Pyridoxal 5'-phosphate synthase subunit PdxS

Overview
NamePyridoxal 5'-phosphate synthase subunit PdxS
Smed IDSMED30003929
Length (bp)1019
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pyridoxal 5'-phosphate synthase subunit PdxS (SMED30003929) t-SNE clustered cells

Violin plots show distribution of expression levels for Pyridoxal 5'-phosphate synthase subunit PdxS (SMED30003929) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pyridoxal 5'-phosphate synthase subunit PdxS (SMED30003929) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pyridoxal 5'-phosphate synthase subunit PdxS (SMED30003929) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003929

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30003929SMESG000015015.1 Contig708GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30003929SMESG000026036.1 Contig708GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30003929SMESG000026036.1 dd_Smed_v4_1240_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003929SMESG000026036.1 dd_Smed_v4_1240_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003929SMESG000026036.1 Contig46865newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003929SMESG000026036.1 Contig38723newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003929SMESG000026036.1 Contig38723uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
intestinal phagocyteSMED30003929SMESG000026036.1 dd_Smed_v6_1240_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. UniProt/SwissProt
Match: sp|Q8WPW2|PDX1_SUBDO (Pyridoxal 5'-phosphate synthase subunit SNZERR OS=Suberites domuncula OX=55567 GN=SNZERR PE=2 SV=2)

HSP 1 Score: 390.963 bits (1003), Expect = 1.346e-135
Identity = 212/292 (72.60%), Postives = 246/292 (84.25%), Query Frame = 2
Query:   11 STVQFGTFTVKSGLAQMAKGGLIMDVTDXXXXXXXXXXXXXXVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQKMNEEELEKYAESLRVSVXXXXXXXXXXXXPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSVVQKWSLRE 886
            S  Q GT TVK+GLAQM KGG+IMDV +A QAR+AEEAGACAVMALE+VPADIRK GGVARM DP+KIKEIM  VT+PVMAK RIGHFAEAQILQ +GVD IDESEVLSPAD   H++KQ F VPFVCGAR LGEALRRI EGAAMIRTKGEAGTG+V+EAVRHA+ I + I   Q ++  EL  YA+ L V ++LL+KT +L +LPVVNFAAGGLATPADV+LLMQLGV+GVFVGSGIFKS NP+KRA+AMVQAVTHY D  +LA +SEDLG+ MVG+NC+ + +KW+ RE
Sbjct:   10 SETQTGTMTVKTGLAQMLKGGIIMDVINADQARVAEEAGACAVMALEKVPADIRKDGGVARMADPRKIKEIMDTVTVPVMAKCRIGHFAEAQILQNLGVDFIDESEVLSPADDENHVDKQPFNVPFVCGARSLGEALRRISEGAAMIRTKGEAGTGNVVEAVRHARQINREIRVAQCLSSAELYGYAKQLGVPLDLLQKTAKLGRLPVVNFAAGGLATPADVSLLMQLGVDGVFVGSGIFKSGNPEKRAKAMVQAVTHYNDPKVLADVSEDLGDPMVGLNCEHLSEKWAQRE 301          
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. UniProt/SwissProt
Match: sp|Q54J47|PDX1_DICDI (Probable pyridoxal 5'-phosphate synthase subunit pdx1 OS=Dictyostelium discoideum OX=44689 GN=pdx1 PE=1 SV=1)

HSP 1 Score: 361.303 bits (926), Expect = 5.194e-124
Identity = 197/296 (66.55%), Postives = 239/296 (80.74%), Query Frame = 2
Query:   11 STVQFGTFTVKSGLAQMAKGGLIMDVTDXXXXXXXXXXXXXXVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQKMNEEELEKYAESLRVSVXXXXXXXXXXXXPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSV----VQKWSLRE 886
            +T     F +KS LAQM KGG+IMDV    QAR+AEEAGACAVMALE++PADIR +GGVARM+DP  IKEIM AVTIPVMAK RIGHF EAQILQ IGVD IDESEVL+ AD   HI+K EF VPFVCG R+LGEALRRI EGAAMIRTKGEAGTGDV+EAVRHA+++ + I  +Q M+  EL  YA+ ++  +EL+K+ K L +LPVVNFAAGG+ATPAD A++MQLG++GVFVGSGIFKS +P KRA+A+VQAVTH+ +  ++AK+SE+LGEAMVGIN D++     Q WS +E
Sbjct:    9 ATNNNSPFRIKSSLAQMLKGGVIMDVVTPEQARIAEEAGACAVMALEKIPADIRHFGGVARMSDPGMIKEIMNAVTIPVMAKVRIGHFVEAQILQEIGVDYIDESEVLTIADNENHIDKSEFKVPFVCGCRNLGEALRRISEGAAMIRTKGEAGTGDVVEAVRHARAVNKEIKKIQNMDPHELYTYAKEIQAPLELVKEVKRLGRLPVVNFAAGGVATPADAAMMMQLGMDGVFVGSGIFKSGDPAKRAKAIVQAVTHFNNPQIVAKVSENLGEAMVGINVDTLKDKENQNWSTKE 304          
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. UniProt/SwissProt
Match: sp|A9B891|PDXS_HERA2 (Pyridoxal 5'-phosphate synthase subunit PdxS OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95) OX=316274 GN=pdxS PE=3 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 2.533e-123
Identity = 196/278 (70.50%), Postives = 234/278 (84.17%), Query Frame = 2
Query:   29 TFTVKSGLAQMAKGGLIMDVTDXXXXXXXXXXXXXXVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQKMNEEELEKYAESLRVSVXXXXXXXXXXXXPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSV 862
            TFT K GLAQM KGG+IMDV    QA++AEEAGA AVMALERVPADIRK GGVARM+DP+ I+ I++AVTIPVMAK+RIGHF EAQIL+AIGVD IDESEVL+PAD   H NK  F VPFVCGAR+LGEALRRI EGAAMIRTKGEAGTG+V+EAVRHA+++   I  LQ ++ +EL   A++L+   EL+K+  EL +LPVVNFAAGG+ATPAD AL+MQLGV+GVFVGSGIFKS NP KRA+A+V+A TH++DA LLA+IS +LGEAMVGIN D++
Sbjct:    5 TFTTKVGLAQMLKGGVIMDVVTPDQAKIAEEAGAVAVMALERVPADIRKDGGVARMSDPEMIQGIIEAVTIPVMAKSRIGHFVEAQILEAIGVDYIDESEVLTPADEEHHTNKHNFKVPFVCGARNLGEALRRITEGAAMIRTKGEAGTGNVVEAVRHARTMFAEIRRLQTLDPDELFVAAKNLQAPYELVKQIAELGRLPVVNFAAGGIATPADAALMMQLGVDGVFVGSGIFKSGNPAKRAKAIVEATTHFRDAKLLAEISRNLGEAMVGINIDTI 282          
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. UniProt/SwissProt
Match: sp|B8G663|PDXS_CHLAD (Pyridoxal 5'-phosphate synthase subunit PdxS OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) OX=326427 GN=pdxS PE=3 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 2.794e-123
Identity = 193/278 (69.42%), Postives = 227/278 (81.65%), Query Frame = 2
Query:   29 TFTVKSGLAQMAKGGLIMDVTDXXXXXXXXXXXXXXVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQKMNEEELEKYAESLRVSVXXXXXXXXXXXXPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSV 862
            T+T K GLAQM KGG+IMDV    QAR+AEEAGA AVMALERVPADIR  GGVARM+DP+ I  I +AVTIPVMAKARIGHF EAQ+L+AIGVD IDESEVL+PAD   HINK +F VPFVCG R+LGEALRRI EGAAM+RTKGEAGTG+V+EAVRHA+++   I  LQ MNE+EL  YA+ ++   EL+K+     KLPVVNFAAGG+ATPAD ALLMQLGV+G+FVGSGIFKS NP KRA A+V+A THY D  ++A++S+ LGEAMVGIN D +
Sbjct:    5 TWTTKVGLAQMLKGGVIMDVVTPEQARIAEEAGAVAVMALERVPADIRAQGGVARMSDPELILAIKQAVTIPVMAKARIGHFVEAQVLEAIGVDYIDESEVLTPADEEHHINKHKFRVPFVCGCRNLGEALRRIAEGAAMLRTKGEAGTGNVVEAVRHARAVYSEIRRLQSMNEDELFTYAKQIQAPYELVKQVATEGKLPVVNFAAGGIATPADAALLMQLGVDGIFVGSGIFKSGNPIKRARAIVEATTHYNDPEIIAEVSKGLGEAMVGINIDQI 282          
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. UniProt/SwissProt
Match: sp|B9LIK3|PDXS_CHLSY (Pyridoxal 5'-phosphate synthase subunit PdxS OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) OX=480224 GN=pdxS PE=3 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 3.334e-122
Identity = 191/278 (68.71%), Postives = 227/278 (81.65%), Query Frame = 2
Query:   29 TFTVKSGLAQMAKGGLIMDVTDXXXXXXXXXXXXXXVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQKMNEEELEKYAESLRVSVXXXXXXXXXXXXPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSV 862
            T+T K GLAQM KGG+IMDV    QAR+AEEAGA AVMALERVPADIR  GGVARM+DP+ I  I +AVTIPVMAKARIGHF EAQ+L+AIGVD IDESEVL+PAD   HINK +F VPFVCG R+LGEALRR+ EGAAM+RTKGEAGTG+V+EAVRHA+++   I  LQ MNE+EL  YA+ ++   EL+K+     KLPVVNFAAGG+ATPAD ALLMQLGV+G+FVGSGIFKS +P KRA A+V+A THY D  ++A++S+ LGEAMVGIN D +
Sbjct:    5 TWTTKVGLAQMLKGGVIMDVVTPEQARIAEEAGAVAVMALERVPADIRAQGGVARMSDPELILAIKQAVTIPVMAKARIGHFVEAQVLEAIGVDYIDESEVLTPADEEHHINKHKFRVPFVCGCRNLGEALRRVAEGAAMLRTKGEAGTGNVVEAVRHARAVYSEIRRLQSMNEDELFTYAKQIQAPYELVKQVATEGKLPVVNFAAGGIATPADAALLMQLGVDGIFVGSGIFKSGDPVKRARAIVEATTHYNDPEIIAEVSKGLGEAMVGINIDQI 282          
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. TrEMBL
Match: X2ATT4 (SOR_SNZ domain-containing protein OS=Capitella teleta OX=283909 PE=3 SV=1)

HSP 1 Score: 426.017 bits (1094), Expect = 7.370e-147
Identity = 226/287 (78.75%), Postives = 262/287 (91.29%), Query Frame = 2
Query:   26 GTFTVKSGLAQMAKGGLIMDVTDXXXXXXXXXXXXXXVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQKMNEEELEKYAESLRVSVXXXXXXXXXXXXPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSVVQKWSLRE 886
            G+FT+KSGLAQMAKGGL+MDVTDA QAR+AEEAGACAVMALERVPADIR+ GGVARM+DP+ IKEIM AVTIPVMAKARIGHFAEAQILQA+GVDMIDESEVL+PADP  HI+K +F +PFVCGAR+LGEALRRI EGAAMIRTKGEAGTG+V+EAVRHAK+I   I++ +KM++ +L  YA+ LRV VELLKKT ++ +LPVVNFAAGGLATPADV+L+MQLGV+GVFVGSGIFKS+ PKKRA++MVQAVTHYKD A LA+ISEDLGEAMVGINCD + QKW++RE
Sbjct:   22 GSFTLKSGLAQMAKGGLVMDVTDAQQARIAEEAGACAVMALERVPADIRRDGGVARMSDPKMIKEIMAAVTIPVMAKARIGHFAEAQILQALGVDMIDESEVLTPADPEAHIDKSQFKIPFVCGARNLGEALRRIHEGAAMIRTKGEAGTGNVLEAVRHAKTINADIMAAKKMDDTQLAVYAKELRVPVELLKKTVDMGRLPVVNFAAGGLATPADVSLMMQLGVDGVFVGSGIFKSNCPKKRADSMVQAVTHYKDPAFLAEISEDLGEAMVGINCDDIKQKWAVRE 308          
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. TrEMBL
Match: A0A267GMC6 (SOR_SNZ domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013599g2 PE=3 SV=1)

HSP 1 Score: 401.364 bits (1030), Expect = 2.622e-137
Identity = 212/293 (72.35%), Postives = 254/293 (86.69%), Query Frame = 2
Query:   23 FGTFTVKSGLAQMAKGGLIMDVTDXXXXXXXXXXXXXXVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQKMNEEELEKYAESLRVSVXXXXXXXXXXXXPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSVV--QKWSLREGKK 895
             GT+TVK+GLA+M KGGL+MDV +A QA++AEEAGACAVMALERVPADIRK GGVARMTDP+ IKEIM AVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVL+PADP  HI+K  F +PFVCG R+LGEALRRI EGAAM+RTKGEAGTG+VIEAVRHA+++ + + + + M+++EL  YA+ L+V   LLK+ K   +LPVVNFAAGGLATPADV++LMQLGV+GVFVGSGIFKS NP+KRAEAMVQAVTHY+D   LA++SEDLGEAM+GI+CD ++  Q W+ RE ++
Sbjct:    9 IGTYTVKTGLAKMTKGGLVMDVVNAEQAKIAEEAGACAVMALERVPADIRKQGGVARMTDPKLIKEIMSAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLTPADPENHIDKHSFKIPFVCGCRNLGEALRRIAEGAAMMRTKGEAGTGNVIEAVRHARALNREMRAAKVMDDDELYSYAKQLQVHHGLLKEVKRQGRLPVVNFAAGGLATPADVSMLMQLGVDGVFVGSGIFKSANPQKRAEAMVQAVTHYRDPEFLARVSEDLGEAMIGIDCDELIKGQLWAGRESQR 301          
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. TrEMBL
Match: A0A1I8HL75 (SOR_SNZ domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013599g1 PE=3 SV=1)

HSP 1 Score: 400.979 bits (1029), Expect = 3.022e-137
Identity = 212/293 (72.35%), Postives = 254/293 (86.69%), Query Frame = 2
Query:   23 FGTFTVKSGLAQMAKGGLIMDVTDXXXXXXXXXXXXXXVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQKMNEEELEKYAESLRVSVXXXXXXXXXXXXPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSVV--QKWSLREGKK 895
             GT+TVK+GLA+M KGGL+MDV +A QA++AEEAGACAVMALERVPADIRK GGVARMTDP+ IKEIM AVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVL+PADP  HI+K  F +PFVCG R+LGEALRRI EGAAM+RTKGEAGTG+VIEAVRHA+++ + + + + M+++EL  YA+ L+V   LLK+ K   +LPVVNFAAGGLATPADV++LMQLGV+GVFVGSGIFKS NP+KRAEAMVQAVTHY+D   LA++SEDLGEAM+GI+CD ++  Q W+ RE ++
Sbjct:    9 IGTYTVKTGLAKMTKGGLVMDVVNAEQAKIAEEAGACAVMALERVPADIRKQGGVARMTDPKLIKEIMSAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLTPADPENHIDKHSFKIPFVCGCRNLGEALRRIAEGAAMMRTKGEAGTGNVIEAVRHARALNREMRAAKVMDDDELYSYAKQLQVPHGLLKEVKRQGRLPVVNFAAGGLATPADVSMLMQLGVDGVFVGSGIFKSANPQKRAEAMVQAVTHYRDPEFLARVSEDLGEAMIGIDCDELIKGQLWAGRESQR 301          
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. TrEMBL
Match: A0A3M6TJL8 (SOR_SNZ domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00008885 PE=3 SV=1)

HSP 1 Score: 396.356 bits (1017), Expect = 5.335e-135
Identity = 217/282 (76.95%), Postives = 241/282 (85.46%), Query Frame = 2
Query:   26 GTFTVKSGLAQMAKGGLIMDVTDXXXXXXXXXXXXXXVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQKMNEEELEKYAESLRVSVXXXXXXXXXXXXPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSVVQK 871
            GTF VK+GLAQMAKGG+IMDVT A +AR+AE AGACAVM+LERVPADIRK GGVARMTDP++ KEIM AVTIPVMAKARIGHFAEAQIL+AIGVDMIDESEVL+PAD S HI+K +F VPFVCGARDLGEALRRI EGAAMIRTKG+AGTGDV EAVRHA++IR  I   Q ++  EL  YA+ LRVS ELLKKT E+ +LPVVNFAAGGLATPADVALLMQLGV+GVFVGSGIFKSDNPKKRA AM QAVTHY +   LA++SEDLGEAM G    +   K
Sbjct:   42 GTFKVKAGLAQMAKGGIIMDVTTAEEARVAENAGACAVMSLERVPADIRKQGGVARMTDPKRTKEIMNAVTIPVMAKARIGHFAEAQILEAIGVDMIDESEVLTPADESHHIDKHKFTVPFVCGARDLGEALRRIAEGAAMIRTKGQAGTGDVAEAVRHARTIRNQIRHAQALDSAELFTYAKELRVSFELLKKTAEMGRLPVVNFAAGGLATPADVALLMQLGVDGVFVGSGIFKSDNPKKRAWAMAQAVTHYNNPKKLAELSEDLGEAMFGTPVSATAHK 323          
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. TrEMBL
Match: A0A2B4S7V8 (Putative pyridoxine biosynthesis SNZERR OS=Stylophora pistillata OX=50429 GN=SNZERR PE=3 SV=1)

HSP 1 Score: 395.201 bits (1014), Expect = 1.458e-134
Identity = 215/282 (76.24%), Postives = 241/282 (85.46%), Query Frame = 2
Query:   26 GTFTVKSGLAQMAKGGLIMDVTDXXXXXXXXXXXXXXVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQKMNEEELEKYAESLRVSVXXXXXXXXXXXXPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSVVQK 871
            GTF VK+GLAQMAKGG+IMDVT A +AR+AE AGACAVM+LERVPADIRK GGVARMTDP++ KEIM AVTIPVMAKARIGHFAEAQIL+AIGVDMIDESEVL+PAD S+HI+K +F VPFVCGARDLGEALRRI EGAAMIRTKG+AGTGDV EAVRHA++IR  I   Q ++  EL  YA+ LRV  ELL+KT E+ +LPVVNFAAGGLATPADVALLMQLGV+GVFVGSGIFKSDNPKKRA AM QAVTHY +   LA++SEDLGEAM G    +   K
Sbjct:   42 GTFKVKAGLAQMAKGGIIMDVTTAEEARVAENAGACAVMSLERVPADIRKQGGVARMTDPKRTKEIMSAVTIPVMAKARIGHFAEAQILEAIGVDMIDESEVLTPADESQHIDKHKFTVPFVCGARDLGEALRRIAEGAAMIRTKGQAGTGDVAEAVRHARTIRNQIRHAQALDSAELFSYAKELRVPFELLQKTAEMGRLPVVNFAAGGLATPADVALLMQLGVDGVFVGSGIFKSDNPKKRAWAMAQAVTHYSNPKKLAELSEDLGEAMFGTPVSATTHK 323          
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. Ensembl Yeast
Match: SNZ1 (Protein involved in vitamin B6 biosynthesis; member of a stationary phase-induced gene family; coregulated with SNO1; interacts with Sno1p and with Yhr198p, perhaps as a multiprotein complex containing other Snz and Sno proteins [Source:SGD;Acc:S000004702])

HSP 1 Score: 326.635 bits (836), Expect = 2.491e-112
Identity = 178/278 (64.03%), Postives = 223/278 (80.22%), Query Frame = 2
Query:   32 FTVKSGLAQMAKGGLIMDVTDXXXXXXXXXXXXXXVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQKM-NEEELEKYAESLRVSVXXXXXXXXXXXXPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSV 862
            F +KSGLAQM KGG+IMDV    QA++AE++GACAVMALE +PAD+RK G V RM+DP+ IK+IM +V+IPVMAK RIGHF EAQI++A+ VD IDESEVL+PAD + HI K +F VPFVCGA+DLGEALRRI EGAAMIRTKGEAGTGDV EAV+H + I + I + Q++ +E+++ K AE +RV V LLK   E  KLPVVNFAAGG+ATPAD ALLMQLG +GVFVGSGIFKS NP + A A+V+A TH+ + + L ++S DLGE M G++ +S+
Sbjct:    6 FKIKSGLAQMLKGGVIMDVVTPEQAKIAEKSGACAVMALESIPADMRKSGKVCRMSDPKMIKDIMNSVSIPVMAKVRIGHFVEAQIIEALEVDYIDESEVLTPADWTHHIEKDKFKVPFVCGAKDLGEALRRINEGAAMIRTKGEAGTGDVSEAVKHIRRITEEIKACQQLKSEDDIAKVAEEMRVPVSLLKDVLEKGKLPVVNFAAGGVATPADAALLMQLGCDGVFVGSGIFKSSNPVRLATAVVEATTHFDNPSKLLEVSSDLGELMGGVSIESI 283          
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. Ensembl Yeast
Match: SNZ2 (Member of a stationary phase-induced gene family; transcription of SNZ2 is induced prior to diauxic shift, and also in the absence of thiamin in a Thi2p-dependent manner; forms a coregulated gene pair with SNO2; interacts with Thi11p [Source:SGD;Acc:S000005277])

HSP 1 Score: 323.939 bits (829), Expect = 3.343e-111
Identity = 184/279 (65.95%), Postives = 214/279 (76.70%), Query Frame = 2
Query:   32 FTVKSGLAQMAKGGLIMDVTDXXXXXXXXXXXXXXVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQK--MNEEELEKYAESLRVSVXXXXXXXXXXXXPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSV 862
            F VK+GLAQM KGG+IMDV    QA +AE AGACAVMALER+PAD+RK G V RM+DP+ IKEIM+AV+IPVMAK RIGHF EAQIL+ + VD IDESEVL+PAD + HI K  F VPFVCGA+DLGEALRRI EGAAMIRTKGEAGTGDV EAV+H   I+  I   ++    E +    A  LRV V+LLK T    KLPVVNFAAGG+ATPAD ALLMQLG EGVFVGSGIFKS +P+K A A+V+A THY + A L +IS DLG+ M GI+  S+
Sbjct:    4 FKVKTGLAQMLKGGVIMDVVTPEQAIIAERAGACAVMALERIPADMRKSGQVCRMSDPRMIKEIMEAVSIPVMAKVRIGHFVEAQILEELQVDYIDESEVLTPADWTHHIEKHNFKVPFVCGAKDLGEALRRINEGAAMIRTKGEAGTGDVSEAVKHITKIKAEIQQYKENLKTESDFAAKATELRVPVDLLKTTLSEGKLPVVNFAAGGVATPADAALLMQLGCEGVFVGSGIFKSSDPEKLACAIVEATTHYDNPAKLLQISSDLGDLMGGISIQSI 282          
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. Ensembl Yeast
Match: SNZ3 (Member of a stationary phase-induced gene family; expressed in the presence of galactose; transcription of SNZ3 is induced prior to diauxic shift, and also in the absence of thiamin in a Thi2p-dependent manner; forms a coregulated gene pair with SNO3 [Source:SGD;Acc:S000001835])

HSP 1 Score: 323.553 bits (828), Expect = 5.285e-111
Identity = 183/279 (65.59%), Postives = 214/279 (76.70%), Query Frame = 2
Query:   32 FTVKSGLAQMAKGGLIMDVTDXXXXXXXXXXXXXXVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQK--MNEEELEKYAESLRVSVXXXXXXXXXXXXPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSV 862
            F VK+GLAQM KGG+IMDV    QA +AE AGACAVMALER+PAD+RK G V RM+DP+ IKEIM+AV+IPVMAK RIGHF EAQIL+ + VD IDESEVL+PAD + HI K  F VPFVCGA+DLGEALRRI EGAAMIRTKGEAGTGDV EAV+H   I+  I   ++    E +    A  LRV V+LLK T    KLPVVNFAAGG+ATPAD ALLMQLG EGVFVGSGIFKS +P+K A A+V+A THY + A L ++S DLG+ M GI+  S+
Sbjct:    4 FKVKTGLAQMLKGGVIMDVVTPEQAIIAERAGACAVMALERIPADMRKSGQVCRMSDPRMIKEIMEAVSIPVMAKVRIGHFVEAQILEELQVDYIDESEVLTPADWTHHIEKHNFKVPFVCGAKDLGEALRRINEGAAMIRTKGEAGTGDVSEAVKHITKIKAEIQQYKENLKTESDFAAKATELRVPVDLLKTTLSEGKLPVVNFAAGGVATPADAALLMQLGCEGVFVGSGIFKSSDPEKLACAIVEATTHYDNPAKLLQVSSDLGDLMGGISIQSI 282          
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. Ensembl Nematostella
Match: EDO31551 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXL5])

HSP 1 Score: 379.793 bits (974), Expect = 2.439e-132
Identity = 204/281 (72.60%), Postives = 240/281 (85.41%), Query Frame = 2
Query:   26 GTFTVKSGLAQMAKGGLIMDVTDXXXXXXXXXXXXXXVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQKMNEEELEKYAESLRVSVXXXXXXXXXXXXPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSVVQ 868
            GTF VKSGLAQMAKGG+IMDVT+A +A +AE AGACAVMALE++P+DIRK GGVARMTDP+ IKEI+ AVTIPVMAKARIGHFAEAQIL+ +GVDM+DESEVL+PAD + HI+K +F VPFVCGARDLGEALRRI EGAAMIRTKG+AGTGDV EAVRHA++IR  I   Q +++ EL  YA+ LRV +++L++T EL +LPVVNFAAGGLATPADV+LLMQLGV+GVFVGSGIF+S NP KRA AM QAVTHY +   LA++SEDLGEAM GI     +Q
Sbjct:   40 GTFKVKSGLAQMAKGGIIMDVTNAEEAVVAENAGACAVMALEKIPSDIRKEGGVARMTDPKLIKEIINAVTIPVMAKARIGHFAEAQILEVLGVDMVDESEVLTPADDANHIDKHKFKVPFVCGARDLGEALRRISEGAAMIRTKGQAGTGDVSEAVRHARAIRSQIRYAQGLDKPELYTYAKELRVPMDVLERTVELGRLPVVNFAAGGLATPADVSLLMQLGVDGVFVGSGIFRSGNPAKRAWAMAQAVTHYNNPKKLAELSEDLGEAMSGIPAKDAIQ 320          
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. Planmine SMEST
Match: SMESG000026036.1 (SMESG000026036.1)

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 298/298 (100.00%), Postives = 298/298 (100.00%), Query Frame = 2
Query:    8 MSTVQFGTFTVKSGLAQMAKGGLIMDVTDXXXXXXXXXXXXXXVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQKMNEEELEKYAESLRVSVXXXXXXXXXXXXPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSVVQKWSLREGKKEF 901
            MSTVQFGTFTVKSGLAQMAKGGLIMDVTDAAQARLAEEAGACAVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQKMNEEELEKYAESLRVSVELLKKTKELQKLPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSVVQKWSLREGKKEF
Sbjct:    1 MSTVQFGTFTVKSGLAQMAKGGLIMDVTDAAQARLAEEAGACAVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQKMNEEELEKYAESLRVSVELLKKTKELQKLPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSVVQKWSLREGKKEF 298          
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. Planmine SMEST
Match: SMESG000026036.1 (SMESG000026036.1)

HSP 1 Score: 508.834 bits (1309), Expect = 0.000e+0
Identity = 281/281 (100.00%), Postives = 281/281 (100.00%), Query Frame = 2
Query:   59 MAKGGLIMDVTDXXXXXXXXXXXXXXVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQKMNEEELEKYAESLRVSVXXXXXXXXXXXXPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSVVQKWSLREGKKEF 901
            MAKGGLIMDVTDAAQARLAEEAGACAVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQKMNEEELEKYAESLRVSVELLKKTKELQKLPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSVVQKWSLREGKKEF
Sbjct:    1 MAKGGLIMDVTDAAQARLAEEAGACAVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQKMNEEELEKYAESLRVSVELLKKTKELQKLPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSVVQKWSLREGKKEF 281          
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. Planmine SMEST
Match: SMESG000026036.1 (SMESG000026036.1)

HSP 1 Score: 495.738 bits (1275), Expect = 1.296e-178
Identity = 274/274 (100.00%), Postives = 274/274 (100.00%), Query Frame = 2
Query:   80 MDVTDXXXXXXXXXXXXXXVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQKMNEEELEKYAESLRVSVXXXXXXXXXXXXPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSVVQKWSLREGKKEF 901
            MDVTDAAQARLAEEAGACAVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQKMNEEELEKYAESLRVSVELLKKTKELQKLPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSVVQKWSLREGKKEF
Sbjct:    1 MDVTDAAQARLAEEAGACAVMALERVPADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGVDMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRTKGEAGTGDVIEAVRHAKSIRQSILSLQKMNEEELEKYAESLRVSVELLKKTKELQKLPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRAEAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSVVQKWSLREGKKEF 274          
The following BLAST results are available for this feature:
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8WPW2|PDX1_SUBDO1.346e-13572.60Pyridoxal 5'-phosphate synthase subunit SNZERR OS=... [more]
sp|Q54J47|PDX1_DICDI5.194e-12466.55Probable pyridoxal 5'-phosphate synthase subunit p... [more]
sp|A9B891|PDXS_HERA22.533e-12370.50Pyridoxal 5'-phosphate synthase subunit PdxS OS=He... [more]
sp|B8G663|PDXS_CHLAD2.794e-12369.42Pyridoxal 5'-phosphate synthase subunit PdxS OS=Ch... [more]
sp|B9LIK3|PDXS_CHLSY3.334e-12268.71Pyridoxal 5'-phosphate synthase subunit PdxS OS=Ch... [more]
back to top
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
X2ATT47.370e-14778.75SOR_SNZ domain-containing protein OS=Capitella tel... [more]
A0A267GMC62.622e-13772.35SOR_SNZ domain-containing protein OS=Macrostomum l... [more]
A0A1I8HL753.022e-13772.35SOR_SNZ domain-containing protein OS=Macrostomum l... [more]
A0A3M6TJL85.335e-13576.95SOR_SNZ domain-containing protein OS=Pocillopora d... [more]
A0A2B4S7V81.458e-13476.24Putative pyridoxine biosynthesis SNZERR OS=Styloph... [more]
back to top
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
SNZ12.491e-11264.03Protein involved in vitamin B6 biosynthesis; membe... [more]
SNZ23.343e-11165.95Member of a stationary phase-induced gene family; ... [more]
SNZ35.285e-11165.59Member of a stationary phase-induced gene family; ... [more]
back to top
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO315512.439e-13272.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pyridoxal 5'-phosphate synthase subunit PdxS vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000026036.10.000e+0100.00SMESG000026036.1[more]
SMESG000026036.10.000e+0100.00SMESG000026036.1[more]
SMESG000026036.11.296e-178100.00SMESG000026036.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003929 ID=SMED30003929|Name=Pyridoxal 5'-phosphate synthase subunit PdxS|organism=Schmidtea mediterranea sexual|type=transcript|length=1019bp
GTAAATCATGTCAACAGTTCAATTCGGTACATTTACAGTCAAATCAGGTC
TGGCACAAATGGCTAAAGGGGGACTGATTATGGACGTTACGGATGCTGCA
CAGGCTCGTTTAGCAGAAGAAGCAGGAGCGTGTGCAGTGATGGCGTTGGA
AAGAGTGCCAGCTGATATTCGTAAATATGGAGGTGTAGCCAGAATGACAG
ACCCCCAAAAAATTAAGGAAATAATGAAAGCTGTCACAATTCCGGTTATG
GCAAAAGCCAGAATTGGACATTTTGCTGAAGCACAAATTCTTCAAGCAAT
TGGAGTTGATATGATTGATGAATCCGAAGTATTAAGTCCAGCTGATCCAT
CAGAACATATTAATAAACAAGAATTCATTGTACCTTTTGTTTGTGGTGCA
CGGGATTTAGGAGAAGCATTACGAAGAATTCAAGAAGGGGCCGCTATGAT
TAGAACAAAAGGTGAAGCTGGCACTGGAGATGTCATTGAAGCTGTCAGAC
ATGCAAAATCAATCAGACAAAGTATCTTGAGCTTACAAAAAATGAACGAA
GAAGAATTAGAAAAGTATGCAGAATCACTAAGAGTTTCAGTGGAACTATT
GAAGAAAACGAAAGAGCTTCAGAAACTACCAGTTGTAAATTTTGCAGCCG
GTGGCCTTGCAACGCCAGCTGATGTGGCGCTTTTGATGCAGCTTGGGGTC
GAGGGGGTTTTCGTAGGTTCCGGAATATTCAAATCTGATAATCCAAAGAA
AAGAGCTGAAGCAATGGTTCAAGCAGTCACCCATTACAAAGATGCCGCAT
TGTTGGCCAAAATCAGTGAGGATCTTGGTGAAGCAATGGTTGGAATCAAC
TGTGACAGTGTTGTTCAGAAATGGAGTTTAAGAGAAGGCAAAAAAGAGTT
TTAGGTCGGCATTCAGTTAAAATATCGGATTCAAAATTTCACATTTTTTT
TAGAAAAATGATTTAATGATATTTTTCATTTATTAAATATAAGTAATAAT
GAAAATTAGAATTTTTGTG
back to top

protein sequence of SMED30003929-orf-1

>SMED30003929-orf-1 ID=SMED30003929-orf-1|Name=SMED30003929-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=299bp
MSTVQFGTFTVKSGLAQMAKGGLIMDVTDAAQARLAEEAGACAVMALERV
PADIRKYGGVARMTDPQKIKEIMKAVTIPVMAKARIGHFAEAQILQAIGV
DMIDESEVLSPADPSEHINKQEFIVPFVCGARDLGEALRRIQEGAAMIRT
KGEAGTGDVIEAVRHAKSIRQSILSLQKMNEEELEKYAESLRVSVELLKK
TKELQKLPVVNFAAGGLATPADVALLMQLGVEGVFVGSGIFKSDNPKKRA
EAMVQAVTHYKDAALLAKISEDLGEAMVGINCDSVVQKWSLREGKKEF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR033755PdxS/SNZ_N
IPR001852PdxS/SNZ
IPR013785Aldolase_TIM
IPR011060RibuloseP-bd_barrel
Vocabulary: biological process
TermDefinition
GO:0042819vitamin B6 biosynthetic process
GO:0042823pyridoxal phosphate biosynthetic process
GO:0008152metabolic process
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0016829lyase activity
GO:0036381pyridoxal 5'-phosphate synthase (glutamine hydrolysing) activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001852Pyridoxal 5'-phosphate synthase subunit PdxS/SNZPIRSFPIRSF029271Pdx1coord: 1..295
e-value: 2.6E-147
score: 487.4
IPR001852Pyridoxal 5'-phosphate synthase subunit PdxS/SNZTIGRFAMTIGR00343TIGR00343coord: 11..290
e-value: 2.1E-140
score: 465.2
IPR001852Pyridoxal 5'-phosphate synthase subunit PdxS/SNZPANTHERPTHR31829FAMILY NOT NAMEDcoord: 5..286
IPR001852Pyridoxal 5'-phosphate synthase subunit PdxS/SNZPROSITEPS01235PDXS_SNZ_1coord: 207..225
IPR001852Pyridoxal 5'-phosphate synthase subunit PdxS/SNZPROSITEPS51129PDXS_SNZ_2coord: 11..298
score: 135.376
IPR001852Pyridoxal 5'-phosphate synthase subunit PdxS/SNZCDDcd04727pdxScoord: 13..284
e-value: 1.05317E-175
score: 484.827
IPR013785Aldolase-type TIM barrelGENE3DG3DSA:3.20.20.70coord: 2..296
e-value: 9.6E-142
score: 473.1
IPR033755PdxS/SNZ N-terminal domainPFAMPF01680SOR_SNZcoord: 9..214
e-value: 1.7E-104
score: 348.1
NoneNo IPR availablePANTHERPTHR31829:SF0PYRIDOXAL 5'-PHOSPHATE SYNTHASE SUBUNIT SNZ1-RELATEDcoord: 5..286
IPR011060Ribulose-phosphate binding barrelSUPERFAMILYSSF51366Ribulose-phoshate binding barrelcoord: 20..270