGVRQFPSSVWLLMKQEVRLLIHEASFDGYFVNYWANGDVESAVAARYLSSDDLR--KSLHFTMADYFLGTWHGVSKPVSTVSSADDVSSADRLMPTQKLMYSIEGETGGSVTSGGGQQGS-FYNERKFRQLPRHLFLSDRVPELNNLVLFSYDWLYYKSAALGLEETLRDFQLVPSN-TEVSLVEETIRKAFDILGDNLNNLAAELSGSLVLYSHEYKNIKNLVRQADVRGCQHNIFVPCYSYAKLPGSALQSTVECPSNLQSM----HLSSETATLYVKLKDDVSLYKYDLERGTMLGEARTSSGELHLSADERYAVMVDDRKRSHLKVHLCSDGSFVGHILPLNWIDTMPFEEKSMFRITKVRVSRRLVACIVASRMSSVIIADLATCQPIHVFKPDRRAALCDITPDERFIFTNNGEQVLVFEIGNGVQTSVVDLLAVPKRLMFTRDGS-RAFIMCEGEQKVVILYMDAKGAIEMSFKIMFDNSLG-DDRLQDMRVSQ-AEQLLLVRAEKNVLVYEFGRDAIVAHIRRPPEIPAEFKMPN---ANYERINFSEADFAFGDRVVITSIFRDVLVWEVEQGRPLVMLHAPT-GILTRLLVDQTRSLVVGFIEHSR---EIHLWSLQGA---FTDGTAVDSLTAPIRAVRSARRRPRAVACCDNSDEMGVVDLDTGYLTDLYSHEGVVVDCAISSCGDYAVASVVQRNPNTTNIVWSLSERRILAEFGNVPG--HLLPCRHSSDVYIVDQAEVAFKQPFGITRLALGDGAVR 1440          
BLAST of AAA domain-containing protein vs. TrEMBL
Match: A0A267G6I1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033440g2 PE=4 SV=1)

HSP 1 Score: 621.698 bits (1602), Expect = 0.000e+0
Identity = 427/1479 (28.87%), Postives = 720/1479 (48.68%), Query Frame = 1
Query:   31 LIKTSLPFTAASLPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEP----EMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNAD-LVINEDLQSVLRQYYNSCNEIYEASEPKFRILWRDDTGVSEAHHQIYIDQF-EAFITAKVVEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTD--DDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFVTSNCTIAEIFLSIFLQISAIILRNNQ---FETILKNSKEIENNIPRDIEGILLSFQQQSNKKFIIILHDFEKC-----SEVGSQSLVTDLIPKFLPKNLKLIVSSTDS-----FDTRKPYFLNVLVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLGEFYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLL-----VDLATTVSVESLIDDKNSHLKDFHQILAGYFNGAW--VDQTISFHFDLKNPEMSYNCCPKSQKMYA-------------KKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNGGKEIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSPLASTINCPEAIESVLVIQNKESMNKELLIKLKNDSRAYFYDLSFGAISYNTLLSSGEVYYGPNRDIILVLETEYRQIIKVHQRETGDLLGQIIPMNWVVLRPFEERNEYRITNIDMNQTKMALIITNEVSYLFVLNLETLEPILAFNPGLRLEMLKLTPDESTVFTHHVERLVSLNVEKNQLNSAVELQGIPLQMLFANEQSKKAFIVCDQQKSVVVLDLESAGVVRKCYKISFENCLDENDYVLEVSCSEIGNPFLLIMSCHSVILYDWNKEKVLNHITRPSQLPVYFKLPNRLDNQPASLKFNAAKLILSDRVIICALFRDVIVCTVSDNKIIKTLHAPVGGIVSEIHI--ADDYIIGKVEQSQNSAEVMIWKTDPKCLFFKIENNQDKLTRCVKKIQIG--GSVAIASCVESDEMGVIEISTGTLVDLYSHSSVVINCCLSSCGKWALVTV--KNSHNANILWSLETRKIIFEFGSSTNTEFIVPMKSKSGFYCITNHSKSIDAPNFIVTQILCDLGVE 4326
            L    LP ++        I F + S+F DFE ER++L N  +P+L E   + +G++ + +DIKLGL+        Y  +F++   K       + P+ LLGQK+G  L P R+P++ F L+  TL+ H+     +   L+ +Y  D N   P    E +L+      PD+  +D  +      EWK T  +L+NLF+    ICL  GT+D +   +I   E +A  S  +  S  ++F P++F R+IID+KN++   N+ K D          DV   +  D  +I++ L  +L Q  N     Y + + +F +LWR   G+ +  H+ Y+  F EAFI A     V  R     +   +  ++ +D    +       A F    E  + A+++Y  D     N   +L G  N+GK    A+   E Q  L        I R V     ++++  S+F QI      +           NS E     PR+++ ++           ++++   E+        +  QSLV    P+  P N+KL++++ D           P+   + +   +   +  F +  L    + LT EQ  R+    L   + +  AS++ D         +  +      L +      +R   +FG+  +SH   Y+  S GGLTD EV ++L+LD  V++E+ +        +  + +FP S+WLL+KQE+ +++ +   DGY +      D+ + V+   L  D     K  H  +A YF G W  V + +S      +   +    P  + MY+              + G+ FYN RKFRQL RHL   D   EL   V+F +D+LY K+ AL + E L DFQL  +   E+ L+EE+I  +  ++  +L++LA EL   L+ Y   Y N++ L+   D    +HN FVP Y   KLPGS L ST+ CP  ++S+    +  S    L +KLK+D   Y YDL  G +      SSGE++   +    ++++   R  +KVH    G  +G I+P+NW+   PFEE++ +RIT + + +  +A I+ + +S + + +L T +PI  F P  R  +  +TPDE  +FT++ E+++   +      S V+L  +P +++F  + S +AFI+C+ ++ VV+L +++ G +   +KI FEN L  +D + ++  S+     LL+ +  +V++Y++ ++ ++ HI RP ++P  FK+PN        + F+ A     DRV+I ++FRDV+V  V   + +  LHAP  GI++ + +      ++G +E S+   E+ +W        F      D LT  ++ ++       A+A C  SDEMGV+++ TG L DLYSH  VV++C +SSCG +A+ +V  +N +  NI+WSL  R+I+ EFG+      ++P +  S  Y +     +   P  I    L D  V 
Sbjct:    8 LCSGRLPLSSLPTVSPRSITFCIISAFSDFEKEREVLRNEAYPRLYEYFRNTYGLQFRGVDIKLGLEKVNYDELDYWDLFHDIKRKFAFASHDSVPVILLGQKFGLPLLPRRLPSRAFDLIRATLRAHRNPLTAQYYILDSWYRRDDNAECPDGDTEHVLLPASRQLPDIVGEDPEAKASALAEWKFTARLLANLFKIGVGICLREGTMDDQTAFEILTFELDAGISHLLSHSDLTQFRPIVFERDIIDLKNYL---NEPKADL-------YTDVELDEENDRYLIDKSLADLL-QELNDRLTTYASVDRQFSVLWRFPDGIDKRLHEEYLGDFCEAFIEAAKT-AVESRLAGKQMHADSEVVRVFDDAWTSLEHCRLLAPFSLRQEATIEAVVEYCVDFSARQNYTYLLLGGQNTGKMPAIAQAFIEIQQRLCESPVGVLIPRVVMFERRLSDLTASLFNQIRTCCRLDTGGVVATGAGANSTEQTAPPPRNLQELVDRLSGAG--PLVLLIAGAERLVDDAGDRLPPQSLVP--APRGPPSNVKLVLTALDEAGGSVLSLAGPHLRVLHIGPQSADAYREFARHYLAERSRRLTAEQ-WRWAEQRLAGLESMFHASLLCDRLARLASGDDPADLPANSGLADLLDAEFDRLEAKFGRIAVSHAFAYVSLSGGGLTDIEVKDLLSLDDAVLDEMLVP------IEDGVRQFPSSVWLLMKQEVRLLIHEASFDGYFVNYWANGDVESAVAARYLSSDDLR--KSLHFTMADYFLGTWHGVSKPVSTVSSADDVSSADRLMPTQKLMYSIEGETGGSVTSGGGQQGS-FYNERKFRQLPRHLYLSDRVPELNNLVLFSYDWLYYKSAALGLEETLRDFQLVPSN-TEVSLVEETIRKAFDILGENLNNLAAELSGSLVLYSHEYKNIKNLVRQADVRGCQHNIFVPCYSYAKLPGSALQSTVECPSNLQSM----HLSSETATLYVKLKDDVSLYKYDLERGTMLGEARTSSGELHLSADERYAVMVDNRKRSHLKVHLCSDGSFVGHILPLNWIDTMPFEEKSMFRITKVRVARRLVACIVASRMSSVIIADLATCQPIHVFKPDRRAALCDITPDERFIFTNNGEQVLVFEIGNGVQTSVVDLLAVPKRLMFTRDGS-RAFIMCEGEQKVVILYMDAKGAIEMSFKIMFENSLG-DDRLQDMRVSQ-AEQLLLVRAEKNVLVYEFGRDAIVAHIRRPPEIPAEFKMPN---ANYERINFSEADFAFGDRVVITSIFRDVLVWEVEQGRPLVMLHAPT-GILTRLLVDQTRSLVVGFIEHSR---EIHLWSLQGA---FTDGTAVDSLTAPIRAVRSARRRPRAVACCDNSDEMGVVDLDTGYLTDLYSHEGVVVDCAISSCGDYAVASVVQRNPNTTNIVWSLSERRILSEFGNVPG--HLLPCRHSSDVYIVDQAEVAFKQPFGITRLALSDGAVR 1440          
BLAST of AAA domain-containing protein vs. TrEMBL
Match: A0A1I8JLX6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 597.43 bits (1539), Expect = 5.433e-179
Identity = 455/1703 (26.72%), Postives = 788/1703 (46.27%), Query Frame = 1
Query:   31 LIKTSLPFTAASLPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEP----EMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNAD-LVINEDLQSVLRQYYNSCNEIYEASEPKFRILWRDDTGVSEAHHQIYIDQF-EAFITAKVVEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTD--DDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFVTSNCTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSFQQQSNKKFIIILHDFEKC-----SEVGSQSLVTDLIPKFLPKNLKLIVSSTDS-----FDTRKPYFLNVLVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLGEFYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLL-----VDLATTVSVESLIDDKNSHLKDFHQILAGYFNGAW--VDQTISFHFDLKNPEMSYNCCPKSQKMYA------------KKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNGGKEIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSPLASTINCPEAIESVLVIQNKESMNKELLIKLKNDSRAYFYDLSFGAISYNTLLSSGEVYYGPNRDIILVLETEYRQIIKVHQRETGDLLGQIIPMNWVVLRPFEERNEYRITNIDMNQTKMALIITNEVSYLFVLNLETLEPILAFNPGLRLEMLKLTPDESTVFTHHVERLVSLNVEKNQLNSAVELQGIPLQMLFANEQSKKAFIVCDQQKSVVVLDLESAGVVRKCYKISFENCLDENDYVLEVSCSEIGNPFLLIMSCHSVILYDWNKEKVLNHITRPSQLPVYFKLPNRLDNQPASLKFNAAKLILSDRVIICALFRDVIVCTVSDNKIIKTLHAPVGGIVSEIHI--ADDYIIGKVEQSQNSAEVMIWKTDPKCLFFKIENNQDKLTRCVKKIQIG--GSVAIASCVESDEMGVIEISTGTLVDLYSHSSVVINCCLSSCGKWALVTV--KNSHNANILWSLETRKIIFEFGSSTNTEFIVPMKSKSGFYCITNHSKSIDAPNFIVTQILCDLGVEISYTIKVLEISCLGFLTEPPCILNDDKELAFLSSN-------YRTEN-----GVGTGTNSLILWSRETHTNQNGMSKIITVKE--------------FSEQINRSVEDILSITTTKSMEDVLFIFFKTHDHEIDILHFNCHTGLVIQFMELFDVLPKQMDHKELFLSNNGCYVFYQKTSAIVNLSSGEFIGNISSDANNEYAFQCFVLKDTILILSQKTKLLAYRLPE 4932
            L    LP ++        I F + S+F DFE ER++L N  +P+L E   + +G++ + +DIKLGL+        Y  +F++   K       + P+ LLGQ             + F L+  TL+ H+     +   L+ +Y  D N   P    E +L+      PD+  +D  +      EWK T  +L+NLF+    ICL  GT+D +   +I   E +A  S  +  S  ++F P++F R+IID+KN++   N+ K D          DV   +  D  +I++ L  +L Q  N     Y + + +F +LWR   G+ +  H+ Y+  F EAFI A     V  R     +   +  ++ +D    +       A F    E  + A+++Y  D     N   +L G  N+GK    A+   E Q  L     C         +    +I     L    ++           NS E     PR+++ ++           ++++   E+        +  QSLV    P+  P N+KL++++ D           P+   + +   +   +  F +  L    + LT EQ  R+    L   + +  AS++ D         +  +      L +      +R   +FG+  +SH   Y+  S GGLTD EV ++L+LD  V++E+ +        +  + +FP S+WLL+KQE+ +++ +   DGY +      D+ + V+   L  D     K  H  +A YF G W  V + +S      +   +    P  + MY+                  FYN RKFRQL RHL   D   EL   V+F +D+LY K+ AL + E L DFQL  +   E+ L+EE+I  +  ++  +L++LA EL   L+ Y   Y N++ L+   D    +HN FVP Y   KLPGS L ST+ CP  ++S+    +  S    L +KLK+D   Y YDL  G +      SSGE++   +    ++++   R  +KVH    G  +G I+P+NW+   PFEE++ +RIT + + +  +A I+ + +S + + +L T +PI  F P  R  +  +TPDE  +FT++ E+++   +      S V+L  +P +++F  + S +AFI+C+ ++ VV+L +++ G +   +KI FEN L  +D + ++  S+     LL+ +  +V++Y++ ++ ++ HI RP ++P  FK+PN        + F+ A     DRV+I ++FRDV+V  V   + +  LHAP  GI++ + +      ++G +E S+   E+ +W        F      D LT  ++ ++       A+A C  SDEMGV+++ TG L DLYSH  VV++C +SSCG +A+ +V  +N +  NI+WSL  R+I+ EFG+      ++P +  S  Y +     +   P F +T++    G          E + +  L   P +  +D+ +  L++        Y  E        GTG   LI  S  +      + +I+ V+                  +   +++ + S    +  + V+ I       +++ L   C            ++LP   D   L  S +G Y      + + ++++G     +   A   + F+CF L D++++ S+  ++ AYR+PE
Sbjct:    8 LCSGRLPLSSLPTVSPRSITFCIISAFSDFEKEREVLRNEAYPRLYEYFRNTYGLQFRGVDIKLGLEKVNYDELDYWDLFHDIKRKFAFASHDSVPVILLGQ------------NRAFDLIRATLRAHRNPLTAQYYILDSWYRRDDNAECPDGDTEHVLLPASRQLPDIVGEDPEAKASALAEWKFTARLLANLFKIGVGICLREGTMDDQTAFEILTFELDAGISHLLSHSDLTQFRPIVFERDIIDLKNYL---NEPKADL-------YTDVELDEENDRYLIDKSLADLL-QELNDRLTTYASVDRQFSVLWRFPDGIDKRLHEEYLGDFCEAFIEAAKT-AVESRLAGKQMHADSEVVRVFDDAWTSLEHCRLLAPFSLRQEATIEAVVEYCVDFSARQNYTYLLLGGQNTGKMPAIAQAFIEIQQRL-----CE--------SPLFNQIRTCCRLDTGGVVATGAG-----ANSTEQTAPPPRNLQELVDRLS--GAGPLVLLIAGAERLVDDAGDRLPPQSLVP--APRGPPSNVKLVLTALDEAGGSVLSLAGPHLRVLHIGPQSADAYREFARHYLAERSRRLTAEQ-WRWAEQRLAGLESMFHASLLCDRLARLASGDDPADLPANSGLADLLDAEFDRLEAKFGRIAVSHAFAYVSLSGGGLTDIEVKDLLSLDDAVLDEMLVP------IEDGVRQFPSSVWLLMKQEVRLLIHEASFDGYFVNYWANGDVESAVAARYLSSDDLR--KSLHFTMADYFLGTWHGVSKPVSTVSSADDVSSADRLMPTQKLMYSIEGETGGSVTSGGGQQGSFYNERKFRQLPRHLYLSDRVPELNNLVLFSYDWLYYKSAALGLEETLRDFQLVPSN-TEVSLVEETIRKAFDILGENLNNLAAELSGSLVLYSHEYKNIKNLVRQADVRGCQHNIFVPCYSYAKLPGSALQSTVECPSNLQSM----HLSSETATLYVKLKDDVSLYKYDLERGTMLGEARTSSGELHLSADERYAVMVDNRKRSHLKVHLCSDGSFVGHILPLNWIDTMPFEEKSMFRITKVRVARRLVACIVASRMSSVIIADLATCQPIHVFKPDRRAALCDITPDERFIFTNNGEQVLVFEIGNGVQTSVVDLLAVPKRLMFTRDGS-RAFIMCEGEQKVVILYMDAKGAIEMSFKIMFENSLG-DDRLQDMRVSQ-AEQLLLVRAEKNVLVYEFGRDAIVAHIRRPPEIPAEFKMPN---ANYERINFSEADFAFGDRVVITSIFRDVLVWEVEQGRPLVMLHAPT-GILTRLLVDQTRSLVVGFIEHSR---EIHLWSLQGA---FTDGTAVDSLTAPIRAVRSARRRPRAVACCDNSDEMGVVDLDTGYLTDLYSHEGVVVDCAISSCGDYAVASVVQRNPNTTNIVWSLSERRILSEFGNVPG--HLLPCRHSSDVYIVDQAEVAFKQP-FGITRLALACG----------ESASIPHLLGRPFLTGNDRLIVCLTARDLDCARAYYIEPCLFTWNTGTGQTRLIGPSMLSAFGL--VRRILAVQPCLAGSDEGGSDVVVVYTEEEEALDSVRSPDQRRFTQSVMII-------DVETLTLRCLAP---------NLLPAGTDPDRLSFSRSGEYCV-DADNYLYSVAAGL---PLRRAAPAGFQFRCFALADSLMLFSRGRRVRAYRVPE 1602          
BLAST of AAA domain-containing protein vs. TrEMBL
Match: A0A1S3JCC0 (NACHT and WD repeat domain-containing protein 2 OS=Lingula unguis OX=7574 GN=LOC106171981 PE=4 SV=1)

HSP 1 Score: 452.21 bits (1162), Expect = 1.142e-127
Identity = 435/1794 (24.25%), Postives = 808/1794 (45.04%), Query Frame = 1
Query:   67 LPER--NVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNC-PIF--LLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSII-ICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYS-QNADLVINEDLQSVLRQYYNSCNEIYEASE--PKFRILWRDDTGVSEAHHQIYIDQFEAFITAKVVEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFVTSNCTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSF-----QQQSNKKFIIILHDFEKCS-EVGSQSLVTDLIPKFLPKNLKLIVSST-------DSFDT---RKP-YFLNVLVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLGEFYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLVDLATTVSVESLIDDKNSHLKD------FHQILAGYFNGAWVDQTISFHFD--------LKNPEMSYNCCPKSQKM-YAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNGGKEIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSPLASTINCPEAIESVLVIQNKESMNKELLIKLKNDSRAYFYDLSFGAISYNTLLSSGEVYYGPNRDIILVLETEYRQIIKVHQRETGDLLGQIIPMNWVVLRPFEERNEYRITNIDMNQTKMALIITNEVSYLFVLNLETLEPILAFNPGLRLEMLKLTPDESTVFTHHVERLVSLNVEKNQLNSAVELQGIPLQMLFANEQSKKAFIVCDQQKSVVVLDLESAGVVRKCYKISFENCLDENDYVLEVSCSEIGNPFLLIMSCHSVILYDWNKEKVLNHITRPSQLPVYFKLPNRLDNQPASLKFNAAKLILSDRVIICALFRDVIVCTVSDNKIIKTLHAPVGGIVSEIHIADDY--IIGKVEQSQNSAEVMIWKTDPKCLFFKIENNQDKLTRCVKKIQI--GGSVAIASCVESDEMGVIEISTGTLVDLYSHSSVVINCCLSSCGKWALVTVKNSHNA--NILWSLETRKIIFEFGSSTNTEFIVPMKSKSGFYCITNHSKSIDAPNFI---------VTQILCDLGVEISYTIKVLEISCLGFLTEPPCILNDDKELAFLSSNYRTENGVGTGTNSLILWSRETHTNQNGMSKIITVKEFSEQINRS---VEDILSITTTKSMEDVLFIFFKTHDHE-------------IDILHFNCHTGLVIQFMELFDVLPKQMDHKELFLSNNGCYVFYQKTSAIVNLSSGEFIGNISSDANNEYAFQCFVLKDTILILSQKTKLLAYRLPEICKIGQIELKDEVSCVSKCLDDFTIMVGCVDGSVLSYSLIDIFSPYSFLSQIKVVRNFLPTTRSP---TIELESIRSLNKTELSQEFDNLIAIKRPISEP 5223
            LPE    V+  +V  +  D   ER  L  +++PKL+E C ++ GIE++++D++ G+   +       ++F + L +   C + +  P F  L+GQ+YG+   P  IP   +++L  +L+ ++ R   +   L+ +Y  D N + P  +L  I ++  D  + +   +    Q++W  T++ L  L Q  +++C   G++D     K F+ EFE      I  +   + +  +F REI D+KN++   N            K +D+ ++ +   L I+ D Q  L    N     +   +   KF ILWR +  V    H+ YI+ F       V+  + ++A      + A  +  +D +    L   +  +   G E+I+  +  Y+T   +  P++L+G    GK+ VFA+   E    +P   +C  I R++  N   A+I   I+     + L             E E++IP D + +L  F         ++  ++     E  + E  +  LV   +P+ L  N+K+++S+        D   T   + P YF+ V  P  +     + ++  L   G+ ++++Q  R +    +     L   + V+             ++   T+ +   +  ++     GKTL+SH L Y+  S+ GL+D E+ ++L+LD  +++E+Y        +   + + P  +W+ ++ +L   L     DG ++        VE+    K  +L D       +  +A YF+ +W  +   F+F         L +   S +    SQ + +    G   YN RK+ Q+ R L      +EL K   F++ +LYNK+KAL +  ++  F L  N G E  L++ ++     VI  +++++A EL  +LL Y + +PN+R LI+ CD    +H+A VP +P +++PG PL  T+  P  ++     Q   S ++ LL K ++      +DL+ G   Y+   S+G+++  P+  +I++L+      +K+H+ +TG  +GQ+IP+N       E   +Y++  + ++   + +I T E SYL + ++   + I   N   +  +  +TPD   VFT+  E L+S ++   +   ++ L+  P  ++F  E   + F+   ++  + VL  +  G V   YKIS    L + D + ++  S     +LL+    ++++Y    EKVL+   RPS  PV FKLP R       L F  AK    D+ ++  +FR++ +  V    ++  L +P+ GI++ + + D    I+  +E   NS  + +W  D      K  +  D+LT  ++++ +    +V+   C  SDE+GVI++STG L DL +H S +    +++ G++A V+V+       N +W +E RKII EFG      + VP+ + S    +        AP +I         V ++ CDL               L F+   P +  +D+ L  L+++   E      + ++  +S E             V  +S    RS   V+ +L +   +S    + + +     E             I  L  +  +G VI   + F   P  +D   + + N    +     S I ++++G +   +          Q F L    +I  +  ++   R+ +  +I + ++   ++CV  C D  TI+VGC DG+V +Y LID           K +   +P+ + P    I+  + RS +K E S       A + PI  P
Sbjct:   18 LPESPPRVVRIYVSCTPTDMIQERNALMQQVYPKLREYCKEKHGIELQMVDLRWGVLPGIRDDHNQAELFLQELER---CQRVSAGPSFVALIGQRYGDRPLPATIPEHEYEVLRNSLRRNRSRETRDAGMLDHWYFKDTNAIPPVYVLQPISSVISDFNEMNDPEVRKAAQEQWLHTENSLRKLLQKGAELCHKEGSMDGYSKHKYFMGEFENELRHGIENAPRPRDTAFVFMREIEDLKNYVTHKN----------TPKFMDIRWNWKEEKLEIDSDSQRFLYDLKNGKVPAWMGKQNIDKFSILWRFEKVVHPDLHKAYINDFCDKFHDTVIR-LVDKAAFSYTPIPAPPI--FDTVLPHWLITQRKCRDFFGREEIMDRIYAYVTGH-SKQPLVLHGQSGCGKTCVFAKAQEEVPQWVP---DCTTIVRYLGINAESADIRQVIYGVCHQLALLEG----------EDEHHIPTDYKALLKYFFDLLEHYPEDRHLVLFFDSLETLNPEHNAHYLV--WLPEKLNPNVKIVLSTLPEKHDILDRLRTEVIKNPNYFIEV--PPLSVDNCVLLMEYYLQRVGRQISDDQ-LRVVRRAFECCSLPLFVRLTVEEVTRWRSYTKPALKMIVNTIQQAIGVIFDQLEAIHGKTLVSHSLTYLTASATGLSDGEMEDLLSLDDMILDEIY------RTWHPQVRRIPPLVWVRLRADLEPFLFQREVDGVVVSFWNHREFVEAA---KQRYLADEEMCKRIYSEMANYFSCSWHGRPKPFNFSPAVAKSMGLSSTASSADRLVLSQPLTFVGSDGTTRYNKRKYDQMPRTLYLSGRLNELNKMAFFNYLWLYNKSKALSIQHIIATFAL--NPGTESNLVKGALQACQPVILKNMNNMAAELTGRLLTYYASHPNIRHLIQQCDVEGLQHSALVPAFPYHQVPGGPLQHTLESPTPLQ---FFQLLGSDSRYLLAKERSSQNILVFDLATGEWKYDIQASAGDMHLTPDGSMIVLLDHVTEMSVKIHRSDTGKYVGQLIPLNHTT---GETSEKYKLGRMSLSNEFLCIIATFEKSYLCIASVNECKFIEVVNLNGKASVCTITPDSRFVFTNSAETLMSYDLFTLEHVCSLPLEHRPNHVVFTRE-GHRGFVSNLEENVITVLHAKE-GYVDLTYKISLTELL-KGDQISDLVVSH-NEKYLLVRGNSNLVIYGVKNEKVLSCFGRPSDTPVQFKLPQR---SLTDLNFTQAKFSQDDQYVLATIFRNIYIIDVLSGNLVTKLQSPM-GIITSLLLPDKRKQIVTHIE---NSDVIHVWNLDDA---IKHVDTLDRLTGRIQEVLVTKDNTVSFVRCHNSDEVGVIDMSTGQLCDLLTHESPLTGLSITTDGRYAFVSVQPKRPGITNKIWHMEERKIIHEFGEVGG--YSVPLHNVSTIISVCQKEIDFKAPYYISLFKFEEDRVVEVQCDL--------------TLNFVLSKPFVTKEDRYLIVLTADEYNEYKAEYNSPAICAFSLEND---------FAVASYSPADLRSCVNVKRMLDVRPHESNPYAVIVLYSCAAEEDEYSGVSSGYTSGIGFLILDVCSGAVIHVCDTF--FPPDVDLSRILI-NQDVTLCMDAQSHIYDITTGFWKCQLVPTGT---CPQRFALNGKAVIYYEDQEVYVIRVEDGKEIARCDVHMPITCVEVCHDQRTIVVGCSDGAVSAYVLID-----ERYDNAKEIVKTIPSRQLPLSTDIDGRTSRSWDKVESS-------APQTPIRLP 1702          
BLAST of AAA domain-containing protein vs. Ensembl Cavefish
Match: nwd1 (NACHT and WD repeat domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-071116-8])

HSP 1 Score: 149.058 bits (375), Expect = 1.722e-35
Identity = 213/958 (22.23%), Postives = 399/958 (41.65%), Query Frame = 1
Query:   79 NVINFFVCSS-FEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGL-DSYLETTAAYQQIFYEYLNKHGICDKYNC-PIFL--LGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGN-FLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILWRDDTGVSEAHHQIYIDQFEAFITAKVVEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIV--YAMLDYLTDDDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFVTSNCTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSFQQQSNKKFIIILHDFEKCSEV-GSQSLVTDLIPKFLPKNLKLIVS----------STDSFDTRKPYFLNVLVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPC-QTLGEFYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQEL------------SVILVDVIKDGYLLVDLATTVSVESLIDDKNSHLKDFHQILAGYFNGAWV---DQTISFH-------FDLKNPEMSYNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARN--GGKEIVLLEES---INNSALVIENDLDS--LAGELIMQLLPYVSYYPNL-RFLIENCDK--VAPKHNAFVPIYPSNKLPGSPLASTIN 2796
            N+I    C S   D   ER    ++I+P++Q+ C    G+  +++D + G+ DS +      +    E      +C K +  P FL  +G +YG+   P  I    F+LLL  L    +    EG+  L Q+++ D N V P+ +L  I  +                  W  T++ L  L    +     +G +  E       N+     +   +KS D+  S VIF R++  +K         K +++K  + K +DVT     D    E L  +  + +++C     A +P F  +      +    H+ Y++ F   I +++ +G   R           +L+  +++ +A+L   + A F CG + ++    ++ + + +  + P+++ GPP SGK+ V  R   E ++ L   +    +T  +     ++    S+   +   +            +    + + R  + +L    +Q +   ++IL   +      G   L    +PK +P N+ L+VS          S  + +    YF  V     T  E  +  +  ++  G+ LT EQ +  L ++ K T   L   +++D    Q   Y ++ +I    ++ E  +L L+    + GK  + H L YI  S  GL++ E+ ++L+LD  V+ EVY N    L  + ++++FP  LW L +Q+L            +V  ++++K+ YL V+L   +                H +L+ YF G W     + I  H        D K P         +Q ++  +      N+RK  +L  HL+    ++EL + ++ + ++LY KT +  V+ ++ DF    +     EI L+ E    +  +   I+ ++DS  L  E+  +       YP+L   L   C     +      VP     + PG  L +T+N
Sbjct:    2 NIILCVTCKSHLSDLTSERNAFWDKIYPEIQDFC-QSLGLVFEVVDFRWGVSDSVINDHMTVELCLQEI----QLCQKLSVGPSFLALVGSQYGHRPIPRFISENEFELLLSKLSRKDQ----EGSMLLRQWFIKDSNSVPPKYVLQPINVV-----------------SWNLTEARLLQLLCTAALEAEKDGEMSAEQ------NDRVGDGTGFPQKSQDNP-SAVIFVRDLPPLK---------KSEQQKHTL-KFLDVTADGLLDKEAQELLTKLKERIHSAC-----ADDPGFHHIELSKGAIDRKEHKEYLENFCKQIVSQL-KGKISRQTAPPAVPGWLWLQ-QELLHHANLSKKQCAVF-CGRDGLLGKICLVMWESLNMQHGPLVVSGPPGSGKTAVLCRLAQEMRAVLGPQA---VVTLRLLGTSPLSSDVDSVLKSVCVQVCGAFNLAPPCTQTANSHDMLVRFFQSMLHKVSEQGDT-LLLILDSLDHLPHANGGHKL--RWLPKEIPPNIHLVVSTLADWSPCLESLKALNNDDKYFFQV--EPLTLEEGQLITKAYMDKAGRRLTSEQVDAVLQSFQK-TGSPLHLKLLLD-MAKQWTSYTTLSDIRLGSSVQEVISLFLDSLEGKHGKLFVRHALGYITLSRFGLSEAELQDILSLDNDVLAEVYQNR---LPPNHTLLRFPPLLWALFRQDLGDHLVERWENGIAVQFIEIVKERYLSVELRVKM----------------HTVLSEYFLGQWSQGQQKPILLHPLMTQLNADRKVP---------AQPLWFAEG---IPNFRKLHELPFHLLHAGKWEELRQLLLGNLEWLYCKTLSCGVASVIQDFTFCTDVMDCPEIRLIRECFLLLKPTIDFIDGNIDSSLLCTEITARFQALAHAYPDLIGCLYSQCQDWFASCADPVLVPRCSFMEAPGGALKNTLN 867          
BLAST of AAA domain-containing protein vs. Ensembl Cavefish
Match: nwd1 (NACHT and WD repeat domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-071116-8])

HSP 1 Score: 108.227 bits (269), Expect = 5.705e-23
Identity = 129/561 (22.99%), Postives = 236/561 (42.07%), Query Frame = 1
Query: 1225 PIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFVTSNCTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSFQQQSNKKFIIILHDFEKCSEV-GSQSLVTDLIPKFLPKNLKLIVS----------STDSFDTRKPYFLNVLVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPC-QTLGEFYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLVDLATTVSVESLIDDKNSHLK-----DFHQILAGYFNGAWV---DQTISFH-------FDLKNPEMSYNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARN--GGKEIVLLEES---INNSALVIENDLDS--LAGELIMQLLPYVSYYPNL-RFLIENCDK--VAPKHNAFVPIYPSNKLPGSPLASTIN 2796
            P+++ GPP SGK+ V  R   E ++ L   +    +T  +     ++    S+   +   +            +    + + R  + +L    +Q +   ++IL   +      G   L    +PK +P N+ L+VS          S  + +    YF  V     T  E  +  +  ++  G+ LT EQ +  L ++ K T   L   +++D    Q   Y ++ +I    ++ E  +L L+    + GK  + H L YI  S  GL++ E+ ++L+LD  V+ EVY N    L  + ++++FP  LW L +Q+L   LV+  ++G  +   +    +E +   K  +L        H +L+ YF G W     + I  H        D K P         +Q ++  +      N+RK  +L  HL+    ++EL + ++   ++LY KT +  V+ ++ DF    +     EI L+ E    +  +   I+ ++DS  L  E+  +       YP+L   L   C     +      VP     + PG  L +T+N
Sbjct:   11 PLVVSGPPGSGKTAVLCRLAQEMRAVLGPQA---VVTLRLLGTSPLSSDVDSVLKSVCVQVCGAFNLAPPCTQTANSHDMLVRFFQSMLHKVSEQGDT-LLLILDSLDHLPHANGGHKL--RWLPKEIPPNIHLVVSTLADWSPCLESLKALNNDDKYFFQV--EPLTLEEGQLITKAYMDKAGRRLTSEQVDAVLQSFQK-TGSPLHLKLLLD-MAKQWTSYTTLSDIRLGSSVQEVISLFLDSLEGKHGKLFVRHALGYITLSRFGLSEAELQDILSLDNDVLAEVYQNR---LPPNHTLLRFPPLLWALFRQDLGDHLVERWENGIAVCGFSLRQFIEIV---KERYLSVELRVKMHTVLSEYFLGQWSQGQQKPILLHPLMTQLNADRKVP---------AQPLWFAEG---IPNFRKLHELPFHLLHAGKWEELRQLLLGSLEWLYCKTLSCGVASVIQDFTFCTDVMDCPEIRLIRECFLLLKPTIDFIDGNIDSSLLCTEITARFQALAHAYPDLIGCLYSQCQDWFASCADPVLVPRCSFMEAPGGALKNTLN 543          
BLAST of AAA domain-containing protein vs. Ensembl Cavefish
Match: nwd2 (NACHT and WD repeat domain containing 2 [Source:NCBI gene;Acc:103039682])

HSP 1 Score: 87.4261 bits (215), Expect = 1.334e-16
Identity = 81/325 (24.92%), Postives = 142/325 (43.69%), Query Frame = 1
Query: 1933 RFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDV-IKDGYLLV--DLATTVSVESLIDDKNSHLKDFHQILAGYFNGAWV---------------------------DQTISFH---------FDLKNPEMSY--NCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARN--GGKEIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSP 2778
            + G   +   L Y+  +  GLT+ E+ ++L+LD  V+ ++ +  S +L   +S ++    L   +K+EL   LV+  +++  L+V  +    +  + L       +   H +LA YF GAW                             Q++  H         +D + PE  +   C    Q ++       F N+RK  +L+ HL      D+L+  VI +F +LY   K  +  + L D   A      KE+  L  ++ +  + +  +  SL+ EL  +LLP V+  P LR L+  CDK  PK+ + VP++ S  +  SP
Sbjct:  731 KLGSRFVFRALGYVTMARAGLTEVELEDILSLDNSVLGDIMV--SSNL---KSPLRISYDLIAQLKEELEGYLVERQVRNVTLMVWANRHLHLIAQKLYLSNEEDVHQMHSLLAEYFLGAWAGGRKKIFHCDNNHFASLNISQHRNPHHQQSLHGHDKASADKHSYDRQTPEQPWVFQCNLLDQDIF-------FVNHRKMTELLFHLTRSGRTDDLMYGVIMNFSWLYTMIKIGQFDKALTDIDTAYTYTQEKELKFLASTLRSIKIKVNKNPASLSAELQQRLLPVVTSLPKLRHLLLECDKDGPKYCSIVPLHSSMDVTYSP 1043          

HSP 2 Score: 71.2478 bits (173), Expect = 9.721e-12
Identity = 41/155 (26.45%), Postives = 76/155 (49.03%), Query Frame = 1
Query:   46 LPFTAASLPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNF----LEQYYVLDVNCVEPEMIL 498
            L      +P    +  F+C++ +D E ER  L   ++PKL++ C + +GIE +++D+  G+D     +   Q++  + L +        C + L+G+KYG++  P  + +  F+++L+         AVE       LE++Y  D N V P   L
Sbjct:  105 LALPPQHVPTGRSVRVFICANPDDTEAERNALKEHVYPKLRDFCRENYGIEFQVVDLYWGVDPEEWDSPELQRLRMKLLEECLKTSAGPCFVGLVGEKYGSIRVPGEVESAEFEMILDA--------AVEAGLDTRILEEWYCRDENSVPPAYYL 251          
BLAST of AAA domain-containing protein vs. Ensembl Cavefish
Match: nwd2 (NACHT and WD repeat domain containing 2 [Source:NCBI gene;Acc:103039682])

HSP 1 Score: 87.4261 bits (215), Expect = 1.446e-16
Identity = 81/325 (24.92%), Postives = 142/325 (43.69%), Query Frame = 1
Query: 1933 RFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDV-IKDGYLLV--DLATTVSVESLIDDKNSHLKDFHQILAGYFNGAWV---------------------------DQTISFH---------FDLKNPEMSY--NCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARN--GGKEIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSP 2778
            + G   +   L Y+  +  GLT+ E+ ++L+LD  V+ ++ +  S +L   +S ++    L   +K+EL   LV+  +++  L+V  +    +  + L       +   H +LA YF GAW                             Q++  H         +D + PE  +   C    Q ++       F N+RK  +L+ HL      D+L+  VI +F +LY   K  +  + L D   A      KE+  L  ++ +  + +  +  SL+ EL  +LLP V+  P LR L+  CDK  PK+ + VP++ S  +  SP
Sbjct:  651 KLGSRFVFRALGYVTMARAGLTEVELEDILSLDNSVLGDIMV--SSNL---KSPLRISYDLIAQLKEELEGYLVERQVRNVTLMVWANRHLHLIAQKLYLSNEEDVHQMHSLLAEYFLGAWAGGRKKIFHCDNNHFASLNISQHRNPHHQQSLHGHDKASADKHSYDRQTPEQPWVFQCNLLDQDIF-------FVNHRKMTELLFHLTRSGRTDDLMYGVIMNFSWLYTMIKIGQFDKALTDIDTAYTYTQEKELKFLASTLRSIKIKVNKNPASLSAELQQRLLPVVTSLPKLRHLLLECDKDGPKYCSIVPLHSSMDVTYSP 963          
BLAST of AAA domain-containing protein vs. Ensembl Cavefish
Match: nwd2 (NACHT and WD repeat domain containing 2 [Source:NCBI gene;Acc:103039682])

HSP 1 Score: 87.0409 bits (214), Expect = 1.521e-16
Identity = 81/325 (24.92%), Postives = 142/325 (43.69%), Query Frame = 1
Query: 1933 RFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDV-IKDGYLLV--DLATTVSVESLIDDKNSHLKDFHQILAGYFNGAWV---------------------------DQTISFH---------FDLKNPEMSY--NCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARN--GGKEIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSP 2778
            + G   +   L Y+  +  GLT+ E+ ++L+LD  V+ ++ +  S +L   +S ++    L   +K+EL   LV+  +++  L+V  +    +  + L       +   H +LA YF GAW                             Q++  H         +D + PE  +   C    Q ++       F N+RK  +L+ HL      D+L+  VI +F +LY   K  +  + L D   A      KE+  L  ++ +  + +  +  SL+ EL  +LLP V+  P LR L+  CDK  PK+ + VP++ S  +  SP
Sbjct:  644 KLGSRFVFRALGYVTMARAGLTEVELEDILSLDNSVLGDIMV--SSNL---KSPLRISYDLIAQLKEELEGYLVERQVRNVTLMVWANRHLHLIAQKLYLSNEEDVHQMHSLLAEYFLGAWAGGRKKIFHCDNNHFASLNISQHRNPHHQQSLHGHDKASADKHSYDRQTPEQPWVFQCNLLDQDIF-------FVNHRKMTELLFHLTRSGRTDDLMYGVIMNFSWLYTMIKIGQFDKALTDIDTAYTYTQEKELKFLASTLRSIKIKVNKNPASLSAELQQRLLPVVTSLPKLRHLLLECDKDGPKYCSIVPLHSSMDVTYSP 956          

HSP 2 Score: 71.2478 bits (173), Expect = 1.093e-11
Identity = 40/151 (26.49%), Postives = 75/151 (49.67%), Query Frame = 1
Query:   46 LPFTAASLPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNF----LEQYYVLDVNCVEP 486
            L      +P    +  F+C++ +D E ER  L   ++PKL++ C + +GIE +++D+  G+D     +   Q++  + L +        C + L+G+KYG++  P  + +  F+++L+         AVE       LE++Y  D N V P
Sbjct:   28 LALPPQHVPTGRSVRVFICANPDDTEAERNALKEHVYPKLRDFCRENYGIEFQVVDLYWGVDPEEWDSPELQRLRMKLLEECLKTSAGPCFVGLVGEKYGSIRVPGEVESAEFEMILDA--------AVEAGLDTRILEEWYCRDENSVPP 170          
BLAST of AAA domain-containing protein vs. Ensembl Nematostella
Match: EDO31117 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYV4])

HSP 1 Score: 156.377 bits (394), Expect = 3.991e-38
Identity = 205/946 (21.67%), Postives = 405/946 (42.81%), Query Frame = 1
Query:   73 ERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQ---IFYEYLNKHGICDKYNCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYP---DLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILWRD-DTGVSEAHHQIYIDQFEAFITAKVVEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFVTSNCTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSFQQQSNKKFIIILHDFEKCSEVGSQSLVTDLIPKFLPKNLKLIVSSTDSFDTRKPYFLNVL--------VPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLG----EFYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLVDLATTVSVESLIDDKNSHLK-----DFHQILAGYFNGA-WV-DQTISFHFDLKNPEMSYNCCPKSQK-------MYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNGGK--EIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKL---PGSPLASTIN 2796
            E N++  F  S+F D   ER +L   ++P L++ C  +  +E +++D++ G+    E TA ++       E  N   +    N   FL G KYG    P +I  + F+ L++  +  +     E + L ++++ + N +  E +L  + A  P   D+ ++  +     ++EW K       + +  + +    G L  E V K + +  E      I    D +   + + REI DI   I      KD+K    I    D+    + D    E L  + RQ     +++   +  ++ + W       S+  H  Y++ F                 +   DL+         + +  L+ + F     G ++I+    DYL   D+  P+++YG   SGK+ + A   F  +  L  ++ C F  RF+ ++   +   L+I   +   I +    E++ ++  E    + R    +L +    + +  +++L   ++ S   +  L+ + +PK L  ++K+++S    +    P     L        VP  ++   +  +   L++  + LT EQ    ++ + K         + +   + +   + S  ++   +LG    E       R  ++ GK L S  L Y+  +  GLT+ E+ ++L+LD  V+++VY      +   + +V+ P  LW  ++ ++   LV+   DG  +V        E+    +  +LK     D H ++A +F G  W        H  L   + +    P + +       M++K+     +N RK  +L  HLV    ++ L + V+F+F+++  K KA  ++ +L D+  A       +I L+++++  S+  I++DL+SLA +LI +LL +   +P +  L+E   +     N  V I P N     PG PL + ++
Sbjct:   20 ESNIVRIFTSSTFTDTFEERNLLMRDVYPSLRKYC-QQHSLEFQVVDMRWGVRD--EATADHKTSDLCIQEIKNCQRLTQGPNYVCFL-GNKYGYRPVPYKINAEEFESLVDIAREVENVKKEEVDLLLEWFLKNENALPAEYVLQPVTAKLPYYNDMREEVHDKYSQQREEWWKISVTFQRVLRISAHVAGRRGKLTEEQVHKYYKSVTEHEIEHGILNCADPEAQTLCYIREIEDINLNI------KDEK----IPLYTDIADGGH-DAEAQEHLFRLKRQRV--LDKLKAENVVQYSVPWNSRGINASDRRHHEYLENF---------------CNRFESDLTR--------LIDRSLECSAFR----GRQEILSRARDYLCRYDSARPLVVYGASGSGKTSIMAVIAFRVKEWLGDNAVCIF--RFLGTSPGTSNTLLTI-KSVCEQIHQVFGLESLKEDVAEDYTELVRHFHELLSTLSVSAERPLVLVLDSVDQLSPSYNAHLM-NWLPKSLSDHIKIVISVLPGYYEILPTLQRSLTDTNCYIEVPTLSRDTGHEILDAWLDSKHRTLTPEQRVLVMAAFDK-----CPQPLFLKLIFAEASEWASYTDVSGVSLGANVPEAIGFLFERLERKHGKMLFSRALQYVTAARSGLTENELEDILSLDDDVIDDVYQYWDPPV---EGVVRLPNLLWARVRSDIDEFLVERQADGKTVVAWYHRQFWEAC---ERMYLKDGVKVDAHALMAEFFLGEFWTWGGGRKKHIVLTRRQKAL---PDADRQVSAQPLMFSKE----IFNLRKLSELPYHLVHSKQFNALSQEVLFNFEWIMAKVKAQSLNSVLADYDTALQAKPDLDIRLVQDTLILSSSNIKHDLNSLAPQLIGRLLAFKGKFPRIASLLEQAYRWIYARNIPV-IAPMNACLISPGGPLITNLH 898          
BLAST of AAA domain-containing protein vs. Ensembl Nematostella
Match: EDO37261 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG70])

HSP 1 Score: 80.1073 bits (196), Expect = 4.423e-15
Identity = 143/711 (20.11%), Postives = 287/711 (40.37%), Query Frame = 1
Query:  148 RIFPKLQEQCFDEFGIEIKLIDIKLGL-----DSYLETTAAYQQIFYEYLNKHGICDKYNCP---IFLLGQKYGNV-LPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEP-KFRILW-RDDTGVSEAHHQIYID----QFEAFITAKVVEGVAER-AKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFVTS---NCTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSFQQQSNKKFIIILHDFEKCS-EVGSQSLVTDLIPKFLPKNLKLIVSSTDSFDTR-----KPYFLN----VLVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLGEFY-----ALN--LNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDG 2172
            +++PKL+E C  + G E +++D++ G+     D +  T    ++I          C K +     I LL +KYG   L P+ +P+   +++      H    +   + L+++Y LD NC+    IL  +                                                      +++ F     + +RK     +S     R+   +KN IV +  K     ++ + K +D T           D  S+L+Q  +S  +I   +    ++I W +     +   H+ Y++     F+  +  K+ + ++E  + +I   +    ++ + + C + L +        G + ++ ++ DYL +     P++L+G    GK+ + A    +      H   C  + RF+ +   + TI  +  SI  QI  +          LK+  E+          +L S    + +  +++L   ++ S E G++ L  D +PK LP + K+IVS+      R     K  F N    + VP    ++ +  +   L  +G+ L   Q +  +S + +         + +   +++   ++S  + P QT    Y     A+N  L R   + G+ L+ H L Y+  +  GLT+ E+ ++L+ D +V+++V+        +   I + P  LW+ I+ +L   LVD   +G
Sbjct:   24 KVYPKLKEFC-KQKGYEFQVVDMRWGVRDVATDLHETTDLCIREI--------RACQKISAGPNFITLLSEKYGYCPLVPV-MPSDELQMI------HANCNSTGKDLLDKWYRLDTNCIPASYILQPVST----------------------------------------------------WIHGFFTEGDKKVRKQAQDDWS-----RDCTALKNAIVTAIHKAHSD-QATVHKYMDTTIGDEI-----TDRMSMLQQLKSSMKQILGINNMLVYKIKWTKKGIDPTNDEHRQYLNTFCRDFQRVLETKITQSISENTSSEIESPIYEEVVQ-HMMFCQSKLDMFH------GRQAVLNSIGDYLREG-LGQPLVLHGCSGCGKTSIMAMAA-KCARDWIHPEAC-VVLRFLGTTPKSSTIRRLMKSICEQIKCVYRLTTSIPQGLKDMVEL-------FPSLLAS--ATAKRPLLVLLDSLDQLSPEDGARLL--DWLPKHLPGHCKMIVSTLPGAQYRCFPKLKAMFKNDKLFISVPSLPHSDVSDILSMWLQQSGRTLQPAQRDLVMSAFSQ-----CPLPLFLKISFDEACRWHSYTD-PGQT--RLYGSVRDAINGLLERIEAKHGRILVQHALGYLTAARSGLTETELDDILSSDDEVLDDVF------QYWTPPIRRLPPLLWVRIRADLDSYLVDRGSEG 620          
BLAST of AAA domain-containing protein vs. Ensembl Nematostella
Match: EDO40517 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Z9])

HSP 1 Score: 66.2402 bits (160), Expect = 8.329e-11
Identity = 100/461 (21.69%), Postives = 190/461 (41.21%), Query Frame = 1
Query:  877 EDLQSVLRQYYNSCNEIYEASEPKFRILWRDDTGVSEAH--HQIYID----QFEAFITAKVVEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFVTSNCTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSFQQQ-----SNKKFIIILHDFEKCSEVGSQSLVTDLIPKFLPKNLKLIVSSTDS-----FDTRKPYFLN----VLVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTL-----GEFYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLV 2184
            ++LQS +R   +  N I+      + I W  +    E +  H  Y+     +F   +  K+ + + +RA     D    F +        +L+   F     G EDI+  +  Y++      P++LYG    GK+ + A T     S   +  E   + RF+ +    + I L +    SA +     F T  K        +P+D + +L  FQ +     SN+  ++IL   ++ +       +   +P+ LPK++ ++VS+        +   K   L+    V V           + + L+N  + LT+ Q +  L+ + +         + +   Y+    + S   +    L     G   AL   R  +R G  L+ H L YI  +  GL++ E+ ++L+ D++V++EV+        +   + + P  LW  I+ EL+  +V+   DG  +V
Sbjct:  215 KNLQSEIRSTLDKSN-IFS-----YDIKWTSEGVTPEGNLTHGQYLGKLCTEFYDVMKKKITDAITKRAAGEVRDKEHLFQEVAQHATFCNLKCENFH----GREDILEKIRTYISGSGQK-PLVLYGDSGCGKTSLVAMTAKLVPSWTEY--EPVVVLRFLGTTPDSSNIRLVLR---SACLQLCKAFGTSTKV-------VPQDYQDLLREFQDRLKMAKSNRPIVVILDSADQLTTTDDAHQMV-WLPRKLPKHVYVLVSTLKDPKYACYPALKKLLLDSNCFVEVSSLPSEVACNILTSWLSNDNRRLTDSQRKIVLNAFNR-----CPLPLYLRLAYDHAVTWKSYTPLEKSVLEKNVQGMIKAL-FKRLERRHGTVLVRHALAYITAAKHGLSEPELEDILSCDEEVLDEVF------QYWTPPVRRIPPLLWARIRAELNSYVVECGTDGARVV 639          
BLAST of AAA domain-containing protein vs. Ensembl Nematostella
Match: EDO34994 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMT6])

HSP 1 Score: 62.7734 bits (151), Expect = 1.198e-9
Identity = 84/378 (22.22%), Postives = 166/378 (43.92%), Query Frame = 1
Query: 1132 LQINKFAKFGC----GYEDIVYA------MLDY-LTDDDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFV--TSNCTIAEIFL-SIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSFQQQSNKKFIIILHDFEKCS-EVGSQSLVTDLIPKFLPKNLKLIVSST-----DSFDTRKPYFLN---VLVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLGEFYALNLNRWYKRF----GKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLV 2184
            LQ   F +  C    G ED++ +      M  Y + D   N P+++YG    GK+ V +      +  L  D+ C  + R++  T + ++  + + S+  QI A+  ++  F  I  + KE++ +  R +    +       +  +I+L   ++ S E G++ L    +P  LP ++ L+VS+      + F   K +      VLVP+  Q +    + + L    + L+ +Q +  +   L+      +  + V   +++   + S   +    L       +N  ++R     G  L+S  L Y+  +  GLT+ E+ ++L+ D  V+++VY        +   + + P  LW+ I+Q+L   LV    DG  +V
Sbjct:  279 LQHLSFCQSKCEQFYGREDVLLSCRLILNMRSYDVLDVCRNRPLVIYGESGCGKTSVVSMVAMRSREWLRGDT-C-VVVRYIGTTPDSSLVRLLVRSVCQQICAVYEKDPSF--IRNDIKELKEDFIRCLRMATV------ERPLLIVLDSLDQLSAEDGARQL--SWLPMTLPDHVHLVVSTIPEVKYECFPVLKAFLPPESFVLVPKLPQKDAAEILVSYLRMEHRTLSTDQQD-IVQQALQEC----SLPIFVRVAFDEAIRWKSYSPLDETVLQHTVRGAINSLFERVERQHGHVLVSRALGYVTAAKSGLTETELEDLLSCDDFVLDDVY------QYWTPPVRRIPPLLWVRIRQDLESYLVTRGADGAQVV 633          

HSP 2 Score: 53.1434 bits (126), Expect = 8.878e-7
Identity = 45/146 (30.82%), Postives = 68/146 (46.58%), Query Frame = 1
Query:   79 NVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNC-PIFL--LGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDI 507
             V+  F  S+F D E ER  L  +  PKL+  C  E G E +++D++ G+    E +A         L +   C + +  P F+  LGQKYG    P RIP   F  +   L+N   R     + +E+++  D N V P  +L  I
Sbjct:    2 KVVRIFTSSTFTDTEAERNALMLKTIPKLKLFC-QEKGYEFQVVDMRWGVR---EQSADDHTTVDLCLKELKACQQLSTGPNFVTFLGQKYGFRPFPPRIPGDEFLQIAAALENEHDR-----SLIEKWFKCDFNGVPPAYMLQPI 138          
BLAST of AAA domain-containing protein vs. Ensembl Nematostella
Match: EDO47108 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNA9])

HSP 1 Score: 62.3882 bits (150), Expect = 1.425e-9
Identity = 99/432 (22.92%), Postives = 183/432 (42.36%), Query Frame = 1
Query:  946 KFRILWRD---DTGVSEAHHQIYIDQ----FEAFITAKVVEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFVTSNC-TIAEIFLSIFLQISAI-ILRNNQFETILKNSKEIENNIPRDIEGILLSFQQ-----QSNKKFIIILHDFEKCS-EVGSQSLVTDLIPKFLPKNLKLIVSS--TDSFDTRKPYFLNVL-------VPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLGEFYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKD 2169
            +F + W +   D   SE H Q YI++    F   +T  +   V+ERA+    D  A  +  +   C     + K   F  G E+ + ++   L  +   +  +LYG    GK+ + A+              C  +  ++      +   F+ I    S I  L  +  + + + S E  +N+P D++ +   F +      + K  +++L   ++ S + G + L  D +PK LP N+ L++S+   D ++   P    +L       VP     E +  +   L  + K LT+ Q +  L  + +    +       +    +++       +P    G   AL  +R  +  G+ L+SH L YI  S  GLT+ E+ ++L+LD  V+N+VY        +   I + P  LW+ I+ ++S  L+D   D
Sbjct:  215 QFDVKWAENGIDPSESEEHAQ-YIEELCTSFYETLTGMIGTAVSERAEVEVKDPLAEEVFSHLTFC-----LKKCEAFH-GREEFLDSVKQALLSNGQRI-TVLYGESGCGKTSIMAKI-------------CALVKEWLRKEAVAVVPRFVGISPDSSGIRTLLRSVCQQLCRVSGENADNVPEDMKSLREYFPECLKSAATCKTIVLMLDSLDQLSPDDGGRQL--DWLPKSLPDNIYLVMSTLPGDEYECL-PNLQAILPDACLKEVPSLPLAEADSILTNLLQASRKCLTDSQKQAVLEAFQQCQLPLYLMLAFGEACRWKSYTPEDQITLPPSVKGIINAL-FDRVERVHGRILVSHALGYITASKNGLTEPELEDLLSLDDDVLNDVY------QYWTPPIRRLPPLLWIRIRADISDFLIDRGAD 615          

HSP 2 Score: 51.9878 bits (123), Expect = 2.282e-6
Identity = 40/151 (26.49%), Postives = 72/151 (47.68%), Query Frame = 1
Query:   79 NVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGL-----DSYLETTAAYQQIFYEYLNKHGICDKYNC-PIFL--LGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDI 507
             ++  F  S+F D  +ER  L  RI+P++++ C  + G E +++D++ G+     D +L +    +++          C + +  P F+  LGQKYG    P +IP   F+ LL  + N + +       L  ++  D N V  E +L  I
Sbjct:    1 KIVRIFTSSTFTDTSVERNTLMERIYPRIKQFC-QQHGYEFQVVDMRWGVRDESTDDHLTSELCMREL--------RACQELSTGPNFITFLGQKYGYRPFPPKIPATEFENLLSAVNNVEDQ-----QLLRHWFRRDDNIVPAEYLLQPI 137          
BLAST of AAA domain-containing protein vs. Ensembl Medaka
Match: nwd2 (NACHT and WD repeat domain containing 2 [Source:NCBI gene;Acc:101165765])

HSP 1 Score: 98.2117 bits (243), Expect = 6.358e-20
Identity = 131/582 (22.51%), Postives = 250/582 (42.96%), Query Frame = 1
Query: 1225 PIILYGPPNSGKSIVFARTIFE----FQSSLPHDSECHFITRFVTSNCTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEG---ILLSFQQQS--NKKFIIILHDFEKCSEVGSQSLVTDLIPKFLPKNLKLIVSSTDSFDTRKPYFLNVLVPEFTQTEFNI-FIQTQLNNTGKLLTEEQNERFLSNYLKFTDG----------ILTASVIVDYFYNQNFIYNSMEEIP----CQTLGE-----FYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDV-IKDGYLLV--DLATTVSVESLIDDKNSHLKDFHQILAGYFNGAWVDQTISF------HFDLKNPEMSYNCCPKSQKMYAKKSGN------------------------VFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNGG--KEIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSP 2778
            P++++G P +GK+++ +    +     Q  +  +++   I RF+ S+       LS  L+     L  +  E I  N + + + +P  I+    +L++   +S  ++  +I+L   E+ S+   ++     +P  LP+ ++++VS+  +    K   L  L        + +  IQ       ++L ++     L    K T G            T  + V+  Y +   + S +++     C T+ E     FY++       + G+  +   L YI  +  GLT+ E+ ++L+LD  V+ +V +       Y ++ ++    L   +++EL   L++  +++  LLV  +    +  + L       +   H +LA YF GAW             HF   N  +S++  P  Q+ + K S +                         F N+RK  +LV HL      D+L+  VI +F +LY   K  +  + L D  LA +    KE+  L  ++    + +  +  SL+ EL  +LLP V+  P LR L+  CDK  PK+ + +P++ S  +  SP
Sbjct:  413 PMVVFGGPCTGKTLLLSEVAKQAYTWLQKEMGPETDPVVIVRFIGSS------QLSTDLRT----LLQSICEQIAINYRCLIHFLPNKIQEMRELLINLLGESSFHRPLVIVLDSLEQLSD-ADEARKLWWLPIQLPRTVRIVVSTLPN----KHGILQKLRHLIHDDGYYVELIQRDRKACSQMLKQQ----LLGVKRKVTSGQQIYVNEALAKCTLPMFVNLIYREVVHWRSHKDVDDKSLCSTVHESIEQLFYSVE-----NKLGQRFVFRALGYITMAKAGLTEVELEDILSLDNIVLGDVIV-----ATYLKNPLRISYDLVAKLREELEGYLIERQVRNIALLVWANRHLHLIAQKLYLSNEEDVHQMHSLLAEYFLGAWAGGRKKIFTYDNNHFTSLN--ISHHKNPHHQQSHEKASSDKYSYDRQTPEQPWVFQCNLLEPDIFFVNHRKMTELVYHLTRSGRTDDLMFGVIMNFSWLYTMIKIGQFEKALTDIDLAYSCSQEKELKFLATTLRGVKVKVLKNPASLSAELQQRLLPVVASLPKLRHLLLECDKDGPKYCSIMPLHSSMDVTYSP 963          

HSP 2 Score: 70.8626 bits (172), Expect = 1.484e-11
Identity = 37/144 (25.69%), Postives = 74/144 (51.39%), Query Frame = 1
Query:   67 LPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMIL 498
            +P    +  F+C++ +D E ER  L   ++PKL++ C + +GIE +++D+  G+D         Q++  + L +        C + L+G+KYG++  P  + +  F+++L+          ++ + LE++Y  D N V P   L
Sbjct:   35 VPSGRSVRVFICANPDDTEAERNALKEHVYPKLRDFCRENYGIEFQVVDLYWGVDPEEWDNPELQRLRMKLLEECLKTSAGPCFVGLVGEKYGSIRVPGEVESAEFEMILDA----AVEAGLDTHILEEWYCRDENSVPPAYYL 174          
BLAST of AAA domain-containing protein vs. Ensembl Medaka
Match: nwd2 (NACHT and WD repeat domain containing 2 [Source:NCBI gene;Acc:101165765])

HSP 1 Score: 98.2117 bits (243), Expect = 6.358e-20
Identity = 131/582 (22.51%), Postives = 250/582 (42.96%), Query Frame = 1
Query: 1225 PIILYGPPNSGKSIVFARTIFE----FQSSLPHDSECHFITRFVTSNCTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEG---ILLSFQQQS--NKKFIIILHDFEKCSEVGSQSLVTDLIPKFLPKNLKLIVSSTDSFDTRKPYFLNVLVPEFTQTEFNI-FIQTQLNNTGKLLTEEQNERFLSNYLKFTDG----------ILTASVIVDYFYNQNFIYNSMEEIP----CQTLGE-----FYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDV-IKDGYLLV--DLATTVSVESLIDDKNSHLKDFHQILAGYFNGAWVDQTISF------HFDLKNPEMSYNCCPKSQKMYAKKSGN------------------------VFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNGG--KEIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSP 2778
            P++++G P +GK+++ +    +     Q  +  +++   I RF+ S+       LS  L+     L  +  E I  N + + + +P  I+    +L++   +S  ++  +I+L   E+ S+   ++     +P  LP+ ++++VS+  +    K   L  L        + +  IQ       ++L ++     L    K T G            T  + V+  Y +   + S +++     C T+ E     FY++       + G+  +   L YI  +  GLT+ E+ ++L+LD  V+ +V +       Y ++ ++    L   +++EL   L++  +++  LLV  +    +  + L       +   H +LA YF GAW             HF   N  +S++  P  Q+ + K S +                         F N+RK  +LV HL      D+L+  VI +F +LY   K  +  + L D  LA +    KE+  L  ++    + +  +  SL+ EL  +LLP V+  P LR L+  CDK  PK+ + +P++ S  +  SP
Sbjct:  413 PMVVFGGPCTGKTLLLSEVAKQAYTWLQKEMGPETDPVVIVRFIGSS------QLSTDLRT----LLQSICEQIAINYRCLIHFLPNKIQEMRELLINLLGESSFHRPLVIVLDSLEQLSD-ADEARKLWWLPIQLPRTVRIVVSTLPN----KHGILQKLRHLIHDDGYYVELIQRDRKACSQMLKQQ----LLGVKRKVTSGQQIYVNEALAKCTLPMFVNLIYREVVHWRSHKDVDDKSLCSTVHESIEQLFYSVE-----NKLGQRFVFRALGYITMAKAGLTEVELEDILSLDNIVLGDVIV-----ATYLKNPLRISYDLVAKLREELEGYLIERQVRNIALLVWANRHLHLIAQKLYLSNEEDVHQMHSLLAEYFLGAWAGGRKKIFTYDNNHFTSLN--ISHHKNPHHQQSHEKASSDKYSYDRQTPEQPWVFQCNLLEPDIFFVNHRKMTELVYHLTRSGRTDDLMFGVIMNFSWLYTMIKIGQFEKALTDIDLAYSCSQEKELKFLATTLRGVKVKVLKNPASLSAELQQRLLPVVASLPKLRHLLLECDKDGPKYCSIMPLHSSMDVTYSP 963          

HSP 2 Score: 70.8626 bits (172), Expect = 1.484e-11
Identity = 37/144 (25.69%), Postives = 74/144 (51.39%), Query Frame = 1
Query:   67 LPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMIL 498
            +P    +  F+C++ +D E ER  L   ++PKL++ C + +GIE +++D+  G+D         Q++  + L +        C + L+G+KYG++  P  + +  F+++L+          ++ + LE++Y  D N V P   L
Sbjct:   35 VPSGRSVRVFICANPDDTEAERNALKEHVYPKLRDFCRENYGIEFQVVDLYWGVDPEEWDNPELQRLRMKLLEECLKTSAGPCFVGLVGEKYGSIRVPGEVESAEFEMILDA----AVEAGLDTHILEEWYCRDENSVPPAYYL 174          
BLAST of AAA domain-containing protein vs. Ensembl Medaka
Match: nwd2 (NACHT and WD repeat domain containing 2 [Source:NCBI gene;Acc:101165765])

HSP 1 Score: 98.2117 bits (243), Expect = 7.525e-20
Identity = 130/580 (22.41%), Postives = 251/580 (43.28%), Query Frame = 1
Query: 1225 PIILYGPPNSGKSIVFARTIFE----FQSSLPHDSECHFITRFVTSNCTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEG---ILLSFQQQS--NKKFIIILHDFEKCSEVGSQSLVTDLIPKFLPKNLKLIVSSTDSFDTRKPYFLNVLVPEFTQTEFNI-FIQTQLNNTGKLLTEEQNERFLSNYLKFTDG----------ILTASVIVDYFYNQNFIYNSMEEIP----CQTLGE-----FYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDV-IKDGYLLV--DLATTVSVESLIDDKNSHLKDFHQILAGYFNGAWVDQTIS-FHFD---LKNPEMSYNCCPKSQKMYAKKSGN------------------------VFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNGG--KEIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSP 2778
            P++++G P +GK+++ +    +     Q  +  +++   I RF+ S+       LS  L+     L  +  E I  N + + + +P  I+    +L++   +S  ++  +I+L   E+ S+   ++     +P  LP+ ++++VS+  +    K   L  L        + +  IQ       ++L ++     L    K T G            T  + V+  Y +   + S +++     C T+ E     FY++       + G+  +   L YI  +  GLT+ E+ ++L+LD  V+ +V +       Y ++ ++    L   +++EL   L++  +++  LLV  +    +  + L       +   H +LA YF GAW       F +D     +  +S++  P  Q+ + K S +                         F N+RK  +LV HL      D+L+  VI +F +LY   K  +  + L D  LA +    KE+  L  ++    + +  +  SL+ EL  +LLP V+  P LR L+  CDK  PK+ + +P++ S  +  SP
Sbjct:  403 PMVVFGGPCTGKTLLLSEVAKQAYTWLQKEMGPETDPVVIVRFIGSS------QLSTDLRT----LLQSICEQIAINYRCLIHFLPNKIQEMRELLINLLGESSFHRPLVIVLDSLEQLSD-ADEARKLWWLPIQLPRTVRIVVSTLPN----KHGILQKLRHLIHDDGYYVELIQRDRKACSQMLKQQ----LLGVKRKVTSGQQIYVNEALAKCTLPMFVNLIYREVVHWRSHKDVDDKSLCSTVHESIEQLFYSVE-----NKLGQRFVFRALGYITMAKAGLTEVELEDILSLDNIVLGDVIV-----ATYLKNPLRISYDLVAKLREELEGYLIERQVRNIALLVWANRHLHLIAQKLYLSNEEDVHQMHSLLAEYFLGAWAGGRKKIFTYDNNHFTSLNISHHKNPHHQQSHEKASSDKYSYDRQTPEQPWVFQCNLLEPDIFFVNHRKMTELVYHLTRSGRTDDLMFGVIMNFSWLYTMIKIGQFEKALTDIDLAYSCSQEKELKFLATTLRGVKVKVLKNPASLSAELQQRLLPVVASLPKLRHLLLECDKDGPKYCSIMPLHSSMDVTYSP 953          

HSP 2 Score: 70.4774 bits (171), Expect = 1.655e-11
Identity = 37/144 (25.69%), Postives = 74/144 (51.39%), Query Frame = 1
Query:   67 LPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMIL 498
            +P    +  F+C++ +D E ER  L   ++PKL++ C + +GIE +++D+  G+D         Q++  + L +        C + L+G+KYG++  P  + +  F+++L+          ++ + LE++Y  D N V P   L
Sbjct:   35 VPSGRSVRVFICANPDDTEAERNALKEHVYPKLRDFCRENYGIEFQVVDLYWGVDPEEWDNPELQRLRMKLLEECLKTSAGPCFVGLVGEKYGSIRVPGEVESAEFEMILDA----AVEAGLDTHILEEWYCRDENSVPPAYYL 174          
BLAST of AAA domain-containing protein vs. Ensembl Medaka
Match: nwd1 (NACHT and WD repeat domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-071116-8])

HSP 1 Score: 90.1225 bits (222), Expect = 1.849e-17
Identity = 185/883 (20.95%), Postives = 343/883 (38.84%), Query Frame = 1
Query:  193 IEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNCP---IFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEG-NFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRI----LWRDDTGVSEAHHQIYID--------QFEAFITAKVVEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYED-------IVYAMLDYLTDDDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFVTSN----CTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSFQQQSNKKFIIILHDFEKCSEVGSQSLVTDLIPKFLPKNLKLIVSSTDSFDTRKPYFLNVL-----------VPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLGEFYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVY-INHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLVD-----LATTVSVESLIDDKNSHLKDFHQILAGYFNGAWVDQTISFHFDLKNPEMSYNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNGGKEIVLLEESINNSALV-IENDLDSLA------GELIMQLLPYVSYYPNL 2688
            + ++++D+  G+ +Y        +I  + +    +C + +     I LLG +YG+   P  I  K F++ L  L         EG   L  ++  D N V P  +L  I  +                  W+ T++ L  L ++ +    + G +  E     + +       + +    D   + ++F RE    K       ++K  +    + K +D T    A+++++ + Q +L +     +++Y  S+    +    L R         H  Y+D        Q +A I A V     E  KKI  ++     K   ++  A       A+   G          I  AM +  +    + P++++G    GK+ +  + + E Q  L  ++    + RF+ ++      + ++  SI LQ+S+             +  E++    R+I    L    Q     +I+L   E+ +E    S     IP  LP  + L+V    S DT    F+N+            V   ++ E    +++ L  + + LT EQ +  L ++   T   L   +I+    N        E++      E  +  L+R   +  K L+   L YI  +  GL + E+ +V++LD  V++EVY   H  +     S+++ P  LW  +K++L   L +   +G  ++      L+  V    L  ++       H+IL  YF G W  +         +  +S    P     +A    N+    RK + L  HL+    ++EL + VI    YL   T    VS ++ D        + +   E  +   ALV I+  LD L       GEL+ +L    + +P+L
Sbjct:   16 LPVQVVDLHWGIGNYPFGDHEACEISLQEIK---MCKRLSAGPNFIALLGNRYGHRALPRLISEKQFEVYLSKLSQ-----TPEGIKQLRLWFRKDTNAVPPTYVLQPITDV----------------DSWRFTETQLLQLLRSAASEAEAEGEITAEQKQSFYTSVTAQELEQGLWIG-DHPPNALLFLRENPKQK-------KQKGKEWPKRLAKFMDAT----ANMLLDPESQKLLAELK---SQLYATSQKTTNLHCVELSRGIIDPKRKEHAQYLDSLCQQFISQMKARIEAVVSLRTTESQKKILGNVEEDEDKLSLVLEEAKQHTTMTAELCEGLHGREGILGKICLAMWE--SGQKCHSPLVVHGAAGMGKTALLCKVVREMQRVL--ETRVVLVIRFLAAHHPQRPALDQVLHSICLQVSSACGLVPPTPMTAGSPTELQKFF-RNI----LEEASQQGYTLLIVLDALEQLAEQ-HHSHKLHWIPTNLPPKVHLLV----SMDTCSEAFVNMRLKTDSLENFFEVERLSRDEGERIMESHLRASQRTLTAEQKDVALQSF-TLTGCPLHLKLILSAVQNWTSFTPLTEQLLGNNTEEVMSQLLHRLEHKHRKELVGGALGYIALARDGLLEAELYDVMSLDDDVISEVYRYTHPPT----PSLIRLPPLLWARLKRDLKDHLEERWTNGVAVIAFNHRCLSEVVLGHYLTSERQGRC---HKILGEYFLGRWSGKLKPVALPGLSLLLSDRKVPPQPLWFAPGLANI----RKLQALPHHLLHAGLWEELRQEVI-SMSYLCYGTSVCGVSSVIHDLD---QCSQYMDCTETGLIRDALVLIKPGLDFLDGMSLFYGELLARLSALSAVFPSL 829          
BLAST of AAA domain-containing protein vs. Planmine SMEST
Match: SMESG000012845.1 (SMESG000012845.1)

HSP 1 Score: 3548.83 bits (9201), Expect = 0.000e+0
Identity = 1738/1751 (99.26%), Postives = 1748/1751 (99.83%), Query Frame = 1
Query:   10 MESFQNLLIKTSLPFTAASLPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILWRDDTGVSEAHHQIYIDQFEAFITAKVVEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFVTSNCTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSFQQQSNKKFIIILHDFEKCSEVGSQSLVTDLIPKFLPKNLKLIVSSTDSFDTRKPYFLNVLVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLGEFYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLVDLATTVSVESLIDDKNSHLKDFHQILAGYFNGAWVDQTISFHFDLKNPEMSYNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNGGKEIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSPLASTINCPEAIESVLVIQNKESMNKELLIKLKNDSRAYFYDLSFGAISYNTLLSSGEVYYGPNRDIILVLETEYRQIIKVHQRETGDLLGQIIPMNWVVLRPFEERNEYRITNIDMNQTKMALIITNEVSYLFVLNLETLEPILAFNPGLRLEMLKLTPDESTVFTHHVERLVSLNVEKNQLNSAVELQGIPLQMLFANEQSKKAFIVCDQQKSVVVLDLESAGVVRKCYKISFENCLDENDYVLEVSCSEIGNPFLLIMSCHSVILYDWNKEKVLNHITRPSQLPVYFKLPNRLDNQPASLKFNAAKLILSDRVIICALFRDVIVCTVSDNKIIKTLHAPVGGIVSEIHIADDYIIGKVEQSQNSAEVMIWKTDPKCLFFKIENNQDKLTRCVKKIQIGGSVAIASCVESDEMGVIEISTGTLVDLYSHSSVVINCCLSSCGKWALVTVKNSHNANILWSLETRKIIFEFGSSTNTEFIVPMKSKSGFYCITNHSKSIDAPNFIVTQILCDLGVEISYTIKVLEISCLGFLTEPPCILNDDKELAFLSSNYRTENGVGTGTNSLILWSRETHTNQNGMSKIITVKEFSEQINRSVEDILSITTTKSMEDVLFIFFKTHDHEIDILHFNCHTGLVIQFMELFDVLPKQMDHKELFLSNNGCYVFYQKTSAIVNLSSGEFIGNISSDANNEYAFQCFVLKDTILILSQKTKLLAYRLPEICKIGQIELKDEVSCVSKCLDDFTIMVGCVDGSVLSYSLIDIFSPYSFLSQIKVVRNFLPTTRSPTIELESIRSLNKTELSQEFDNLIAIKRPISEPIVAHERREFSNIY 5262
            MESFQ+LLIKTSLPFTAASLPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILWRDDTGVSEAHHQIYI+QFEAFITAKVVEGVAERAKKINL+LSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFVTSNCTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSFQQQSNKKFIIILHDFEKCSEVGSQSLVTDLIPKFLPKNLKLIVSSTDSFDTRKPYFLNVLVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYN NFI NSMEEIPCQTLGEFYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLVDLATTVSVESLID+KNSHLKDFHQILAGYFNGAWVDQTISFHFDLKNPEMSYNCCPKSQKMYAKKSGN+FYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNGGKEIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSPLASTINCPEAIESVLVIQNKESMNKELLIKLKNDSRAYFYDLSFGAISYNTLLSSGEVYYGPNRDIILVLETEYRQIIKVHQRETGDLLGQIIPMNWVVLRPFEERNEYRITNIDMNQT+MALIITNEVSYLFVLNLETLEPILAFNPGLRLEMLKLTPDESTVFTHHVERLVSLNVEKNQLNSAVELQGIPLQMLFANE+SKKAFIVCDQQKSVVVLDLESAGVVRKCYKISFENCLDENDYVLEVSCSEIGNPFLLIMSCHSVILYDWNKEKVLNHITRPSQLPVYFKLPNRLDNQPASLKFNAAKLILSDRVIICALFRDVIVCTVSDNKIIKTLHAPVGGIVSEIHIADDYIIGKVEQSQNSAEVMIWKTDPKCLFFKIENNQDKLTRCVKK+QIGGSVAIASCVESDEMGVIEISTGTLVDLYSHSSVVINCCLSSCGKWALVTVKNSHNANILWSLETRKIIFEFGSSTNTEFIVPMKSKSGF+CITNHSKSIDAPNFIVTQILCDLGVEISYTIKVLEISCLGFLTEPPCILNDDKELAFLSSNYRTENGVGTGTNSLILWSRETHTNQNGMSKIITVKEFSEQINRSVEDILSITTTKSMEDVLFIFFKTHD+EIDILHFNCHTGLVIQFMELFDVLPKQMDHKELFLSNNGCYVFYQKTSAIVNLSSGEFIGNISSDANNEYAFQCFVLKDTILILSQKTKLLAYRLPEICKIGQIELKDEVSCVSKCLDDFTIMVGCVDGSVLSYSLIDIFSPYSFLSQIKVVRNFLPTTRSPTIELE IRSLNKTELSQEFDNLIAIKRPISEPIVAHERREFSNIY
Sbjct:    1 MESFQDLLIKTSLPFTAASLPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILWRDDTGVSEAHHQIYIEQFEAFITAKVVEGVAERAKKINLNLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFVTSNCTIAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSFQQQSNKKFIIILHDFEKCSEVGSQSLVTDLIPKFLPKNLKLIVSSTDSFDTRKPYFLNVLVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNHNFINNSMEEIPCQTLGEFYALNLNRWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLVDLATTVSVESLIDEKNSHLKDFHQILAGYFNGAWVDQTISFHFDLKNPEMSYNCCPKSQKMYAKKSGNIFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNGGKEIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENCDKVAPKHNAFVPIYPSNKLPGSPLASTINCPEAIESVLVIQNKESMNKELLIKLKNDSRAYFYDLSFGAISYNTLLSSGEVYYGPNRDIILVLETEYRQIIKVHQRETGDLLGQIIPMNWVVLRPFEERNEYRITNIDMNQTRMALIITNEVSYLFVLNLETLEPILAFNPGLRLEMLKLTPDESTVFTHHVERLVSLNVEKNQLNSAVELQGIPLQMLFANEKSKKAFIVCDQQKSVVVLDLESAGVVRKCYKISFENCLDENDYVLEVSCSEIGNPFLLIMSCHSVILYDWNKEKVLNHITRPSQLPVYFKLPNRLDNQPASLKFNAAKLILSDRVIICALFRDVIVCTVSDNKIIKTLHAPVGGIVSEIHIADDYIIGKVEQSQNSAEVMIWKTDPKCLFFKIENNQDKLTRCVKKLQIGGSVAIASCVESDEMGVIEISTGTLVDLYSHSSVVINCCLSSCGKWALVTVKNSHNANILWSLETRKIIFEFGSSTNTEFIVPMKSKSGFFCITNHSKSIDAPNFIVTQILCDLGVEISYTIKVLEISCLGFLTEPPCILNDDKELAFLSSNYRTENGVGTGTNSLILWSRETHTNQNGMSKIITVKEFSEQINRSVEDILSITTTKSMEDVLFIFFKTHDYEIDILHFNCHTGLVIQFMELFDVLPKQMDHKELFLSNNGCYVFYQKTSAIVNLSSGEFIGNISSDANNEYAFQCFVLKDTILILSQKTKLLAYRLPEICKIGQIELKDEVSCVSKCLDDFTIMVGCVDGSVLSYSLIDIFSPYSFLSQIKVVRNFLPTTRSPTIELEPIRSLNKTELSQEFDNLIAIKRPISEPIVAHERREFSNIY 1751          
BLAST of AAA domain-containing protein vs. Planmine SMEST
Match: SMESG000074035.1 (SMESG000074035.1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.943e-18
Identity = 163/764 (21.34%), Postives = 317/764 (41.49%), Query Frame = 1
Query:   25 NLLIKTSLPFTAASLPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNC-PIF--LLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQ--QEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILWRDDTGVSE--AHHQIYIDQFEAFITAKV----------VEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDDTNVPIILYGPPNSGKSIVFAR--TIFE---FQSSLPHDSECH-------------FITRFVTSN---CTIAEIFLSIFLQISAIILRNNQFE--TILKNSKEIENNIPRDIEGILLSFQQQSNKKFIIILHDFEKC---SEVGSQSLVT--DLIPKFLPKNLKLIVS-STDSFDTRKPYFLNVLVPEFTQT----------EFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLGEFYALNLN--RWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELS 2142
            N ++   + FT   +     +  F+ S+F DF++ER +   ++ P L   C +++G+ ++L D++ G+  Y       + +    L +  +C K +  P F  L+G +YG    P  +P+  F+++ + + ++   F  E   + +++  DVN   P   L+ I+   P  Y    + II  +   EW K +  +    +   KI +S G    E   K+  +  E  F   +    D  F  VI  ++      +    N   ++ +     K ID     N +++     Q++L ++ NS  ++      KF + W  + G+++    H+ Y+D     +   +          +E  + R   + L L +  +  +            F  +G     +   +L  L D + + PII++G    GK+   A+  T+ +   F ++  + SE +              + RF+ ++    ++ ++  S+  QI        +F   T L + K + N + + I     S+QQ      III    ++    S   ++SL    D IP  LP  + +I+S  T++F+++        + EF             E  +  Q+ L +  + LT+ Q    +S  +    G+     +      ++  Y SMEE   +   E  A+N       +++G  L+SH L Y+     GLT+ E+ ++L+L   V+NEVY  H   +     I++ P  +   I  +LS
Sbjct:   36 NKILSGCINFTDIGVSPPREVRIFLSSTFSDFKVERNLFIKQVIPSLHSIC-NDYGLSLRLCDMRWGVTDYAVNEHLVESLC---LKEIKMCQKTSIGPFFVLLIGNRYGYQPLPSELPSSEFEMIFKIITDN---FPKEAELISKWFQKDVNSEPPVYNLLPIKTFIPK-YGDYEDEIIRRESGHEWWKVEENIRRCLKKSFKIAISQGLFTNEQKRKLIKSVTETEFWTAV---MDDNF--VINKQKASRCLAYERQINGLMNNLQSECAIKYIDYVTRDN-EIICESSAQNLLLEFKNSIKKVELRHFRKFNVPWVSN-GITDLLISHKNYLDDLSTTVICDIKALIVEHMSAIEKHSGRFNNLKLHLQSEVIHHWQFCWQ-----RCFNFYG---RKVQQEILFNLIDRNYDKPIIVHGDSGCGKTAFLAKVSTVIQEKFFNTTGENKSETNENSNGFQLNQTPVIVLRFIGTSMYSSSLHQLLFSVCFQIQLAYKLKVKFRKMTSLSSLKWLFNYLIQQISH--YSYQQSP---LIIIFDSIDQLFMFSNTLNESLSNSLDWIPVPLPPGIHIIISLITENFESKCFQMFQNRLSEFQHKFIHINYFDDKEVVLICQSLLEHKKRTLTDLQMNLIISKLINNPRGLYIKLALEQAVTWKS--YMSMEECIIKDCVE-SAVNFKFACLEEKYGLLLMSHALGYLTLGYNGLTEIELEDLLSLQDNVLNEVYQYHDPPI---SGIIRLPSLMCSRIHSDLS 765          
BLAST of AAA domain-containing protein vs. Planmine SMEST
Match: SMESG000074035.1 (SMESG000074035.1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.822e-18
Identity = 189/904 (20.91%), Postives = 363/904 (40.15%), Query Frame = 1
Query:   25 NLLIKTSLPFTAASLPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNC-PIF--LLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQ--QEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILWRDDTGVSE--AHHQIYIDQFEAFITAKV----------VEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDDTNVPIILYGPPNSGKSIVFAR--TIFE---FQSSLPHDSECH-------------FITRFVTSN---CTIAEIFLSIFLQISAIILRNNQFE--TILKNSKEIENNIPRDIEGILLSFQQQSNKKFIIILHDFEKC---SEVGSQSLVT--DLIPKFLPKNLKLIVS-STDSFDTRKPYFLNVLVPEFTQT----------EFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLGEFYALNLN--RWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLV----------DLATTVSVESLIDDKNSHLKDFHQILAGYFNGAWVDQTISFHFDLKNPEMSYNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELL 2532
            N ++   + FT   +     +  F+ S+F DF++ER +   ++ P L   C +++G+ ++L D++ G+  Y       + +    L +  +C K +  P F  L+G +YG    P  +P+  F+++ + + ++   F  E   + +++  DVN   P   L+ I+   P  Y    + II  +   EW K +  +    +   KI +S G    E   K+  +  E  F   +    D  F  VI  ++      +    N   ++ +     K ID     N +++     Q++L ++ NS  ++      KF + W  + G+++    H+ Y+D     +   +          +E  + R   + L L +  +  +            F  +G     +   +L  L D + + PII++G    GK+   A+  T+ +   F ++  + SE +              + RF+ ++    ++ ++  S+  QI        +F   T L + K + N + + I     S+QQ      III    ++    S   ++SL    D IP  LP  + +I+S  T++F+++        + EF             E  +  Q+ L +  + LT+ Q    +S  +    G+     +      ++  Y SMEE   +   E  A+N       +++G  L+SH L Y+     GLT+ E+ ++L+L   V+NEVY  H   +     I++ P  +   I  +LS  ++    D  + +           L   V    +++  +  + D++ I  G        Q      ++KN +   N  P ++K             RK   L  HLV      EL K    +  +L +  K   V EL+
Sbjct:   36 NKILSGCINFTDIGVSPPREVRIFLSSTFSDFKVERNLFIKQVIPSLHSIC-NDYGLSLRLCDMRWGVTDYAVNEHLVESL---CLKEIKMCQKTSIGPFFVLLIGNRYGYQPLPSELPSSEFEMIFKIITDN---FPKEAELISKWFQKDVNSEPPVYNLLPIKTFIPK-YGDYEDEIIRRESGHEWWKVEENIRRCLKKSFKIAISQGLFTNEQKRKLIKSVTETEFWTAV---MDDNF--VINKQKASRCLAYERQINGLMNNLQSECAIKYIDYVTRDN-EIICESSAQNLLLEFKNSIKKVELRHFRKFNVPWVSN-GITDLLISHKNYLDDLSTTVICDIKALIVEHMSAIEKHSGRFNNLKLHLQSEVIHHWQFCWQ-----RCFNFYG---RKVQQEILFNLIDRNYDKPIIVHGDSGCGKTAFLAKVSTVIQEKFFNTTGENKSETNENSNGFQLNQTPVIVLRFIGTSMYSSSLHQLLFSVCFQIQLAYKLKVKFRKMTSLSSLKWLFNYLIQQISH--YSYQQSP---LIIIFDSIDQLFMFSNTLNESLSNSLDWIPVPLPPGIHIIISLITENFESKCFQMFQNRLSEFQHKFIHINYFDDKEVVLICQSLLEHKKRTLTDLQMNLIISKLINNPRGLYIKLALEQAVTWKS--YMSMEECIIKDCVE-SAVNFKFACLEEKYGLLLMSHALGYLTLGYNGLTEIELEDLLSLQDNVLNEVYQYHDPPI---SGIIRLPSLMCSRIHSDLSEYIIKKQTDDKVTLYWYHKQIHQCALKRYVKDLEILEILHKEMADYYAI-CGNIEKTCFLQNHKRKLEIKNADRLINNPPINEK-----------EPRKLHALSFHLVESRQNYELSKLCTANLKFLLSYAKCFGVQELI 893          
BLAST of AAA domain-containing protein vs. Planmine SMEST
Match: SMESG000074035.1 (SMESG000074035.1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.997e-18
Identity = 189/904 (20.91%), Postives = 363/904 (40.15%), Query Frame = 1
Query:   25 NLLIKTSLPFTAASLPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNC-PIF--LLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQ--QEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILWRDDTGVSE--AHHQIYIDQFEAFITAKV----------VEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDDTNVPIILYGPPNSGKSIVFAR--TIFE---FQSSLPHDSECH-------------FITRFVTSN---CTIAEIFLSIFLQISAIILRNNQFE--TILKNSKEIENNIPRDIEGILLSFQQQSNKKFIIILHDFEKC---SEVGSQSLVT--DLIPKFLPKNLKLIVS-STDSFDTRKPYFLNVLVPEFTQT----------EFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLGEFYALNLN--RWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELSVILVDVIKDGYLLV----------DLATTVSVESLIDDKNSHLKDFHQILAGYFNGAWVDQTISFHFDLKNPEMSYNCCPKSQKMYAKKSGNVFYNYRKFRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELL 2532
            N ++   + FT   +     +  F+ S+F DF++ER +   ++ P L   C +++G+ ++L D++ G+  Y       + +    L +  +C K +  P F  L+G +YG    P  +P+  F+++ + + ++   F  E   + +++  DVN   P   L+ I+   P  Y    + II  +   EW K +  +    +   KI +S G    E   K+  +  E  F   +    D  F  VI  ++      +    N   ++ +     K ID     N +++     Q++L ++ NS  ++      KF + W  + G+++    H+ Y+D     +   +          +E  + R   + L L +  +  +            F  +G     +   +L  L D + + PII++G    GK+   A+  T+ +   F ++  + SE +              + RF+ ++    ++ ++  S+  QI        +F   T L + K + N + + I     S+QQ      III    ++    S   ++SL    D IP  LP  + +I+S  T++F+++        + EF             E  +  Q+ L +  + LT+ Q    +S  +    G+     +      ++  Y SMEE   +   E  A+N       +++G  L+SH L Y+     GLT+ E+ ++L+L   V+NEVY  H   +     I++ P  +   I  +LS  ++    D  + +           L   V    +++  +  + D++ I  G        Q      ++KN +   N  P ++K             RK   L  HLV      EL K    +  +L +  K   V EL+
Sbjct:   36 NKILSGCINFTDIGVSPPREVRIFLSSTFSDFKVERNLFIKQVIPSLHSIC-NDYGLSLRLCDMRWGVTDYAVNEHLVESLC---LKEIKMCQKTSIGPFFVLLIGNRYGYQPLPSELPSSEFEMIFKIITDN---FPKEAELISKWFQKDVNSEPPVYNLLPIKTFIPK-YGDYEDEIIRRESGHEWWKVEENIRRCLKKSFKIAISQGLFTNEQKRKLIKSVTETEFWTAV---MDDNF--VINKQKASRCLAYERQINGLMNNLQSECAIKYIDYVTRDN-EIICESSAQNLLLEFKNSIKKVELRHFRKFNVPWVSN-GITDLLISHKNYLDDLSTTVICDIKALIVEHMSAIEKHSGRFNNLKLHLQSEVIHHWQFCWQ-----RCFNFYG---RKVQQEILFNLIDRNYDKPIIVHGDSGCGKTAFLAKVSTVIQEKFFNTTGENKSETNENSNGFQLNQTPVIVLRFIGTSMYSSSLHQLLFSVCFQIQLAYKLKVKFRKMTSLSSLKWLFNYLIQQISH--YSYQQSP---LIIIFDSIDQLFMFSNTLNESLSNSLDWIPVPLPPGIHIIISLITENFESKCFQMFQNRLSEFQHKFIHINYFDDKEVVLICQSLLEHKKRTLTDLQMNLIISKLINNPRGLYIKLALEQAVTWKS--YMSMEECIIKDCVE-SAVNFKFACLEEKYGLLLMSHALGYLTLGYNGLTEIELEDLLSLQDNVLNEVYQYHDPPI---SGIIRLPSLMCSRIHSDLSEYIIKKQTDDKVTLYWYHKQIHQCALKRYVKDLEILEILHKEMADYYAI-CGNIEKTCFLQNHKRKLEIKNADRLINNPPINEK-----------EPRKLHALSFHLVESRQNYELSKLCTANLKFLLSYAKCFGVQELI 893          
BLAST of AAA domain-containing protein vs. Planmine SMEST
Match: SMESG000074035.1 (SMESG000074035.1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.998e-18
Identity = 163/764 (21.34%), Postives = 317/764 (41.49%), Query Frame = 1
Query:   25 NLLIKTSLPFTAASLPERNVINFFVCSSFEDFEIERKILNNRIFPKLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKYNC-PIF--LLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYYVLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQ--QEWKKTKSILSNLFQNLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREIIDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYYNSCNEIYEASEPKFRILWRDDTGVSE--AHHQIYIDQFEAFITAKV----------VEGVAERAKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTDDDTNVPIILYGPPNSGKSIVFAR--TIFE---FQSSLPHDSECH-------------FITRFVTSN---CTIAEIFLSIFLQISAIILRNNQFE--TILKNSKEIENNIPRDIEGILLSFQQQSNKKFIIILHDFEKC---SEVGSQSLVT--DLIPKFLPKNLKLIVS-STDSFDTRKPYFLNVLVPEFTQT----------EFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGILTASVIVDYFYNQNFIYNSMEEIPCQTLGEFYALNLN--RWYKRFGKTLISHCLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPLSLWLLIKQELS 2142
            N ++   + FT   +     +  F+ S+F DF++ER +   ++ P L   C +++G+ ++L D++ G+  Y       + +    L +  +C K +  P F  L+G +YG    P  +P+  F+++ + + ++   F  E   + +++  DVN   P   L+ I+   P  Y    + II  +   EW K +  +    +   KI +S G    E   K+  +  E  F   +    D  F  VI  ++      +    N   ++ +     K ID     N +++     Q++L ++ NS  ++      KF + W  + G+++    H+ Y+D     +   +          +E  + R   + L L +  +  +            F  +G     +   +L  L D + + PII++G    GK+   A+  T+ +   F ++  + SE +              + RF+ ++    ++ ++  S+  QI        +F   T L + K + N + + I     S+QQ      III    ++    S   ++SL    D IP  LP  + +I+S  T++F+++        + EF             E  +  Q+ L +  + LT+ Q    +S  +    G+     +      ++  Y SMEE   +   E  A+N       +++G  L+SH L Y+     GLT+ E+ ++L+L   V+NEVY  H   +     I++ P  +   I  +LS
Sbjct:   36 NKILSGCINFTDIGVSPPREVRIFLSSTFSDFKVERNLFIKQVIPSLHSIC-NDYGLSLRLCDMRWGVTDYAVNEHLVESLC---LKEIKMCQKTSIGPFFVLLIGNRYGYQPLPSELPSSEFEMIFKIITDN---FPKEAELISKWFQKDVNSEPPVYNLLPIKTFIPK-YGDYEDEIIRRESGHEWWKVEENIRRCLKKSFKIAISQGLFTNEQKRKLIKSVTETEFWTAV---MDDNF--VINKQKASRCLAYERQINGLMNNLQSECAIKYIDYVTRDN-EIICESSAQNLLLEFKNSIKKVELRHFRKFNVPWVSN-GITDLLISHKNYLDDLSTTVICDIKALIVEHMSAIEKHSGRFNNLKLHLQSEVIHHWQFCWQ-----RCFNFYG---RKVQQEILFNLIDRNYDKPIIVHGDSGCGKTAFLAKVSTVIQEKFFNTTGENKSETNENSNGFQLNQTPVIVLRFIGTSMYSSSLHQLLFSVCFQIQLAYKLKVKFRKMTSLSSLKWLFNYLIQQISH--YSYQQSP---LIIIFDSIDQLFMFSNTLNESLSNSLDWIPVPLPPGIHIIISLITENFESKCFQMFQNRLSEFQHKFIHINYFDDKEVVLICQSLLEHKKRTLTDLQMNLIISKLINNPRGLYIKLALEQAVTWKS--YMSMEECIIKDCVE-SAVNFKFACLEEKYGLLLMSHALGYLTLGYNGLTEIELEDLLSLQDNVLNEVYQYHDPPI---SGIIRLPSLMCSRIHSDLS 765          
The following BLAST results are available for this feature:
BLAST of AAA domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NWD22.557e-3421.61NACHT and WD repeat domain containing 2 [Source:HG... [more]
NWD12.429e-1723.67NACHT and WD repeat domain containing 1 [Source:HG... [more]
NWD12.629e-1723.67NACHT and WD repeat domain containing 1 [Source:HG... [more]
NWD12.629e-1723.67NACHT and WD repeat domain containing 1 [Source:HG... [more]
NWD12.629e-1723.67NACHT and WD repeat domain containing 1 [Source:HG... [more]
back to top
BLAST of AAA domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
T05C3.23.226e-5123.09pep chromosome:WBcel235:V:5493747:5503010:1 gene:W... [more]
qui-11.391e-621.84QUInine non-avoider [Source:UniProtKB/TrEMBL;Acc:... [more]
qui-11.993e-621.84QUInine non-avoider [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of AAA domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG101851.838e-3523.17gene:FBgn0038397 transcript:FBtr0083235[more]
back to top
BLAST of AAA domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nwd14.259e-3623.63NACHT and WD repeat domain containing 1 [Source:ZF... [more]
nwd22.238e-1724.80NACHT and WD repeat domain containing 2 [Source:ZF... [more]
CU570791.33.164e-923.04NACHT and WD repeat domain-containing protein 2-li... [more]
back to top
BLAST of AAA domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hsp90ab17.188e-3221.45heat shock protein 90kDa alpha family class B memb... [more]
ppp1r3c.11.286e-2021.89protein phosphatase 1, regulatory (inhibitor) subu... [more]
ENSXETT00000003639.13.655e-923.77uncharacterized LOC101730828 [Source:NCBI gene;Acc... [more]
ENSXETT00000022477.11.505e-620.77pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
back to top
BLAST of AAA domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Nwd24.271e-3722.90NACHT and WD repeat domain containing 2 [Source:MG... [more]
Nwd11.307e-1623.81NACHT and WD repeat domain containing 1 [Source:MG... [more]
Nwd11.341e-1624.34NACHT and WD repeat domain containing 1 [Source:MG... [more]
Nwd11.398e-1623.81NACHT and WD repeat domain containing 1 [Source:MG... [more]
back to top
BLAST of AAA domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q6P5U7|NWD2_MOUSE2.988e-3622.90NACHT and WD repeat domain-containing protein 2 OS... [more]
sp|Q9ULI1|NWD2_HUMAN1.228e-3321.61NACHT and WD repeat domain-containing protein 2 OS... [more]
sp|Q149M9|NWD1_HUMAN1.394e-1623.67NACHT domain- and WD repeat-containing protein 1 O... [more]
sp|A6H603|NWD1_MOUSE9.377e-1624.34NACHT domain- and WD repeat-containing protein 1 O... [more]
back to top
BLAST of AAA domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EA390.000e+029.01Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FKI00.000e+028.87Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G6I10.000e+028.87Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JLX65.433e-17926.72Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3JCC01.142e-12724.25NACHT and WD repeat domain-containing protein 2 OS... [more]
back to top
BLAST of AAA domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nwd11.722e-3522.23NACHT and WD repeat domain containing 1 [Source:ZF... [more]
nwd15.705e-2322.99NACHT and WD repeat domain containing 1 [Source:ZF... [more]
nwd21.334e-1624.92NACHT and WD repeat domain containing 2 [Source:NC... [more]
nwd21.446e-1624.92NACHT and WD repeat domain containing 2 [Source:NC... [more]
nwd21.521e-1624.92NACHT and WD repeat domain containing 2 [Source:NC... [more]
back to top
BLAST of AAA domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AAA domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AAA domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO311173.991e-3821.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372614.423e-1520.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405178.329e-1121.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349941.198e-922.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471081.425e-922.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of AAA domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nwd26.358e-2022.51NACHT and WD repeat domain containing 2 [Source:NC... [more]
nwd26.358e-2022.51NACHT and WD repeat domain containing 2 [Source:NC... [more]
nwd27.525e-2022.41NACHT and WD repeat domain containing 2 [Source:NC... [more]
nwd11.849e-1720.95NACHT and WD repeat domain containing 1 [Source:ZF... [more]
back to top
BLAST of AAA domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012845.10.000e+099.26SMESG000012845.1[more]
SMESG000074035.11.943e-1821.34SMESG000074035.1[more]
SMESG000074035.13.822e-1820.91SMESG000074035.1[more]
SMESG000074035.13.997e-1820.91SMESG000074035.1[more]
SMESG000074035.13.998e-1821.34SMESG000074035.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003935 ID=SMED30003935|Name=AAA domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=5304bp
TAGAATTTCATGGAAAGTTTTCAGAATTTACTCATCAAAACCAGTTTGCC
TTTTACCGCCGCCAGTTTACCAGAAAGAAATGTCATCAATTTTTTTGTCT
GCTCATCTTTTGAAGATTTTGAAATCGAAAGAAAAATCTTGAACAATCGA
ATATTTCCAAAACTTCAGGAGCAGTGTTTTGATGAGTTTGGAATTGAAAT
TAAGTTGATAGACATTAAATTGGGTTTGGATTCGTACCTTGAGACCACTG
CGGCTTACCAGCAAATCTTCTACGAATATCTCAATAAACATGGAATTTGC
GATAAATATAACTGCCCAATTTTTTTACTTGGCCAAAAATACGGAAATGT
TCTGCCTCCCCTTCGGATACCAACAAAAATTTTCAAACTCCTTTTAGAAA
CATTGAAAAATCATAAGAAACGGTTCGCTGTTGAGGGAAATTTTCTGGAG
CAATATTATGTCTTGGATGTAAATTGTGTTGAACCAGAAATGATTCTGGT
TGACATTCAAGCTATTTATCCTGATTTATATAAACAAGATAGAAATTCTA
TAATTATTTGTCAACAAGAATGGAAAAAGACTAAATCTATTTTATCAAAT
TTGTTTCAAAATCTGTCAAAGATCTGCTTGTCTAATGGTACCCTCGATGT
TGAAATGGTCACAAAAATCTTTGTGAATGAATTCGAAGCGACCTTTTCAG
AAACAATAAGGAAAAGTTTTGACTCCAAGTTTTCTCCTGTAATTTTCAAT
CGTGAAATTATTGATATAAAGAATTTCATCGTGATTTCCAACCAAAAGAA
AGATGATAAACGAAAATCTGCCATTGAAAAGCTGATTGATGTAACCTACA
GTCAGAACGCGGATTTAGTAATAAATGAAGATTTACAAAGCGTTTTGAGG
CAATACTATAATTCTTGCAACGAAATCTATGAAGCTAGTGAACCGAAATT
TAGAATCCTCTGGAGAGATGACACTGGGGTCTCTGAAGCACATCATCAAA
TATATATTGATCAATTTGAAGCCTTTATCACCGCCAAAGTCGTTGAAGGA
GTTGCTGAAAGAGCAAAGAAAATCAATTTAGACTTGTCCGCGAGTTTCTT
AAAATGTTATGACATAATTTGCAATGCAGATCTGCAAATAAATAAATTTG
CAAAGTTTGGTTGCGGGTATGAGGACATAGTTTACGCGATGTTGGATTAC
TTAACCGATGACGATACCAATGTCCCAATTATTTTATACGGTCCCCCTAA
TTCTGGAAAGTCAATAGTATTTGCTCGAACGATATTTGAGTTCCAAAGCT
CCCTACCACATGACTCTGAATGCCATTTTATCACTCGGTTTGTCACATCA
AATTGTACAATTGCTGAAATTTTCTTGAGTATATTTTTACAAATTAGCGC
AATTATTTTGAGAAATAATCAGTTTGAAACGATTTTAAAAAATTCCAAAG
AAATCGAAAACAACATTCCGAGAGACATTGAAGGAATCCTGCTCAGTTTC
CAACAGCAGTCGAATAAGAAATTCATCATCATTCTCCATGATTTCGAAAA
GTGCTCTGAGGTCGGTTCTCAGTCGCTTGTCACAGATTTGATTCCGAAGT
TCCTACCGAAAAACCTGAAACTTATTGTGAGTAGTACCGATAGCTTTGAC
ACCCGGAAACCGTATTTCCTTAATGTTCTCGTGCCGGAATTTACTCAGAC
TGAGTTTAATATTTTTATTCAAACTCAACTAAACAACACTGGAAAACTTT
TAACCGAAGAACAAAACGAAAGGTTTTTATCAAATTATCTAAAATTTACA
GATGGAATTCTCACTGCATCAGTCATTGTTGACTATTTTTATAATCAGAA
CTTTATATACAATTCTATGGAGGAAATACCCTGTCAAACTCTCGGAGAGT
TTTATGCTCTCAATCTCAACAGATGGTACAAAAGGTTTGGAAAGACACTG
ATTTCCCATTGTCTTCTTTACATATATTGTTCATCCGGAGGCTTGACGGA
TCAGGAAGTCATTGAAGTTCTGAATTTAGATAAAAAAGTCATGAATGAGG
TTTATATCAATCACTCAGAATCCCTCATTTATGATCAAAGTATTGTCAAA
TTTCCTTTGTCTTTATGGTTGTTAATTAAGCAGGAATTGTCAGTCATATT
GGTGGATGTGATTAAAGATGGATATTTACTAGTAGATTTGGCTACAACGG
TTTCTGTAGAGTCTTTAATTGATGATAAAAACAGCCATTTAAAGGATTTC
CATCAAATTCTGGCCGGTTACTTTAACGGAGCATGGGTAGATCAAACCAT
TTCTTTTCATTTTGATCTGAAAAACCCAGAAATGTCATACAACTGCTGTC
CGAAAAGTCAGAAAATGTACGCTAAAAAGAGTGGAAATGTATTTTATAAC
TACCGAAAATTTCGACAACTCGTTCGGCATTTGGTGGCAATTGATAATTA
TGATGAGTTGATAAAGAATGTCATTTTTGATTTTGATTATTTGTACAATA
AAACAAAAGCTCTCAAAGTTTCGGAATTGTTAGATGACTTCCAACTGGCC
CGAAACGGCGGAAAGGAAATTGTTCTGCTAGAGGAAAGCATCAACAATTC
TGCCTTAGTGATAGAGAATGATCTCGACAGTCTTGCGGGAGAATTAATTA
TGCAATTGTTACCCTACGTTTCCTATTATCCAAATCTGAGATTTCTCATA
GAAAATTGTGATAAAGTCGCTCCTAAGCACAATGCATTCGTCCCGATTTA
TCCTTCCAATAAGTTGCCAGGGTCTCCACTGGCCAGCACTATCAATTGTC
CGGAGGCTATTGAATCTGTTTTGGTGATTCAAAATAAAGAAAGCATGAAT
AAAGAGCTTTTAATTAAACTAAAAAACGATTCCAGAGCGTATTTCTATGA
TTTATCATTCGGAGCGATATCTTATAATACACTACTAAGCAGCGGGGAGG
TTTATTATGGACCAAATAGGGACATCATTCTTGTATTAGAAACCGAATAC
CGACAAATCATCAAGGTTCATCAAAGAGAAACTGGTGATTTGCTTGGTCA
AATAATACCCATGAATTGGGTGGTACTTCGACCTTTTGAGGAAAGAAATG
AATACAGAATAACTAACATTGACATGAATCAAACTAAGATGGCACTAATC
ATAACAAATGAAGTGAGTTATTTATTCGTTTTGAATTTGGAAACCCTAGA
ACCAATACTGGCCTTTAATCCAGGGTTGCGATTAGAAATGCTAAAGCTGA
CACCAGATGAGTCGACAGTTTTTACTCATCACGTTGAAAGGCTCGTGAGT
TTAAACGTGGAAAAGAACCAACTGAATTCAGCAGTTGAACTTCAAGGTAT
ACCTCTGCAAATGTTATTTGCCAATGAACAATCGAAAAAAGCTTTTATCG
TTTGTGATCAACAGAAGAGTGTTGTAGTTTTGGATCTTGAATCCGCGGGC
GTTGTGAGGAAATGTTATAAAATATCTTTTGAAAACTGTCTTGATGAAAA
TGATTATGTTTTAGAGGTTTCGTGTTCGGAAATCGGTAATCCATTTCTCT
TGATCATGTCTTGTCACAGTGTTATTTTGTATGACTGGAATAAGGAAAAG
GTGCTCAATCATATTACCCGTCCTTCACAGCTACCGGTTTATTTCAAGCT
ACCCAATCGGCTGGATAACCAACCGGCAAGTCTGAAATTCAATGCTGCCA
AACTGATTTTGTCTGACCGAGTTATTATCTGTGCGCTGTTTCGAGACGTC
ATTGTCTGCACAGTCTCTGACAATAAAATCATTAAGACTCTCCATGCACC
TGTCGGAGGCATCGTTTCTGAAATCCACATTGCCGATGATTATATCATTG
GAAAAGTGGAACAAAGTCAAAATTCGGCGGAAGTCATGATTTGGAAAACG
GATCCAAAGTGTTTGTTTTTCAAAATAGAAAACAATCAAGATAAACTGAC
AAGATGCGTTAAGAAAATACAAATCGGTGGCTCTGTAGCAATTGCTTCGT
GTGTTGAAAGTGACGAAATGGGAGTAATAGAAATATCAACCGGAACATTG
GTCGACCTTTATAGTCACTCGTCTGTGGTGATTAATTGTTGCTTGTCATC
GTGCGGAAAATGGGCTTTGGTCACGGTGAAGAATTCTCACAATGCCAATA
TTCTCTGGTCTTTGGAAACCCGAAAAATCATTTTCGAATTCGGATCATCA
ACCAACACGGAATTTATTGTTCCAATGAAATCGAAATCAGGATTTTACTG
CATTACAAACCATTCAAAAAGTATCGATGCACCGAATTTTATCGTCACTC
AAATCCTCTGTGATCTGGGTGTTGAAATATCATATACCATAAAGGTTTTA
GAAATTTCTTGTTTAGGATTCCTTACGGAACCTCCTTGCATTTTGAATGA
TGATAAAGAGTTAGCGTTTCTTTCCAGCAACTACCGCACTGAAAATGGAG
TAGGGACTGGTACAAACAGTCTGATTTTGTGGTCAAGAGAAACTCATACG
AATCAAAACGGGATGTCAAAGATAATTACGGTGAAAGAGTTTTCAGAACA
AATTAATAGGTCTGTTGAAGATATATTGTCGATCACAACTACAAAGTCAA
TGGAGGATGTTTTATTTATCTTTTTCAAGACTCATGACCATGAGATTGAT
ATTTTACATTTCAATTGTCATACAGGTCTAGTTATTCAATTCATGGAATT
GTTCGATGTCCTTCCTAAGCAAATGGACCACAAAGAATTGTTCTTGTCTA
ACAACGGTTGCTATGTGTTCTATCAAAAAACTAGCGCCATAGTCAACTTG
TCTAGTGGAGAATTTATTGGAAATATTTCTTCTGATGCTAATAATGAGTA
TGCATTTCAGTGTTTCGTTTTAAAGGATACAATTTTGATTTTGTCACAAA
AAACGAAATTACTTGCATATCGTTTGCCGGAAATCTGCAAAATCGGTCAA
ATTGAATTGAAAGACGAGGTGTCTTGCGTTTCTAAATGTCTTGATGATTT
CACAATAATGGTGGGTTGCGTTGACGGATCAGTATTATCGTATTCGCTCA
TTGATATATTTTCTCCATACAGTTTTCTCAGCCAGATTAAAGTTGTGAGA
AATTTCTTGCCGACAACCAGAAGCCCAACAATAGAACTGGAATCGATACG
GTCGCTGAACAAAACCGAATTATCCCAAGAGTTTGACAACCTTATAGCCA
TCAAGCGGCCGATATCCGAGCCCATAGTTGCTCATGAAAGACGAGAATTT
TCTAATATTTATTAATTTAAATATGGTGAAATTTTTATTATGTTAATAGA
TGAA
back to top

protein sequence of SMED30003935-orf-1

>SMED30003935-orf-1 ID=SMED30003935-orf-1|Name=SMED30003935-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1752bp
MESFQNLLIKTSLPFTAASLPERNVINFFVCSSFEDFEIERKILNNRIFP
KLQEQCFDEFGIEIKLIDIKLGLDSYLETTAAYQQIFYEYLNKHGICDKY
NCPIFLLGQKYGNVLPPLRIPTKIFKLLLETLKNHKKRFAVEGNFLEQYY
VLDVNCVEPEMILVDIQAIYPDLYKQDRNSIIICQQEWKKTKSILSNLFQ
NLSKICLSNGTLDVEMVTKIFVNEFEATFSETIRKSFDSKFSPVIFNREI
IDIKNFIVISNQKKDDKRKSAIEKLIDVTYSQNADLVINEDLQSVLRQYY
NSCNEIYEASEPKFRILWRDDTGVSEAHHQIYIDQFEAFITAKVVEGVAE
RAKKINLDLSASFLKCYDIICNADLQINKFAKFGCGYEDIVYAMLDYLTD
DDTNVPIILYGPPNSGKSIVFARTIFEFQSSLPHDSECHFITRFVTSNCT
IAEIFLSIFLQISAIILRNNQFETILKNSKEIENNIPRDIEGILLSFQQQ
SNKKFIIILHDFEKCSEVGSQSLVTDLIPKFLPKNLKLIVSSTDSFDTRK
PYFLNVLVPEFTQTEFNIFIQTQLNNTGKLLTEEQNERFLSNYLKFTDGI
LTASVIVDYFYNQNFIYNSMEEIPCQTLGEFYALNLNRWYKRFGKTLISH
CLLYIYCSSGGLTDQEVIEVLNLDKKVMNEVYINHSESLIYDQSIVKFPL
SLWLLIKQELSVILVDVIKDGYLLVDLATTVSVESLIDDKNSHLKDFHQI
LAGYFNGAWVDQTISFHFDLKNPEMSYNCCPKSQKMYAKKSGNVFYNYRK
FRQLVRHLVAIDNYDELIKNVIFDFDYLYNKTKALKVSELLDDFQLARNG
GKEIVLLEESINNSALVIENDLDSLAGELIMQLLPYVSYYPNLRFLIENC
DKVAPKHNAFVPIYPSNKLPGSPLASTINCPEAIESVLVIQNKESMNKEL
LIKLKNDSRAYFYDLSFGAISYNTLLSSGEVYYGPNRDIILVLETEYRQI
IKVHQRETGDLLGQIIPMNWVVLRPFEERNEYRITNIDMNQTKMALIITN
EVSYLFVLNLETLEPILAFNPGLRLEMLKLTPDESTVFTHHVERLVSLNV
EKNQLNSAVELQGIPLQMLFANEQSKKAFIVCDQQKSVVVLDLESAGVVR
KCYKISFENCLDENDYVLEVSCSEIGNPFLLIMSCHSVILYDWNKEKVLN
HITRPSQLPVYFKLPNRLDNQPASLKFNAAKLILSDRVIICALFRDVIVC
TVSDNKIIKTLHAPVGGIVSEIHIADDYIIGKVEQSQNSAEVMIWKTDPK
CLFFKIENNQDKLTRCVKKIQIGGSVAIASCVESDEMGVIEISTGTLVDL
YSHSSVVINCCLSSCGKWALVTVKNSHNANILWSLETRKIIFEFGSSTNT
EFIVPMKSKSGFYCITNHSKSIDAPNFIVTQILCDLGVEISYTIKVLEIS
CLGFLTEPPCILNDDKELAFLSSNYRTENGVGTGTNSLILWSRETHTNQN
GMSKIITVKEFSEQINRSVEDILSITTTKSMEDVLFIFFKTHDHEIDILH
FNCHTGLVIQFMELFDVLPKQMDHKELFLSNNGCYVFYQKTSAIVNLSSG
EFIGNISSDANNEYAFQCFVLKDTILILSQKTKLLAYRLPEICKIGQIEL
KDEVSCVSKCLDDFTIMVGCVDGSVLSYSLIDIFSPYSFLSQIKVVRNFL
PTTRSPTIELESIRSLNKTELSQEFDNLIAIKRPISEPIVAHERREFSNI
Y*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 387..551
e-value: 1.4E-7
score: 33.4
NoneNo IPR availablePANTHERPTHR19871BETA TRANSDUCIN-RELATED PROTEINcoord: 29..924
NoneNo IPR availableCDDcd18078DEXXQc_Mov10L1coord: 393..434
e-value: 0.00373817
score: 38.8891
NoneNo IPR availableSUPERFAMILYSSF69322Tricorn protease domain 2coord: 1046..1395
NoneNo IPR availableSUPERFAMILYSSF69322Tricorn protease domain 2coord: 1330..1680
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 384..609