FMRFamide-activated amiloride-sensitive sodium channel

Overview
NameFMRFamide-activated amiloride-sensitive sodium channel
Smed IDSMED30003924
Length (bp)1828
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30003924) t-SNE clustered cells

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30003924) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30003924) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30003924) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003924

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30003924SMESG000053391.1 dd_Smed_v4_9429_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003924SMESG000053391.1 dd_Smed_v4_9429_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30003924SMESG000053391.1 dd_Smed_v4_9429_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30003924SMESG000053391.1 dd_Smed_v4_9429_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30003924SMESG000053391.1 dd_Smed_v4_9429_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30003924SMESG000053391.1 dd_Smed_v4_9429_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q25011|FANA_CORAP (FMRFamide-activated amiloride-sensitive sodium channel OS=Cornu aspersum OX=6535 PE=2 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 4.632e-10
Identity = 108/534 (20.22%), Postives = 211/534 (39.51%), Query Frame = 2
Query:  128 EFFNNCSIRGVAKVYKSNSXXXXXXXXXXXXXXXXXXXYSIVKILREYLEYNTTIQTKLQLEDASPFPAITICPYQPFSERAVE--YFQNKGMSPKEFSWKLRKSAKRYLEKDQPHIAESILFYDDLRIYYQNLKYEESTYIGLNDKELFVFCITKLGIGMFFGEVRENCGY-NITRHSSPDFFNCYTINVKPEYSLNT----EYIHLILRFPKPKNLEIFQXXXXXXXXXXXXXGAQLLVHERGSSPVSTREKIHIEPNRLLQINYGNNYWKEYSTPNDICLSESKMTEKITDLDNEYSFTFQGCLDSAKAKRVLEKCQCVMAFLPRLVIPSEQYPYCANF-------RNMSDEDFKEFWKRGRCI-----------SETLTKDKELENMYKNCYKSCIRQKFNLQISNIKWTPTLWQL---EWLFKLQQSWNVLIDFPKNRSIVEKAKADALRFL--NAKDINELISEN-----------ENSIFQKDEKYACVVLERLSNETFYKEEKLGLSLYGLVSRIGGSCTLYLGLT 1606
            E  +  +  G+AK+  S     K++W + +    T     +  ++R+YL++     ++++      +P+++IC  +P S R +   YF N+  S    +W LR   K   E+D         F + +R +Y+NL  +++  +  N +++ + C             RE C   N +     ++FNC+T N      ++       + LI    K   L     +    +  L+  G +++VH  GS P      I I P     +            P   C      T  + +   +Y +TF  CL   K + ++++C C  + LP   +PS    +C          RN S+ED  +  +    I            + L  D+  E +   C++ C    +   +S   W    +QL   E  FK ++              +EK    + + L  N   +++++S++            + + +++     + LE LS   + +    GL+   L + IGG+  L++G++
Sbjct:   45 ELGSESNAHGLAKIVTSRDTKRKVIWALLVIAGFTAATLQLSLLVRKYLQFQVVELSEIKDSMPVQYPSVSICNIEPISLRTIRRMYFNNE--SQNLITW-LRFIQKFRFEQDS--------FMNSIRAFYENLG-QDAKKLSHNLEDMLMHCRFN----------RELCHVSNFSTFFDGNYFNCFTFNSGQRLQMHATGPENGLSLIFSVEKDDPLPGTYGVYNFDNNILHSAGVRVVVHAPGSMPSPVDHGIDIPPGYSSSVGLKAILHTRLPYPYGNC------TNDMLNGIKQYKYTFFACLQLCKQRLIIQRCGCKSSALPE--VPSYNATFCGVIKDWQEINRNHSNEDHNQSEEDRAFIPTPYLACEEREQKNLNNDRTYE-LSCGCFQPCSETSYLKSVSLSYWPLEFYQLSAVERFFKQERQAGQNHFMKTAYEYLEKLAHPSQKHLARNDSHMDDILSKSYSLSEKEMAKEASDLIRQNMLRLNIYLEDLSVVEYRQLPAYGLA--DLFADIGGTLGLWMGIS 545          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A1I8H6N9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002809g2 PE=3 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 2.199e-69
Identity = 172/535 (32.15%), Postives = 270/535 (50.47%), Query Frame = 2
Query:  131 FFNNCSIRGVAKVYKSNSXXXXXXXXXXXXXXXXXXXYSIVKILREYLEYNTTIQTKLQLEDASPFPAITICPYQPFSERAVEYFQNK-GMSPKEFSWKLR-------------------------KSAKRYLEKDQPHIAESI------LFYDDLRIYYQNLKYEESTYIGLNDKELFVFCITKLGIGMFFGEVRENCGYNITR---HSSPDFFNCYTINVKPEYSLNTEYIHLILRFPKPKNLEIFQXXXXXXXXXXXXXGAQLLVHERGSSPVSTREKIHIEPNRLLQINYGNNYWKEYSTPNDICLS-ESKMTEKITDLDNEYSFTFQGCLDSAKAKRVLEKCQCVMAFLPRLVIPSEQYPYCANFRNMSDEDFKEFWKRGRCIS--ETLTKDKELENMYKNCYKSCIRQKFNLQISNIKWTPTLWQLEWLFKLQQSWNVLID--FPKNRSIVEKAKADALRFL---NAKDINELISENENSIFQKDEKYACVVLERLSNETFYKEEKLGLSLYGLVSRIGGSCTLYLGLT 1606
            F    SIRGV KV+K+ S ++  MW IF+    + L YS+ KI  +YL+Y+  IQT  +++D +PFPA++IC  QPFS  A + + NK  MSP EF+  LR                         K +K + +  Q     S+      L YD+LR+YYQN+  +E+  +G    E  V CI K G     G     C  ++ +    S P+FFNC ++   PEY++    I LI+      + +I  + S L  +     G ++ VHE  + P    + I  EP ++ +I Y    ++   TP + C+S ++   +K  DL  EY++ F+ CL+S   + VL KC C+   LPR+ +P++ +PYC       DE FKE   R +C+   +  T  K  E   K+C+  C+   F  ++S  KW  T W L W+ +L + W+         N S  E++      +L   N  D+  L +    + F  D++++ +V++R SN TF K EK+ L+L  L SR+GG C++Y+GLT
Sbjct:    9 FLETSSIRGVGKVFKTQSPLLSRMWGIFVLGSTSFLFYSVFKITLDYLQYDVNIQTYQEIDDETPFPAVSICNNQPFSVNAYQRWSNKQSMSPTEFNKYLRQQALSLVSPDLMRDKYRDLQAARDRKDSKAFRQIHQSMFDSSVAAMTYSLIYDNLRMYYQNMLADEAMELGHTRNESIVDCIFKYGSIQVLGT--RGCHDDMVKVKTFSDPNFFNCLSVEFTPEYAMTIISITLIVWLGPDDSYDIRHRQSFLNEVYEQAYGLRVDVHEPKTQPRVLEQGIQTEPGKMNEIKYQPIRFERKDTPKNPCISLDAAEKQKFRDLRMEYNYDFELCLNSKVQEVVLNKCGCMYIELPRIAMPNKTHPYCG----FMDEKFKE---RSQCVKSLDMRTIRKSFEG--KDCFPKCVDLSFEKELSTTKWRETKWMLHWIKELCERWDKQFKQLSGSNASEFEESLTGVTDYLTRDNITDLRSLGNSTSKASFDFDDRFSFIVVKRQSNNTFVKTEKIVLTLNALFSRVGGLCSMYIGLT 532          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A183TB06 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS13654 PE=3 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 2.238e-63
Identity = 159/524 (30.34%), Postives = 260/524 (49.62%), Query Frame = 2
Query:  131 FFNNCSIRGVAKVYKSNSXXXXXXXXXXXXXXXXXXXYSIVKILREYLEYNTTIQTKLQLEDASPFPAITICPYQPFSERAVEYFQNKG-MSPKEFSWKLRKSAKRYLEK---------------DQPHIAESI---LFYDDLRIYYQNLKYEESTYIGLNDKELFVFCITKLG-IGMFFGEVRENCGYNITRHSSPDFFNCYTINVKPEYSLNTEYIHLILRFPKPKNLEIFQXXXXXXXXXXXXXGAQLLVHERGSSPVSTREKIHIEPNRLLQINYGNNYWKEYSTPNDICLSESKMTEKITDLDNEYSFTFQGCLDSAKAKRVLEKCQCVMAFLPRLVIPSEQYPYCANFRN----MSDEDFKEFWKRGRC----ISETLTKDKELENMYKNCYKSCIRQKFNLQISNIKWTPTLWQLEWLFKLQQSWNVLIDFPKNRSIVEKAKADALRFLNAKDINELISE--NENSIFQKDEKYACVVLERLSNETFYKEEKLGLSLYGLVSRIGGSCTLYLGLTCA 1612
            F  + SIRG  ++ KS ++ ++++W +++ +    L  SI+K++ EY+EY+  IQT + ++  + FPA+T C +QPFS  A E ++ K  MSP  F+  LR  A + LEK               +   I E++   L YD L IYYQ+L + +   +G   K++ V C+ + G   M  G    +    I   S P +FNCY++ +    S +   + LIL     KN     + + L  L    +G ++++HE G      R    + P R+ ++ +       ++ PN  C + S  +++  DLD EY + F+ CL S     V+++C C+ A+ PR+  P+   PYC         + DED     +R +C    IS      K++E   K C + C+  ++  Q+S   W PT WQL W     Q  + L D   N S+          FL  K++    ++  NE + F  D+++A +V++R SN+T  K E L L+   L SRIGG C+LY+G+T A
Sbjct:   30 FLESTSIRGCNRIVKSENRALRVLWTVYVCLTTLFLHISIMKLVNEYMEYSVNIQTYINMDAPTAFPAVTFCNHQPFSSSAYELWKRKKIMSPTTFNQMLRNRASKILEKAIKIPEGPLANIQLINASLIQEALVQGLIYDTLPIYYQSLNWPDHRRLGHKSKDVLVLCLLRYGSTWMLTGPGCADPMLKIRHQSDPKYFNCYSVEIMKYASEHINELGLILWLGPDKNYGKEDRQAFLFDLFEQSVGLRVVIHEPGQRGSLDRHGFQVAPGRMNEVIFQTVKMIHFNRPNKPCFANS--SQRFNDLDEEYDYQFEMCLSSYIQNLVVQRCGCLYAYFPRIYPPNATLPYCGQLVAGEDVLLDEDL--IMRRRQCARLIISNAAVLRKKIEE-EKICLRRCVVTEYETQVSVTMWRPTSWQLYW----SQKTSSLFDSAINGSLTPDEAHLIYHFLKTKNLTNFSADESNEKNTFVFDDRFAYLVVKRKSNDTVVKNENLVLTQNALFSRIGGLCSLYIGMTFA 544          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A1I8G5D0 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 1.188e-60
Identity = 153/520 (29.42%), Postives = 257/520 (49.42%), Query Frame = 2
Query:  122 RKEFFNNCSIRGVAKVYKSNSXXXXXXXXXXXXXXXXXXXYSIVKILREYLEYNTTIQTKLQLEDASPFPAITICPYQPFSERAVEYFQ--NKGMSPKEFSWKLRKSAKRYLEKDQPHIAESILFYDDLRIYYQNLKYEESTYIGLNDKELFVFCITKLGIGMFFGEVRENCGYNITRHSSPDFFNCYTIN-VKPEYSLNTEYIHLILRFPKPKNLEIFQXXXXXXXXXXXXXGAQLLVHERGSSPVSTREKIHIEPNRLLQINYGNNYWKE-YSTPNDICLSESKMTEKITDLDNEYSFTFQGCLDSAKAKRVLEKCQCVMAFLPRLV-IPSEQYPYCANFRNMSDEDFKEFWKRGRCISETLTKDKELENMY-----------KNCYKSCIRQKFNLQISNIKWTPTLWQLEWLFKLQQSWNVLIDFPKN-------RSIVEKAKADALRFLNAKDINELISENENSIFQKDEKYACVVLERLSNETFYKEEKLGLSLYGLVSRIGGSCTLYLGLTCA 1612
            R+ F ++ S+RGV K+ ++++  ++I+W++F+  M  LL+YS  ++L  Y EY+ ++QT +   D S FPAITIC + PFS RA   +Q  +  ++P  F+ +LR+  ++ L      +A ++LFYD +  YYQNL    +  +G +  E  + C+  +G  +  G+  E C       S P +FNCYT+   + + S     ++LI+          ++  + +  +     G +LL+HE    P      +HIEP ++++I +    WKE   +P D C         I DL N Y +++Q C ++   K  + KCQC+++  PR   +PS Q PYC +FR     +      R RC+ E      ++                 C K C R  ++ ++S  +W  + +QL W+     SW  L +           R+I++   AD L  L      +   +        ++ YA VV+ R S +T  +EEKL ++   L+SR+GG C+LYLGLT A
Sbjct: 1323 RQLFCSSSSLRGVPKICRADTTFLRILWLVFVLAMFILLVYSSTRVLMNYREYDVSVQTSVIGNDPSDFPAITICSHYPFSPRAARMWQQCDGQLAPATFNRRLRQLTRQLLFSGNLRLANTLLFYDKVNTYYQNLDPNVTVSMGHSVDEFLLHCMIAIGNYVMVGKASE-CQLTFQLVSHPKYFNCYTVKPTQADKSQAMSAVYLIVNLGSNSRQHPWE-QAFVMDVFDQAYGLRLLLHEANLYPGIENAGVHIEPGKMVEIAFDTVLWKETQDSPMDRC--HDGWRPAIEDLQNRYRYSYQACKEAHMNKLFIAKCQCLLSRFPRPAGLPSNQIPYCGDFRT---SNISIIESRLRCLEEIGEHQSKMPQPAAAAAAAAVADDSQCRKRCTRYSYDQELSITRWRASSYQLHWMLHQSDSWKRLREVNNESEKRHLLRNILDYLGADNLTRLPVSYQQQERQQQATLTDSAEDTYAYVVVRRKSFDTLKREEKLTVTFEALMSRVGGLCSLYLGLTMA 1835          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A074ZXV4 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_01690 PE=3 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 3.799e-60
Identity = 149/520 (28.65%), Postives = 267/520 (51.35%), Query Frame = 2
Query:  131 FFNNCSIRGVAKVYKSNSXXXXXXXXXXXXXXXXXXXYSIVKILREYLEYNTTIQTKLQLEDASPFPAITICPYQPFSERAVEYFQNKG-MSPKEFSWKLRKSAKRYLEKDQPHIAESIL--------FYDDLRIYYQNLKYEESTYIGLNDKELFVFCITKL-GIGMFFGEVRENC---GYNITRHSSPDFFNCYTINVKPEYSLNTEYIHLILRFPKPKNLEIFQXXXXXXXXXXXXXGAQLLVHERGSSPVSTREKIHIEPNRLLQINYGNNYWKEYSTPNDICLSESKMTEKITDLDNEYSFTFQGCLDSAKAKRVLEKCQCVMAFLPRLVIPSEQYPYCANFRNMSDEDFKEFWKRGRCISETLTKDKELENMYK---NCYKSCIRQKFNLQISNIKWTPTLWQLEWLFKLQQSWNVLIDFPKNRSIVEKAKADALRF----------LNAKDINELISENENSIFQKDEKYACVVLERLSNETFYKEEKLGLSLYGLVSRIGGSCTLYLGLTCA 1612
            F  + SIRG  ++ ++ S  I+++WI FL      L+ S+ +I++EYL Y+  I+T+ +++  + FP++T C +QPFSE+A E +++   +SP +F+  LR+ A+  ++ +  +I+E +L         +D +++YYQNL + +   +G    +    C+ +  G  +  G     C     +I   S P  +NCYT+++    S   + + LI+    P+N +I  + + L+ +     G ++ +HE G      R  I IEP R+ +IN+     +   TP   C+ + K  ++  DLD EY + F+ CLDS   + V+E+C CV A+LPR+VIP+   PYC      +  D +  + R  C+   + +  +L   ++    C + C   +++ ++S   W  T WQL W    Q++ N L +   +     KA  D L             NA D+     +     +   +++  ++++R  N+T  ++E L L+L  LVSRIGG C+LY+G+T A
Sbjct:   33 FLESISIRGCNRIVRAQSMFIRLLWICFLICTTVFLIVSVRRIVKEYLLYSVNIETEERMDAPTEFPSVTFCNHQPFSEKAYELWRSGSVISPTQFNRILRQKAEELVDNNSGNISEHLLQMVAHYSIVFDTIKMYYQNLDWPDQKRLGHQRNQSIYMCLIRFSGEELLLGG--PGCYDEMIHIKERSHPHHYNCYTVDINIYLSRRVQELGLIVWLGPPENYDIRYRQAFLQDVFEQAHGLRVAIHEPGQLVNLDRLGIQIEPGRMNEINFEVIRKEHQQTPRKPCIQDPK--DQYRDLDGEYDYEFELCLDSLIQQIVIERCSCVYAYLPRIVIPNATLPYCGRLLRNNQLDAQGLFDRKECVRHVVQQFAKLRKQFEAEGKCLRRCQTLEYDKRVSVTTWRATQWQLYW---SQETANALEEIMASSPNFTKASVDRLTVYLKTANLSTAFNAPDVTH---KGITRKYGFSDRHTYLLIKRKRNDTVVRKETLVLTLDALVSRIGGLCSLYIGMTFA 542          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: H2KTS4 (FMRFamide-activated amiloride-sensitive sodium channel OS=Clonorchis sinensis OX=79923 GN=CLF_106033 PE=3 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 8.691e-60
Identity = 154/541 (28.47%), Postives = 282/541 (52.13%), Query Frame = 2
Query:  131 FFNNCSIRGVAKVYKSNSXXXXXXXXXXXXXXXXXXXYSIVKILREYLEYNTTIQTKLQLEDASPFPAITICPYQPFSERAVEYFQNKG-MSPKEFSWKLRKSAKRYLEKDQPHIAESIL--------FYDDLRIYYQNLKYEESTYIGLNDKELFVFCITKL-GIGMFFGEVRENC---GYNITRHSSPDFFNCYTINVKPEYSLNTEYIHLILRFPKPKNLEIFQXXXXXXXXXXXXXGAQLLVHERGSSPVSTREKIHIEPNRLLQINYGNNYWKEYSTPNDICLSESKMTEKITDLDNEYSFTFQGCLDSAKAKRVLEKCQCVMAFLPRLVIPSEQYPYCANFRNMSDEDFKEFWKRGRCISETLTKDKELENMYK---NCYKSCIRQKFNLQISNIKWTPTLWQLEW-------LFKLQQSWNVLIDFPKNRSIVEKAKADALRFLNAKDINELISENENSIFQKDEKYACVVLERLSNETFYKEEKLGLSLYGLVSRIGGSCTLYLGLTCAXXXXXXXXXXVLWTEQSHKREIRK 1684
            F  + SIRG  ++ ++ S  I+++WI FL      L+ S+ +I++EYL Y+  ++T+ +++  + FP++T C +QPFSE+A E +++   +SP +F+  LR+ A+  ++ +  +I+E +L         +D +++YYQNL + +   +G    +    C+ +  G  +  G     C     +I   S P  +NCYT+++    S   + + LI+    P+N +I  + + L+ +     G ++ +HE G      R  I IEP R+ +IN+     +   TP   C+ + K   +  DLD EY + F+ CLDS   + V+E+C CV A+LPR+V+P+   PYC      +  D +  + R  C+   + +  +L   ++    C + C   +++ ++S   W  T WQL W       L ++  S         +R IV    A+     NA D+     +     +   +++  ++++R  N+T  ++E L L+L  LVSRIGG C+LY+G+T A FIE++EF  +++ + SH ++ R+
Sbjct:   33 FLESISIRGCNRIVRAQSMFIRLLWICFLICTTVFLIVSVRRIVKEYLLYSVNLETEERMDAPTEFPSVTFCNHQPFSEKAYELWRSGSVISPTQFNRILRQKAEELVDNNSGNISEHLLQMVAHYSIVFDTIKMYYQNLDWPDQKRLGHQRNQSIYMCLIRFSGEELLLGG--PGCYDEMIHIKERSHPHHYNCYTVDINIYLSRRVQELGLIVWLGPPENYDIRYRQAFLQDVFEQAHGLRVAIHEPGQLVNLDRLGIQIEPGRMNEINFEVIRKEHQQTPRKPCIQDPK--NRYRDLDGEYDYEFELCLDSLIQQIVIERCSCVYAYLPRIVVPNATLPYCGRLLRNNQLDAQGLFDRKECVRHVVQQFAKLRKQFEAEGKCLRRCQTLEYDKRVSVTTWRATQWQLYWSQETANALEQIMASSPNFTQTSVDRLIVYLKTANLSTAFNAPDVAH---KGITRKYGFSDRHTYLLIKRKRNDTVVRKETLVLTLDALVSRIGGLCSLYIGMTFAIFIEVIEFFYMVYMKNSHSKKRRR 566          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000053391.1 (SMESG000053391.1)

HSP 1 Score: 1003.05 bits (2592), Expect = 0.000e+0
Identity = 511/513 (99.61%), Postives = 511/513 (99.61%), Query Frame = 2
Query:  242 YSIVKILREYLEYNTTIQTKLQLEDASPFPAITICPYQPFSERAVEYFQNKGMSPKEFSWKLRKSAKRYLEKDQPHIAESILFYDDLRIYYQNLKYEESTYIGLNDKELFVFCITKLGIGMFFGEVRENCGYNITRHSSPDFFNCYTINVKPEYSLNTEYIHLILRFPKPKNLEIFQXXXXXXXXXXXXXGAQLLVHERGSSPVSTREKIHIEPNRLLQINYGNNYWKEYSTPNDICLSESKMTEKITDLDNEYSFTFQGCLDSAKAKRVLEKCQCVMAFLPRLVIPSEQYPYCANFRNMSDEDFKEFWKRGRCISETLTKDKELENMYKNCYKSCIRQKFNLQISNIKWTPTLWQLEWLFKLQQSWNVLIDFPKNRSIVEKAKADALRFLNAKDINELISENENSIFQKDEKYACVVLERLSNETFYKEEKLGLSLYGLVSRIGGSCTLYLGLTCAXXXXXXXXXXVLWTEQSHKREIRKEVEVDKIALNQPPIGPCRDMAIVSEDDFNNIQ 1780
            YSIVKILREYLEYNTTIQTKLQLEDASPFPAITICPYQPFSERAVEYFQNKGMSPKEFSWKLRKSAKRYLEKDQPHIAESILFYDDLRIYYQNLKYEESTYIGLNDKELFVFCITKLGIGMFFGEVRENCGYNITRHSSPDFFNCYTINVKPEYSLNTEYIHLILRFPKPKNLEIFQKISLLKSLSLNIIGAQLLVHERGSSPVSTREKIHIEPNRLLQINYGNNYWKEYSTPNDICLSESKMTEKITDLDNEYSFTFQGCLDSAKAKRVLEKCQCVMAFLPRLVIPSEQYPYCANFRNMSDEDFKEFWKRGRCISETLTKDKELENMYKNCYKSCIRQKFNLQISNIKWTPTLWQLEWLFKLQQSWNVLIDFPKNRSIVEKAKADALRFLNAKDINELISENENSIFQKDEKYACVVLERLSNETFYKEEKLGLSLYGLVSRIGGSCTLYLGLTCAFFIEILEFIIVLWTEQSHKREIRKEVEVDKIALNQPPIGPC DMAIVSEDD NNIQ
Sbjct:    7 YSIVKILREYLEYNTTIQTKLQLEDASPFPAITICPYQPFSERAVEYFQNKGMSPKEFSWKLRKSAKRYLEKDQPHIAESILFYDDLRIYYQNLKYEESTYIGLNDKELFVFCITKLGIGMFFGEVRENCGYNITRHSSPDFFNCYTINVKPEYSLNTEYIHLILRFPKPKNLEIFQKISLLKSLSLNIIGAQLLVHERGSSPVSTREKIHIEPNRLLQINYGNNYWKEYSTPNDICLSESKMTEKITDLDNEYSFTFQGCLDSAKAKRVLEKCQCVMAFLPRLVIPSEQYPYCANFRNMSDEDFKEFWKRGRCISETLTKDKELENMYKNCYKSCIRQKFNLQISNIKWTPTLWQLEWLFKLQQSWNVLIDFPKNRSIVEKAKADALRFLNAKDINELISENENSIFQKDEKYACVVLERLSNETFYKEEKLGLSLYGLVSRIGGSCTLYLGLTCAFFIEILEFIIVLWTEQSHKREIRKEVEVDKIALNQPPIGPCSDMAIVSEDDINNIQ 519          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000053382.1 (SMESG000053382.1)

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 359/547 (65.63%), Postives = 446/547 (81.54%), Query Frame = 2
Query:   95 KIRNSGKFKRKEFFNNCSIRGVAKVYKSNSXXXXXXXXXXXXXXXXXXXYSIVKILREYLEYNTTIQTKLQLEDASPFPAITICPYQPFSERAVEYFQNKGMSPKEFSWKLRKSAKRYLEKDQPHIAESILFYDDLRIYYQNLKYEESTYIGLNDKELFVFCITKLGIGMFFGEVRENCGYNITRHSSPDFFNCYTINVKPEYSLNTEYIHLILRFPKPKNLEIFQXXXXXXXXXXXXXGAQLLVHERGSSPVSTREKIHIEPNRLLQINYGNNYWKEYSTPNDICLSESKMTEKITDLDNEYSFTFQGCLDSAKAKRVLEKCQCVMAFLPRLVIPSEQYPYCANFRNMSDEDFKEFWKRGRCISETLTKDKELENMYKNCYKSCIRQKFNLQISNIKWTPTLWQLEWLFKLQQSWNVLIDFPKNRSIVEKAKADALRFLNAKDINELISENENSIFQKDEKYACVVLERLSNETFYKEEKLGLSLYGLVSRIGGSCTLYLGLTCAXXXXXXXXXXVLWTEQSHKREIRKEVEVDKIALNQPPIGPC 1735
            K R +     + FF NCSIRGVAK YK++S IIK++WIIF+ IMMTLLLYSI+KI+ EYLE+NTTIQT+LQLED+SPFPAITICPYQPFS+RA+ +F+NKGMSPK+FS+KLR++AK +LEKD P  AESILFYDDLR+YYQNLKY +STYIGL++ E+FV+CI KL IGMF G+VR +CG+NI+R+SSPDFFNCYTIN++PEYS +TEY+HLIL+F KP NLE F++ SLLK+L  ++IGAQ+ +HE GSSP ST+EKIH+EPNRLLQINY N  WKE +TP D+C+ ESK  EK+ DLDNEYSF+FQ CLDS KAK +LE+C CVMAFLPR +IPSE++PYCA+F+N+S+E F+ F K+G+CI + L +D+ L +  K CYK C  QKF+LQISNI W P LWQLEWL  L QSWNVLI+ P N +IV  AKA+AL+FLNA ++ +L   +ENS F K+E YACV++ERLSNETFY EE+LGLS+YGLVSRIGGSCTLYLGLTCAFFIEI+E++I+LW  Q            +KI+ N P   PC
Sbjct:    4 KTRGNSVSNMEIFFTNCSIRGVAKAYKTSSLIIKLLWIIFIMIMMTLLLYSIIKIVIEYLEFNTTIQTRLQLEDSSPFPAITICPYQPFSDRAIRFFKNKGMSPKDFSFKLRRTAKSFLEKDSPKKAESILFYDDLRVYYQNLKYNDSTYIGLDESEIFVYCINKLRIGMFIGDVRSDCGFNISRYSSPDFFNCYTINIRPEYSRDTEYVHLILKFFKPTNLERFRETSLLKTLFQHVIGAQITIHETGSSPTSTKEKIHVEPNRLLQINYRNINWKEQNTPTDVCIQESKTLEKLIDLDNEYSFSFQSCLDSYKAKNLLERCHCVMAFLPRSIIPSERFPYCADFKNISEEGFEYFLKKGKCIVKVLNEDQRLTSSDKKCYKKCEEQKFSLQISNIVWEPNLWQLEWLLTLHQSWNVLIEPPANDTIVRSAKAEALKFLNANELKDLTDVHENSPFHKNESYACVIIERLSNETFYNEERLGLSMYGLVSRIGGSCTLYLGLTCAFFIEIIEYLIILWKRQCK----------EKISSNGP--NPC 538          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000053390.1 (SMESG000053390.1)

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 340/520 (65.38%), Postives = 424/520 (81.54%), Query Frame = 2
Query:  131 FFNNCSIRGVAKVYKSNSXXXXXXXXXXXXXXXXXXXYSIVKILREYLEYNTTIQTKLQLEDASPFPAITICPYQPFSERAVEYFQNKGMSPKEFSWKLRKSAKRYLEKDQPHIAESILFYDDLRIYYQNLKYEESTYIGLNDKELFVFCITKLGIGMFFGEVRENCGYNITRHSSPDFFNCYTINVKPEYSLNTEYIHLILRFPKPKNLEIFQXXXXXXXXXXXXXGAQLLVHERGSSPVSTREKIHIEPNRLLQINYGNNYWKEYSTPNDICLSESKMTEKITDLDNEYSFTFQGCLDSAKAKRVLEKCQCVMAFLPRLVIPSEQYPYCANFRNMSDEDFKEFWKRGRCISETLTKDKELENMYKNCYKSCIRQKFNLQISNIKWTPTLWQLEWLFKLQQSWNVLIDFPKNRSIVEKAKADALRFLNAKDINELISENENSIFQKDEKYACVVLERLSNETFYKEEKLGLSLYGLVSRIGGSCTLYLGLTCAXXXXXXXXXXVLW-TEQSHKREIRKE 1687
            FF NCS+RGV+K YKS S IIK++W+IF+ +MM L+LYSI+KIL+EY+EYNTT+Q  LQ EDAS FPAITICP+QPF +R++++F+NKGMSPK+FS KLRK AK +LEK  P  AE+ILFYD+LR YYQNLKY ESTYIGL +KE+FV+CITKL   M  GEV +NCGY I+R+SSPDFFNCYT+N++PEY  NTEYI LILRFPKP NL  + +IS L++LS N IGAQLL+HE GSSP ST+EKIHIEPNR+LQINY N YWKEYSTPND+CLS+ +   KI DL+N Y+FTFQGCL+S  AK++LEKCQC+MAF PR VIPSE++PYCA+F N+++E F+ F     CI + L KD++L +  K C+K C  QKFNLQISNI W P+LWQLEWL+KLQ+SWN+LID P N ++  KAK  A++FL+A  + EL +  +NS+F  DE YACVVLERLSNET+YKEEKLGLS++GL+SRIG SCTLYLGLTCAFFIEILE++I+ W T  + K E+ ++
Sbjct:   15 FFTNCSVRGVSKAYKSRSLIIKLLWLIFITVMMILMLYSIIKILKEYMEYNTTMQNVLQFEDASDFPAITICPHQPFFQRSIKFFKNKGMSPKDFSLKLRKVAKAFLEKQAPDKAENILFYDNLRSYYQNLKYNESTYIGLTEKEIFVYCITKLKHEMLLGEVEKNCGYVISRYSSPDFFNCYTLNMRPEYLKNTEYIQLILRFPKPHNLSQYMEISFLQTLSRNAIGAQLLIHESGSSPTSTKEKIHIEPNRILQINYRNVYWKEYSTPNDVCLSKKENLNKIIDLENNYTFTFQGCLESYIAKKILEKCQCIMAFFPRSVIPSEKFPYCADFHNITEEGFERFVLSTGCIRKVLNKDQKLSSSDKKCFKVCEEQKFNLQISNIYWEPSLWQLEWLYKLQKSWNILIDSPDNLTLANKAKTVAMKFLSATGLAELSTGYDNSLFNNDEMYACVVLERLSNETYYKEEKLGLSMHGLISRIGASCTLYLGLTCAFFIEILEYLILNWMTRNTGKNEVGRD 534          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000043119.1 (SMESG000043119.1)

HSP 1 Score: 236.884 bits (603), Expect = 3.236e-69
Identity = 168/548 (30.66%), Postives = 288/548 (52.55%), Query Frame = 2
Query:  116 FKRKEFF----NNCSIRGVAKVYKSNSXXXXXXXXXXXXXXXXXXXYSIVKILREYLEYNTTIQTKLQLEDASPFPAITICPYQPFSERAVEYFQN-KGMSPKEFSWKLRKSAKRYLEKDQPHIAESILFYDDLRIYYQNLKYEESTYIGLNDKELFVFCITKLGIGMFFGEVRENCG----YNITRHSSPDFFNCYTIN-VKPEYSLNTEYIHLILRF-PKPKNLEIFQXXXXXXXXXXXXXGAQLLVHERGSSPVSTREKIHIEPNRLLQINYGNNYWKEYSTPNDICLSESKMTEKITDLDNEYSFTFQGCLDSAKAKRVLEKCQCVMAFLPRLVIPSEQYPYCANFRNMSDEDFKEFWKRGRCISETLTKDKELENMYK-NCYKSCIRQKFNLQISNIKWTPTLWQLEWLFKLQQSWNVLIDFPK---NRSIVE-KAKADALRFLNAKDINELISENENSIFQKDEKYACVVLERLSNETFYKEEKLGLSLYGLVSRIGGSCTLYLGLTCAXXXXXXXXXXVLWTEQSHKREIRKEVEVDKIAL 1711
            F+ K FF    +  SIRG+ K+ K    +  +     L +   L+  S + ++R+++ Y+  I TKL+++  +PFPA+T+C + PFS R    +++ K MSP  F+ K+R      L  +    AE+I +YD + IYYQNL YE++  +G N   +F+ C+  L   ++F E   NC     Y I   S  + FNCYT    +P  S N + + +I+   P+PK+ ++ Q   +         G +++VHE G+ P      +H+EP ++ +I Y  N W+  +TP   C++++     + DL N Y++T   CL  A+ + ++ +C C+  + PR ++P+E  PYC +   + D +    +   +C+S+ L +  + +   K  C+  C    F+  IS  KW  T W L WL +   S   +  F K   NR++ E +A    L + N KD+ +      N    KD+ +A +VL R S ++  K E+L ++ Y LVSRIGG C+L +G+T AF +E++EF  +   +++ KR+ +    V+ + L
Sbjct:   55 FQPKNFFILFCSTISIRGINKIIKGPRPLRLLWLCFVLIMSAILITSSCL-LVRDFMLYDVNINTKLEIDSMTPFPALTVCHHHPFSHRGYRMWKSGKAMSPSYFNRKMRNLTLDQLLLNDVESAETISYYDGISIYYQNLPYEQAIQMGHNS-SIFLTCMYLLENQIYFAE---NCTKLEFYRIKLLSHHEHFNCYTFEPTQPHVSSNLDMLGIIVSLGPEPKHFDMEQSFIIDTFRQAQ--GLKVIVHESGTLPDIDEAGLHVEPGKMNEIIYRPNQWQLTNTPAKPCINDTSRIAYV-DLANTYNYTKHLCLKYAEQEDIMNQCHCMFIYNPRPMMPNESMPYCGSI--LKDFNLSNIYSYVKCLSDVLNQKSKRQQWEKEKCFHRCNYMTFDSTISITKWRATEWHLYWLRQQITSLGEMKQFLKANPNRNVTESQAFKTWLIYGNKKDLRK-TGLKANEFLLKDDNFAYIVLRRESKDSVKKYERLVITQYVLVSRIGGLCSLTVGITLAFIVELVEFCYLFSAKETEKRKRKYSNSVENVKL 591          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000062815.1 (SMESG000062815.1)

HSP 1 Score: 236.113 bits (601), Expect = 5.218e-69
Identity = 161/524 (30.73%), Postives = 272/524 (51.91%), Query Frame = 2
Query:  125 KEFFNNCSIRGVAKVYKSNSXXXXXXXXXXXXXXXXXXXYSIVKILREYLEYNTTIQTKLQLEDASPFPAITICPYQPFSERAVEYF-QNKGMSPKEFSWKLRKSAKRYL-----------EKDQPHIAESILFYDDLRIYYQNLKYEESTYIGLNDKELFVFCITKLGIGMFFGEVRENCGYNITRHSSPDFFNCYTINVKPEYSLNTEYIHLILRFPKPKNLEIFQXXXXXXXXXXXXXGAQLLVHERGSSPVSTREKIHIEPNRLLQINYGNNYWKEYSTPNDICLSESKMTEKITDLDNEYSFTFQGCLDSAKAKRVLEKCQCVMAFLPRLVIPSEQYPYCANFRNMSDEDFKEFWKRGRCISETLTKDKELENMY---KNCYKSCIRQKFNLQISNIKWTPTLWQLEWLFKLQQSW----NVL---IDFPKN------RSIVEKAKADALRFLNAKDINELISENENSIFQKDEKYACVVLERLSNETFYKEEKLGLSLYGLVSRIGGSCTLYLGLTCA 1612
            ++FF N SIRG +++ KS +  ++ +WI+F+   +T L+ SI K++ +Y +Y+  IQT +Q+++A+PFPA+T C +QPFSERA + + ++K MSP +F+   R  A +             + D  H        D L +YYQNL    S+ +G N   +   C+   G  M F    ++    +   S P +FNC+T+   P+Y+     + LI+     +   I  +   L  +     G ++++HE  S P    E + IEP RL ++NY      +  T    C++E     +  DLDN + +    C +    +R++ +C+C+  + PR + PS++ PYC     +  E + +   R  CI++   +  ++++     K C  SC   ++    S  KW PT WQL WL ++  +W    N++   I+ P N      R +++   +    F   K+++E I E+E  +F  +E+Y  VV++R +N TF KEE+L LS   LVSR+GG C+LY+GLT A
Sbjct:   18 RKFFANTSIRGFSRIVKSETTFLRTLWILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTTINDRLSVYYQNLPTTVSSELGHN-ISIIKNCVWSYGQHMAFDNHCQDDMLIVKNISHPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYR--DLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCG---YLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIMLQNLTSRIETFFTRKNLSEFIPESEKLLF--NERYTFVVVKRKANNTFIKEERLVLSFNALVSRVGGLCSLYIGLTFA 533          
The following BLAST results are available for this feature:
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q25011|FANA_CORAP4.632e-1020.22FMRFamide-activated amiloride-sensitive sodium cha... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8H6N92.199e-6932.15Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A183TB062.238e-6330.34Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A1I8G5D01.188e-6029.42G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A074ZXV43.799e-6028.65Uncharacterized protein OS=Opisthorchis viverrini ... [more]
H2KTS48.691e-6028.47FMRFamide-activated amiloride-sensitive sodium cha... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053391.10.000e+099.61SMESG000053391.1[more]
SMESG000053382.10.000e+065.63SMESG000053382.1[more]
SMESG000053390.10.000e+065.38SMESG000053390.1[more]
SMESG000043119.13.236e-6930.66SMESG000043119.1[more]
SMESG000062815.15.218e-6930.73SMESG000062815.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003924 ID=SMED30003924|Name=FMRFamide-activated amiloride-sensitive sodium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=1828bp
CGCAGAAAATGCTTCATGTTCTAACCAATTGTATTGAAATTCTTAACAAT
ATGAAAAATAAATTTTTTTACTAGAAATATAACCTTTCAAAATGAAAATA
CGAAATAGTGGAAAGTTCAAAAGGAAAGAATTCTTCAACAATTGTTCCAT
AAGAGGAGTTGCAAAAGTTTATAAATCAAATTCCAAAATAATAAAAATAA
TGTGGATAATTTTTCTATTTATAATGATGACACTGCTGTTGTATTCAATA
GTCAAAATCCTTAGGGAATATCTGGAATACAATACGACAATACAGACGAA
ACTGCAACTTGAAGATGCGTCTCCGTTTCCAGCAATTACCATTTGCCCAT
ATCAACCGTTTTCGGAGAGAGCTGTAGAATATTTCCAAAATAAAGGAATG
TCGCCTAAAGAATTTAGTTGGAAGCTAAGAAAATCCGCCAAAAGATATTT
GGAAAAAGACCAACCTCACATTGCAGAATCCATTTTGTTTTATGATGATT
TGAGAATTTATTATCAAAACCTAAAATACGAAGAGTCAACTTATATAGGA
TTAAATGATAAAGAGCTATTTGTGTTTTGTATAACAAAATTGGGTATCGG
AATGTTTTTTGGAGAGGTTCGAGAAAACTGTGGATATAATATCACCCGGC
ACAGTAGTCCCGACTTTTTCAATTGCTACACAATAAACGTCAAACCTGAA
TATTCCCTCAATACAGAGTATATTCATTTAATTTTACGATTTCCTAAACC
AAAAAACCTAGAAATATTTCAAAAGATCTCTCTCTTAAAGTCTCTTTCTT
TAAACATAATTGGTGCCCAATTGCTTGTTCACGAGAGAGGCAGTTCACCC
GTGAGTACAAGGGAAAAAATTCATATCGAACCCAATCGCCTTTTGCAAAT
TAATTATGGAAATAATTATTGGAAAGAATATAGTACACCAAATGACATAT
GTTTATCAGAAAGCAAAATGACCGAAAAGATTACCGATTTAGATAATGAA
TATTCTTTTACGTTTCAAGGATGTTTAGATTCTGCAAAAGCAAAAAGAGT
CTTAGAGAAATGTCAATGCGTAATGGCATTTCTACCGAGACTGGTGATAC
CCTCAGAACAATATCCATACTGTGCTAATTTCCGAAACATGAGTGATGAA
GACTTCAAAGAATTTTGGAAAAGAGGAAGATGTATTTCCGAAACTCTTAC
AAAAGATAAAGAACTGGAAAATATGTATAAAAATTGCTACAAAAGCTGCA
TTCGACAAAAGTTCAACTTGCAAATATCAAACATAAAATGGACTCCGACT
CTTTGGCAGCTAGAATGGTTGTTTAAGTTACAGCAGTCATGGAATGTTTT
AATAGATTTCCCAAAGAACCGATCTATCGTTGAAAAGGCTAAAGCAGACG
CATTGAGGTTTTTGAATGCAAAAGATATAAATGAACTTATTTCTGAGAAT
GAAAATTCTATATTTCAAAAAGACGAAAAATATGCATGTGTAGTTTTGGA
AAGACTTTCAAATGAAACATTCTACAAGGAGGAGAAATTAGGGTTGAGTT
TATATGGGTTAGTGAGTAGAATCGGAGGGTCATGTACTCTTTATTTGGGG
CTTACATGCGCCTTTTTTATTGAGATTCTAGAATTTATCATTGTATTATG
GACCGAGCAGTCACATAAAAGGGAAATTCGTAAGGAAGTTGAAGTTGATA
AAATTGCATTGAATCAACCCCCTATTGGACCTTGTAGAGATATGGCAATT
GTTTCAGAAGATGATTTTAATAATATTCAGTGATATATATTTATAAATTG
TGTTAAATATATTGCTAATATATGTCAT
back to top

protein sequence of SMED30003924-orf-1

>SMED30003924-orf-1 ID=SMED30003924-orf-1|Name=SMED30003924-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=564bp
MKIRNSGKFKRKEFFNNCSIRGVAKVYKSNSKIIKIMWIIFLFIMMTLLL
YSIVKILREYLEYNTTIQTKLQLEDASPFPAITICPYQPFSERAVEYFQN
KGMSPKEFSWKLRKSAKRYLEKDQPHIAESILFYDDLRIYYQNLKYEEST
YIGLNDKELFVFCITKLGIGMFFGEVRENCGYNITRHSSPDFFNCYTINV
KPEYSLNTEYIHLILRFPKPKNLEIFQKISLLKSLSLNIIGAQLLVHERG
SSPVSTREKIHIEPNRLLQINYGNNYWKEYSTPNDICLSESKMTEKITDL
DNEYSFTFQGCLDSAKAKRVLEKCQCVMAFLPRLVIPSEQYPYCANFRNM
SDEDFKEFWKRGRCISETLTKDKELENMYKNCYKSCIRQKFNLQISNIKW
TPTLWQLEWLFKLQQSWNVLIDFPKNRSIVEKAKADALRFLNAKDINELI
SENENSIFQKDEKYACVVLERLSNETFYKEEKLGLSLYGLVSRIGGSCTL
YLGLTCAFFIEILEFIIVLWTEQSHKREIRKEVEVDKIALNQPPIGPCRD
MAIVSEDDFNNIQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPRINTSPR01078AMINACHANNELcoord: 75..91
score: 41.88
coord: 35..52
score: 16.89
coord: 317..334
score: 22.89
coord: 241..259
score: 25.89
coord: 382..402
score: 24.57
coord: 183..199
score: 38.35
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 14..515
e-value: 9.5E-50
score: 169.8
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 9..528
NoneNo IPR availablePANTHERPTHR11690:SF222PICKPOCKET 6-RELATEDcoord: 9..528
NoneNo IPR availableTMHMMTMhelixcoord: 36..54
NoneNo IPR availableTMHMMTMhelixcoord: 499..521