Nuclear cap-binding protein subunit 1

Overview
NameNuclear cap-binding protein subunit 1
Smed IDSMED30003920
Length (bp)3131
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nuclear cap-binding protein subunit 1 (SMED30003920) t-SNE clustered cells

Violin plots show distribution of expression levels for Nuclear cap-binding protein subunit 1 (SMED30003920) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nuclear cap-binding protein subunit 1 (SMED30003920) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nuclear cap-binding protein subunit 1 (SMED30003920) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003920

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30003920h1SMcG0012850 SmedASXL_012088SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30003920h1SMcG0012850 SmedASXL_012088SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30003920h1SMcG0012850 dd_Smed_v4_6140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003920h1SMcG0012850 dd_Smed_v4_6140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003920h1SMcG0012850 dd_Smed_v4_6140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30003920h1SMcG0012850 dd_Smed_v4_6140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30003920h1SMcG0012850 dd_Smed_v4_6140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Human
Match: NCBP1 (nuclear cap binding protein subunit 1 [Source:HGNC Symbol;Acc:HGNC:7658])

HSP 1 Score: 420.624 bits (1080), Expect = 4.170e-132
Identity = 214/574 (37.28%), Postives = 338/574 (58.89%), Query Frame = 3
Query:   48 MSRRKRSPDSSDEEYNDKSKRFVGHHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLYNDPNLAI--LVQQSRPHKLPQLSLTLST--SVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDGAPKTLSCQKIARELATMIKSQGKIDEIIDFLRKISD 1757
            MSRR+ S D +D     K ++    ++ ++ LE+LI ++G+K   +L ++L+ +A +L+ D    K +IL +L   A  +PEKLTIY TL+GL+N ++Y+ G EFVE +++  KE++K  N+++  +L+RF+SDL+N  VI   S++ ++   ++   E++ PQ+  DW VY  + SLPW   +L  +  +E+D++  N E Y+++R   H+ +LQVWT+++  PQE+++DCLW Q++ ++   W+E+ + R    P LA   ++ ++  H LP  +    T  SVYP+P VIFR+FDYT                          D+PE  V                 +PGSHS+ERF++EE    I+      RK CA  L++ P + ++P++Y IVE I  ELF+LP      V YT+LLIELC+    S+P VLAQATEML+ R++ M   C++RF+ WFSHHLSNF+F+WSW DW+ C+    + PK +F+ EVL++ +R SY + +  IVP  F+ L P  P  + KYGD +  +L    +A  LA   KS+   DEI   L+ + +
Sbjct:    1 MSRRRHS-DENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANNYNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVSVTQEEDVPQVRRDWYVYAFLSSLPWVGKELYEKKDAEMDRIFANTESYLKRRQKTHVPMLQVWTADKPHPQEEYLDCLWAQIQKLKKDRWQERHILR----PYLAFDSILCEALQHNLPPFTPPPHTEDSVYPMPRVIFRMFDYT--------------------------DDPEGPV-----------------MPGSHSVERFVIEENLHCIIKSHWKERKTCAAQLVSYPGKNKIPLNYHIVEVIFAELFQLPAPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMLYMRLDTMNTTCVDRFINWFSHHLSNFQFRWSWEDWSDCLSQDPESPKPKFVREVLEKCMRLSYHQRILDIVPPTFSALCPANPTCIYKYGDESSNSLPGHSVALCLAVAFKSKATNDEIFSILKDVPN 526          

HSP 2 Score: 73.559 bits (179), Expect = 1.731e-12
Identity = 29/104 (27.88%), Postives = 62/104 (59.62%), Query Frame = 3
Query: 1977 IDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLAR 2288
            I+V +  +L+L +K+F+H+F  L KF +V K   + +  K+ +L  ++ VW+   QM+ V+ ++++  +++   A+  W+FS E+       +VWEI+ + + +
Sbjct:  544 IEVFVQTLLHLAAKSFSHSFSALAKFHEVFKTLAESDEGKLHVLRVMFEVWRNHPQMIAVLVDKMIRTQIVDCAAVANWIFSSELSRDFTRLFVWEILHSTIRK 647          
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Celegans
Match: ncbp-1 (Nuclear cap-binding protein subunit 1 [Source:UniProtKB/Swiss-Prot;Acc:O01763])

HSP 1 Score: 267.7 bits (683), Expect = 3.743e-76
Identity = 156/529 (29.49%), Postives = 267/529 (50.47%), Query Frame = 3
Query:   48 MSRRKRSPDSSDEEYNDKSKRFVGHHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEF-QPQEDFMDCLWNQLKNMRMQSWREKVLWRLYNDPNLAILVQQSRPHKLPQLSLTLSTS--VYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMR-VRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPP 1622
            MSRR R  D  DE    + +      DV++ L+ +I ++G+    ++  +L  + + L  D    +  I++I+  CA  +P ++T+Y TL+GL+N K+++ G + VE L+   ++ +    + + + L  F+ DL N+ V+  QSI       IA A E+N PQ+ +D+ +  V+  LPW   +L  +   +++ + + I  Y+E R  +H+ +LQVW      Q QED+++ L  Q++ +R   W E  + R Y+       +Q +  H LP       TS  +YP P+V+FRLF   D                                        SKP      LPG  SI+RFL E +   I+   + NRK CA+ L+A       +P+ ++I ETI G++ +LP +    + + SL++EL +   +  P +L Q  E ++ R + M+PVCI+R V WFS HLSNF+++++W+DW  C+          F+ EV+++  RF  +E +   +P +F ++ P  P
Sbjct:    1 MSRR-RQFDDEDEVQMKRRRGAPLIEDVEKKLQGVIGKVGENTGSSIECNLDKLTAFLHDDLEKYRASIIDIIAGCAIYLPNRVTVYTTLVGLLNSKNFNFGGDVVEKLISEQQDLLSKQKYQEAQNLAIFLCDLGNSGVLTAQSIGEYLESFIAAAFEENMPQVRNDYYIQTVLRCLPWIGKELTEKAPEQMENIGEAIGKYLELRNKNHVALLQVWREGSTDQKQEDYLESLSAQIEALRNADWVENHIPRHYS--GFETTLQDALQHNLPSFQSPEHTSDMIYPYPLVVFRLFQDADC-----------------------------------SAFSSKP------LPGDSSIDRFLFEGEIAWIIEKNQFNRKACARELLAFAEENPSVPIGFLIFETIFGQMLRLPHAPYPAIFHCSLVLELLKLKPDDYPQILVQTVECIYRRADSMQPVCIDRMVDWFSFHLSNFQYRYTWTDWKDCLNKDAFSGSQIFVREVIEKCRRFGSYEKIIAALPQDFVKIHPCSP 485          

HSP 2 Score: 69.707 bits (169), Expect = 9.678e-12
Identity = 49/226 (21.68%), Postives = 118/226 (52.21%), Query Frame = 3
Query: 1983 VLMTVILNLGSKTFTHAFLYLDKFRDVIKEFV-KEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLARASLEENCAWNKLQEM--------EDANDENEDVKITAKQKYAQSRKIYMDLVTQSLAGIVCRLNQYST-KQSVSSRFQLDLVEMLVYFSSNPANPGSGPAPSLAITDETRTWLLGRVENLLLS 2630
            + + V+L + SKT++H F  L +++  +K      E  + ++L +LY  W+  QQM++++T++LL++++I   A++ WLF ++M+ + +  +++E+++  L + + + N     ++E+        ++ +DE  D+K+   +   +  K   DL  + L     +L +  T ++ + + F +  +E +   +++  +   G   +         WL GR  ++LL+
Sbjct:  540 LFVMVMLKMASKTYSHNFSALFRYQTTLKTVCDASELYQEKLLETLYSCWKTNQQMLMILTDKLLKMQVIDCSAVVGWLFDEKMWQEHDRQWLFEVLNQALEKLTRQINVVEKDIKELTEKTENKIKEEDDEESDIKMDEDE--TKEEKFKQDL--EDLENNKEKLERMVTFQKGLFNDFLIAFIEEIKNAATSNTSEMDGSGDTPGTQTPKFMWLRGRFCHVLLA 761          
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Fly
Match: Cbp80 (gene:FBgn0022942 transcript:FBtr0070683)

HSP 1 Score: 398.282 bits (1022), Expect = 5.982e-124
Identity = 208/575 (36.17%), Postives = 327/575 (56.87%), Query Frame = 3
Query:   48 MSRRKRSPDSSDEEYN---DKSKRFVGHHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLY--NDPNLAILVQQSRPHKLPQLSLTLSTSVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDGAPKTLSCQKIARELATMIKSQGKIDEIIDFLRKISD 1757
            MSRR R+ D+ DE Y+   +K +R   + ++++ LE+LI  +G++   ++ ++L+ + S+L+ D    + +IL IL +CA  +PEK T+Y TL+GL+N K+Y  G EFV+ ++K FKE++K    D  ++ LRF++DL+N  VI   S++ L + +I  + ED  PQ+  DW V+ V+ +LPW    L  +  S L+ ++  IE+Y+ KR   H   L+VW+S+   PQE+++DCLW Q++ +R  +W EK + R Y   D  L   +Q + P  +P          YP+P V++R+FDYTD                         D P                     LPG+HSIERFL+EE    I+      RK CA  L++ P + ++P+ Y IVE +  ELF +P      +CY S+LIELC+    ++P VLAQATE+LF RI+ M   C +RFV WFS+HLSNFKF WSW +W SC+    + P+ +FI EVLQ+ LR SY + +++++P  +A+L+P  P    KY +     L    +A +L   I+ +   +E+++ L+ I +
Sbjct:    1 MSRR-RAHDTEDEGYDHRRNKRRRVSENQEIEDRLESLILRVGERSTSSVESNLEGLVSVLEADLGTFRLKILRILSDCAVRMPEKCTVYTTLVGLLNAKNYKFGGEFVDHMVKTFKESLKMCRWDAARYSLRFLADLVNCHVISATSLLQLLDTMIDVSNEDTVPQVRRDWFVFAVLSTLPWVGRDLYEKKESALESLLLRIEVYLNKRSKKHHNALRVWSSDAPHPQEEYLDCLWAQIRKLRQDNWAEKHIPRPYLVFDSILCEALQHNLPTIVPPPH--HDNFEYPMPWVVYRMFDYTD-----------------------CPDGPN--------------------LPGAHSIERFLIEEHLHHIIETYHHERKDCAAQLLSFPYKHKIPLEYCIVEVVFAELFHMPTPRYLDICYGSILIELCKLQPATLPQVLAQATEILFMRIDSMNTSCFDRFVNWFSYHLSNFKFTWSWDEWDSCLLLDGEHPRPKFIQEVLQKCLRLSYHQRITEMMPTTYAKLIPLTPVPNYKYANEEAANLPGTTVAHQLVVAIRQKCTPEEVVNILKDIPN 529          

HSP 2 Score: 87.8113 bits (216), Expect = 3.154e-17
Identity = 36/104 (34.62%), Postives = 67/104 (64.42%), Query Frame = 3
Query: 1977 IDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLAR 2288
            IDV +  +LNLGSK+F+H+F  + KF  V +   + E  ++ +LH+++ +W   QQM+VV+ ++LL+++++   A+  W+FS EM  +    Y+WEI+   + +
Sbjct:  547 IDVFVQTLLNLGSKSFSHSFAAISKFHSVFRALAETEEAQICILHNIFELWSSHQQMMVVLIDKLLKLQIVDCSAVATWIFSKEMTGEFTKLYLWEILHLTIKK 650          
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Fly
Match: Cbp80 (gene:FBgn0022942 transcript:FBtr0070684)

HSP 1 Score: 398.282 bits (1022), Expect = 5.982e-124
Identity = 208/575 (36.17%), Postives = 327/575 (56.87%), Query Frame = 3
Query:   48 MSRRKRSPDSSDEEYN---DKSKRFVGHHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLY--NDPNLAILVQQSRPHKLPQLSLTLSTSVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDGAPKTLSCQKIARELATMIKSQGKIDEIIDFLRKISD 1757
            MSRR R+ D+ DE Y+   +K +R   + ++++ LE+LI  +G++   ++ ++L+ + S+L+ D    + +IL IL +CA  +PEK T+Y TL+GL+N K+Y  G EFV+ ++K FKE++K    D  ++ LRF++DL+N  VI   S++ L + +I  + ED  PQ+  DW V+ V+ +LPW    L  +  S L+ ++  IE+Y+ KR   H   L+VW+S+   PQE+++DCLW Q++ +R  +W EK + R Y   D  L   +Q + P  +P          YP+P V++R+FDYTD                         D P                     LPG+HSIERFL+EE    I+      RK CA  L++ P + ++P+ Y IVE +  ELF +P      +CY S+LIELC+    ++P VLAQATE+LF RI+ M   C +RFV WFS+HLSNFKF WSW +W SC+    + P+ +FI EVLQ+ LR SY + +++++P  +A+L+P  P    KY +     L    +A +L   I+ +   +E+++ L+ I +
Sbjct:    1 MSRR-RAHDTEDEGYDHRRNKRRRVSENQEIEDRLESLILRVGERSTSSVESNLEGLVSVLEADLGTFRLKILRILSDCAVRMPEKCTVYTTLVGLLNAKNYKFGGEFVDHMVKTFKESLKMCRWDAARYSLRFLADLVNCHVISATSLLQLLDTMIDVSNEDTVPQVRRDWFVFAVLSTLPWVGRDLYEKKESALESLLLRIEVYLNKRSKKHHNALRVWSSDAPHPQEEYLDCLWAQIRKLRQDNWAEKHIPRPYLVFDSILCEALQHNLPTIVPPPH--HDNFEYPMPWVVYRMFDYTD-----------------------CPDGPN--------------------LPGAHSIERFLIEEHLHHIIETYHHERKDCAAQLLSFPYKHKIPLEYCIVEVVFAELFHMPTPRYLDICYGSILIELCKLQPATLPQVLAQATEILFMRIDSMNTSCFDRFVNWFSYHLSNFKFTWSWDEWDSCLLLDGEHPRPKFIQEVLQKCLRLSYHQRITEMMPTTYAKLIPLTPVPNYKYANEEAANLPGTTVAHQLVVAIRQKCTPEEVVNILKDIPN 529          

HSP 2 Score: 87.8113 bits (216), Expect = 3.154e-17
Identity = 36/104 (34.62%), Postives = 67/104 (64.42%), Query Frame = 3
Query: 1977 IDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLAR 2288
            IDV +  +LNLGSK+F+H+F  + KF  V +   + E  ++ +LH+++ +W   QQM+VV+ ++LL+++++   A+  W+FS EM  +    Y+WEI+   + +
Sbjct:  547 IDVFVQTLLNLGSKSFSHSFAAISKFHSVFRALAETEEAQICILHNIFELWSSHQQMMVVLIDKLLKLQIVDCSAVATWIFSKEMTGEFTKLYLWEILHLTIKK 650          
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Fly
Match: CG7907 (gene:FBgn0038887 transcript:FBtr0113261)

HSP 1 Score: 237.269 bits (604), Expect = 1.025e-65
Identity = 203/765 (26.54%), Postives = 342/765 (44.71%), Query Frame = 3
Query:   48 MSRRKRSPDSSDEEYNDKSKRFVGHHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSI-MKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLI--AQALEDN------TPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWRE---KVLWRLYNDPNLAILVQQSRPHKLPQLSLTLS--TSVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPM-RVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKP--PGSVNKYGDGAPKTLSCQKIARELATMIKSQGKIDEIIDFLRKISDDRVLIVSAXXXXXXXXXXXVNEDV--KITNNEESENLNVEKMEPENYEEDIVETSENIEATHIVSGLYPGVTRRVIDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDK-VEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVL 2282
            M RRKR  DSSDEE +D  ++      V+ T+E L+ EL       L   L ++  +L K  S+ +K  ++  LV C    P + + Y TL+GL+N  D+  G E +  +     E++   + +  + ++  M DL +  V+    I+ L    +   +AL+D       TPQ+  D+L Y V+ ++P     L  +  +  DK++ +++IY++KR   H  +L VW   +F  Q D+++ LW Q+  MR   W E   +++ R Y   + +  +   R H+L    L        YPLP V FR+F                   S D    I    P V                        SIER L+E     I+      RK+CA +L+     + +LPV Y IVE ILGE+ +LP ++ + + Y S+L+ELC+   + IP V+AQA +++++R+  M   C +R V W SHH+SNF F   W                                        +++A+ LP P  P + N      PK +  +++ ++   +   Q   D + D L       VL             + V+E +   I + +  E +   +  PE   E I+++S         +G+ P +    I+V     L+LGSK+F+H F  L K+  V K+ V  + ++   +L+ ++ VW    Q   V+TE+L+   +I P +++ W+F   M  +    Y+WE++ + L
Sbjct:    1 MGRRKRE-DSSDEEGDDCRQKRTAETTVK-TVEQLMRELSFPGHTPLELKLGNLGYLLGKGMSVDLKENLINELVICLGYYPGQASAYATLVGLINVADFEFGSECLLFMAHKVGESVHIRDWNRCRGVVHCMVDLYHCQVLPSSYILKLLAAFLKDCEALKDPDDLVGVTPQIRRDFLAYCVLSAMPLIGRDLEGE--TAFDKLIVSLQIYIKKRSALHTNMLSVWP--DFN-QRDYLELLWQQVDGMRQNHWAEPEHQLIPRPYK--SFSETLSHGRIHQLRDYDLAAHEERCRYPLPRVCFRIF-------------------SCDSVGEIPNMPPPV------------------------SIERHLLEAHILDILISFHKERKICADSLLMYAASKPQLPVYYCIVEVILGEMLRLPTANWSTIAYGSILVELCKRQPDKIPQVVAQALDIIYNRLNSMSVACFDRLVNWVSHHISNFGFNCQW----------------------------------------SKWAQGLPSPIDPSATNL----QPKVVFLRELLKKCFRLSYHQRIKDVVPDILADFLPPPVL----------PHFKFVDETLPGAILSKDLLEAMRSPQASPEMISE-IIKSS---------TGIGPLLK---INVFTQNCLHLGSKSFSHTFGILRKYHSVFKDLVAGDPERQAAVLNGIFDVWVASDQYKFVVTEKLVTGLIIEPISVVRWIFGPSMRKELTKIYIWELLHSAL 646          
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Fly
Match: CG7907 (gene:FBgn0038887 transcript:FBtr0113262)

HSP 1 Score: 237.269 bits (604), Expect = 1.025e-65
Identity = 203/765 (26.54%), Postives = 342/765 (44.71%), Query Frame = 3
Query:   48 MSRRKRSPDSSDEEYNDKSKRFVGHHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSI-MKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLI--AQALEDN------TPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWRE---KVLWRLYNDPNLAILVQQSRPHKLPQLSLTLS--TSVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPM-RVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKP--PGSVNKYGDGAPKTLSCQKIARELATMIKSQGKIDEIIDFLRKISDDRVLIVSAXXXXXXXXXXXVNEDV--KITNNEESENLNVEKMEPENYEEDIVETSENIEATHIVSGLYPGVTRRVIDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDK-VEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVL 2282
            M RRKR  DSSDEE +D  ++      V+ T+E L+ EL       L   L ++  +L K  S+ +K  ++  LV C    P + + Y TL+GL+N  D+  G E +  +     E++   + +  + ++  M DL +  V+    I+ L    +   +AL+D       TPQ+  D+L Y V+ ++P     L  +  +  DK++ +++IY++KR   H  +L VW   +F  Q D+++ LW Q+  MR   W E   +++ R Y   + +  +   R H+L    L        YPLP V FR+F                   S D    I    P V                        SIER L+E     I+      RK+CA +L+     + +LPV Y IVE ILGE+ +LP ++ + + Y S+L+ELC+   + IP V+AQA +++++R+  M   C +R V W SHH+SNF F   W                                        +++A+ LP P  P + N      PK +  +++ ++   +   Q   D + D L       VL             + V+E +   I + +  E +   +  PE   E I+++S         +G+ P +    I+V     L+LGSK+F+H F  L K+  V K+ V  + ++   +L+ ++ VW    Q   V+TE+L+   +I P +++ W+F   M  +    Y+WE++ + L
Sbjct:    1 MGRRKRE-DSSDEEGDDCRQKRTAETTVK-TVEQLMRELSFPGHTPLELKLGNLGYLLGKGMSVDLKENLINELVICLGYYPGQASAYATLVGLINVADFEFGSECLLFMAHKVGESVHIRDWNRCRGVVHCMVDLYHCQVLPSSYILKLLAAFLKDCEALKDPDDLVGVTPQIRRDFLAYCVLSAMPLIGRDLEGE--TAFDKLIVSLQIYIKKRSALHTNMLSVWP--DFN-QRDYLELLWQQVDGMRQNHWAEPEHQLIPRPYK--SFSETLSHGRIHQLRDYDLAAHEERCRYPLPRVCFRIF-------------------SCDSVGEIPNMPPPV------------------------SIERHLLEAHILDILISFHKERKICADSLLMYAASKPQLPVYYCIVEVILGEMLRLPTANWSTIAYGSILVELCKRQPDKIPQVVAQALDIIYNRLNSMSVACFDRLVNWVSHHISNFGFNCQW----------------------------------------SKWAQGLPSPIDPSATNL----QPKVVFLRELLKKCFRLSYHQRIKDVVPDILADFLPPPVL----------PHFKFVDETLPGAILSKDLLEAMRSPQASPEMISE-IIKSS---------TGIGPLLK---INVFTQNCLHLGSKSFSHTFGILRKYHSVFKDLVAGDPERQAAVLNGIFDVWVASDQYKFVVTEKLVTGLIIEPISVVRWIFGPSMRKELTKIYIWELLHSAL 646          
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Xenopus
Match: ncbp1 (nuclear cap binding protein subunit 1 [Source:NCBI gene;Acc:448484])

HSP 1 Score: 425.631 bits (1093), Expect = 4.575e-134
Identity = 216/574 (37.63%), Postives = 340/574 (59.23%), Query Frame = 3
Query:   48 MSRRKRSPDSSDEEYNDKSKRFVGHHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLYNDPNLAI--LVQQSRPHKLPQLSLTLST--SVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDGAPKTLSCQKIARELATMIKSQGKIDEIIDFLRKISD 1757
            MSRR+ S D +D   + K ++     ++++ LE+LI  +G+K   +L ++L+ +A +L+ D    K +IL IL + A  +PEK+T+Y TL+GL+N ++Y+ G EFVE +++H KE IK   +++  +L+RF+ DL+N  VI   S++ ++   +    E++ PQ+ SDW VY V+ SLPW   +L  +   E+D+++  IE Y+++R   H+ ILQVW++ +  PQE+++DCLW Q++ ++   W+E+ + R    P LA   ++ ++  H LP  +    T  SVYP+P V+FR+FDYTD                                           A E  ++PGSHS+ERF++EE    I+      RK CA  L++ P + ++P++Y IVE I GELF+LP      V YT+LLIELC+    S+P VLAQA+EML+ R++ M  +CI+RF+ WFSHHLSNF+F+W+W DW+ C+   +DKPK +F+ EVL++ +R SY + +  IVPA F+ L P  P  V KYGD +   L    +A  L   IK++    EI + L+ I +
Sbjct:    1 MSRRRHS-DENDGGPHHKRRKTSEPLEIEDRLESLICRVGEKSTSSLESNLEGLAGVLEADLPNYKSKILRILCSVARTLPEKMTVYTTLVGLLNARNYNFGGEFVEAMIRHLKETIKLNAYNEAVYLVRFLCDLVNCHVIAAPSMVAMFESFVGVTQEEDIPQVRSDWYVYAVLSSLPWVGKELYEKKDVEMDRILSQIEAYLKQRQKLHVSILQVWSAEKPHPQEEYLDCLWAQIQKLKKDRWQERHILR----PYLAFDSVLCEALQHNLPPFTPPPHTEDSVYPVPRVVFRMFDYTD-------------------------------------------APEGPVMPGSHSVERFVIEENLHCILRSHWRERKTCAAQLLSYPEKNKIPLNYQIVEVIFGELFQLPNPPHLDVMYTTLLIELCKLQPGSLPQVLAQASEMLYTRLDTMNTICIDRFINWFSHHLSNFQFRWNWEDWSDCLSQDLDKPKPQFVREVLEKCMRLSYHQRILDIVPAAFSALYPASPSCVFKYGDESNSALPGYSVAVALTNAIKNKASDKEIFNILKDIPN 526          

HSP 2 Score: 80.1073 bits (196), Expect = 1.367e-14
Identity = 37/138 (26.81%), Postives = 77/138 (55.80%), Query Frame = 3
Query: 1977 IDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLARASLEENCAWNKLQEME----------DANDENED 2360
            I+V +  +L+L SK+F+H+F  L KF D+ K   + +  K+ +L  +Y +W+   QM+ V+ ++++  +++   A+  W+FS E+      FY+WEI+ + + + +        +L++M+          D++D +ED
Sbjct:  544 IEVFVQTLLSLASKSFSHSFSALAKFHDIFKALSESDEGKLHILRVVYDIWKNHPQMIAVLVDKMIRTQIVDCAAVANWIFSPELSRDFPRFYIWEILHSTIRKMNKHVQKIQKELEDMKLRLAKQHKHRDSDDNDED 681          
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Xenopus
Match: ncbp1 (nuclear cap binding protein subunit 1 [Source:NCBI gene;Acc:448484])

HSP 1 Score: 316.235 bits (809), Expect = 1.363e-97
Identity = 167/460 (36.30%), Postives = 269/460 (58.48%), Query Frame = 3
Query:   48 MSRRKRSPDSSDEEYNDKSKRFVGHHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLYNDPNLAI--LVQQSRPHKLPQLSLTLST--SVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIER 1415
            MSRR+ S D +D   + K ++     ++++ LE+LI  +G+K   +L ++L+ +A +L+ D    K +IL IL + A  +PEK+T+Y TL+GL+N ++Y+ G EFVE +++H KE IK   +++  +L+RF+ DL+N  VI   S++ ++   +    E++ PQ+ SDW VY V+ SLPW   +L  +   E+D+++  IE Y+++R   H+ ILQVW++ +  PQE+++DCLW Q++ ++   W+E+ + R    P LA   ++ ++  H LP  +    T  SVYP+P V+FR+FDYTD                                           A E  ++PGSHS+ERF++EE    I+      RK CA  L++ P + ++P++Y IVE I GELF+LP      V YT+LLIELC+    S+P VLAQA+EML+ R++ M  +CI+R
Sbjct:    1 MSRRRHS-DENDGGPHHKRRKTSEPLEIEDRLESLICRVGEKSTSSLESNLEGLAGVLEADLPNYKSKILRILCSVARTLPEKMTVYTTLVGLLNARNYNFGGEFVEAMIRHLKETIKLNAYNEAVYLVRFLCDLVNCHVIAAPSMVAMFESFVGVTQEEDIPQVRSDWYVYAVLSSLPWVGKELYEKKDVEMDRILSQIEAYLKQRQKLHVSILQVWSAEKPHPQEEYLDCLWAQIQKLKKDRWQERHILR----PYLAFDSVLCEALQHNLPPFTPPPHTEDSVYPVPRVVFRMFDYTD-------------------------------------------APEGPVMPGSHSVERFVIEENLHCILRSHWRERKTCAAQLLSYPEKNKIPLNYQIVEVIFGELFQLPNPPHLDVMYTTLLIELCKLQPGSLPQVLAQASEMLYTRLDTMNTICIDR 412          
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Mouse
Match: Ncbp1 (nuclear cap binding protein subunit 1 [Source:MGI Symbol;Acc:MGI:1891840])

HSP 1 Score: 460.299 bits (1183), Expect = 2.442e-147
Identity = 243/751 (32.36%), Postives = 409/751 (54.46%), Query Frame = 3
Query:   48 MSRRKRSPDSSDEEYNDKSKRFVGHHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLYNDPNLAI--LVQQSRPHKLPQLSLTLST--SVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDGAPKTLSCQKIARELATMIKSQGKIDEIIDFLRKISDDRVLIVSAXXXXXXXXXXXVNEDVKITNNEESENLNVEKMEPENYEEDIVETSENIEATHIVSGLYPGVTRRVIDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLAR 2288
            MSRR+ S ++ D     K ++    ++ ++ LE+LI ++G+K   +L ++L+ +A +L+ D    K +IL +L   A  +PEKLTIY TL+GL+N ++Y+ G EFVE +++  KE++K  N+++  +L+RF+SDL+N  VI   S++ ++   ++   E++ PQ+  DW VY  + SLPW   +L  +  +E+D++    E Y+++R   H+ +LQVWT+++  PQE+++DCLW Q++ ++   W+E+ + R    P LA   ++ ++  H LP  +    T  SVYP+P VIFR+FDYT                          D+PE  V                 +PGSHS+ERF++EE    I+      RK CA  L++ P + ++P++Y IVE I  ELF+LP      V YT+LLIELC+    S+P VLAQATEML+ R++ M   C++RF+ WFSHHLSNF+F+WSW DW+ C+   ++ PK +F+ EVL++ +R SY +++  IVP  F+ L P  P  + KYGD +  +L    +A  L+   KS+   DEI   L+ + +                        ++ +++E    N  K+E                                  V +  +L+L +K+F+H+F  L KF +V K   + +  K+ +L  ++ VW+   QM+ V+ ++++  +++   A+  W+FS E+       +VWEI+ + + +
Sbjct:    1 MSRRRHSYEN-DGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANNYNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVSVTQEEDVPQVRRDWYVYAFLSSLPWVGKELYEKKDAEMDRIFSTTESYLKRRQKTHVPMLQVWTADKPHPQEEYLDCLWAQIQKLKKDRWQERHILR----PYLAFDSILCEALQHNLPPFTPPPHTEDSVYPMPRVIFRMFDYT--------------------------DDPEGPV-----------------MPGSHSVERFVIEENLHCIIKSYWKERKTCAAQLVSYPGKNKIPLNYHIVEVIFAELFQLPAPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMLYMRLDTMSTTCVDRFINWFSHHLSNFQFRWSWEDWSDCLTQDLESPKPKFVREVLEKCMRLSYHQHILDIVPPTFSALCPANPTCIYKYGDESSNSLPGHSVALCLSVAFKSKATNDEIFSILKDVPNPN----------------------QVDDDDEGFRFNPLKIE----------------------------------VFVQTLLHLAAKSFSHSFSALAKFHEVFKTLAESDKGKLHVLRVMFEVWRNHPQMIAVLVDKMIRTQIVDCAAVANWIFSSELSRDFTRLFVWEILHSTIRK 647          
BLAST of Nuclear cap-binding protein subunit 1 vs. UniProt/SwissProt
Match: sp|Q6GQD0|NBP1B_XENLA (Nuclear cap-binding protein subunit 1-B OS=Xenopus laevis OX=8355 GN=ncbp1-b PE=2 SV=1)

HSP 1 Score: 474.937 bits (1221), Expect = 4.451e-152
Identity = 259/751 (34.49%), Postives = 410/751 (54.59%), Query Frame = 3
Query:   48 MSRRKRSPDSSDEEYNDKSKRFVGHHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLYNDPNLAI--LVQQSRPHKLPQLSLTLST--SVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDGAPKTLSCQKIARELATMIKSQGKIDEIIDFLRKISDDRVLIVSAXXXXXXXXXXXVNEDVKITNNEESENLNVEKMEPENYEEDIVETSENIEATHIVSGLYPGVTRRVIDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLAR 2288
            MSRR+ S D +D     K +R     ++++ LE+LI  +G+K   +L ++L+ +A +L+ D    K +IL IL   A  +PEK+T+Y TL+GL+N ++Y+ G EFVE +++H KE IK   +++  +L+RF+ DL+N  VI   S++ ++   +    E++ PQ+ SDW VY V+ SLPW   +L  +   E+D+++  IE Y+++R   HL ILQVW++ +  PQE+++DCLW Q++ ++   W+E+ + R    P LA   ++ ++  H LP  +    T  SVYP+P VIFR+FDYTD                                           A E  ++PGSHS+ERF++EE    I+      RK CA  L++ P + ++P++Y IVE I GELF+LP   Q  V YT+LLIELC+    S+P VLAQA+EML+ R++ M   CI+RF+ WFSHHLSNF+F+W+W DWA C+   +DKPK +F+ EVL++ +R SY + +  IVPA F+ L P  P +V KYGD +   L    +A  L   IK++    EI + L+ I +                    N+D     ++E    N  K+E                                  V +  +LNL SK+F+H+F  L KF D+ K   + +  K+ +L  +Y VW+   QM+ V+ ++++  +++   A+  W+FS E+      FY+WEI+ + + +
Sbjct:    1 MSRRRHS-DENDGGQPHKRRRTSEPLEIEDRLESLICRVGEKSTSSLESNLEGLAGVLEADLPNYKNKILRILCFVARLLPEKMTVYTTLVGLLNARNYNFGGEFVEAMIRHLKETIKLNAYNEAIYLVRFLCDLVNCHVIAAPSMVAMFESFVGVTQEEDIPQVRSDWYVYAVLSSLPWVGKELYEKKDVEMDQILSQIEAYLKQRQKLHLSILQVWSAEKPHPQEEYLDCLWAQVQKLKKDRWQERHIQR----PYLAFDSVLCEALQHNLPPFTPPPHTEDSVYPVPRVIFRMFDYTD-------------------------------------------APEGPVMPGSHSVERFVIEENLHCILKSHWRERKTCAAQLLSYPEKNKIPLNYHIVEVIFGELFQLPSPPQIDVMYTTLLIELCKLQPGSLPQVLAQASEMLYTRLDTMNTTCIDRFINWFSHHLSNFQFRWNWEDWADCLSQDLDKPKPQFVREVLEKCMRLSYHQRILDIVPATFSALYPANPSNVIKYGDESNSALPGYSVAVILTNAIKNKASDKEIFNILKDIPNP-------------------NQD---DYDDEGIGFNPLKIE----------------------------------VFVQTLLNLASKSFSHSFSALAKFHDIFKALSESDEGKLHILRVVYDVWKNHPQMIAVLLDKMIRTQIVDCAAVANWIFSPELSPDFTRFYIWEILHSTIRK 647          
BLAST of Nuclear cap-binding protein subunit 1 vs. UniProt/SwissProt
Match: sp|Q56A27|NCBP1_RAT (Nuclear cap-binding protein subunit 1 OS=Rattus norvegicus OX=10116 GN=Ncbp1 PE=1 SV=1)

HSP 1 Score: 460.299 bits (1183), Expect = 1.637e-146
Identity = 243/751 (32.36%), Postives = 410/751 (54.59%), Query Frame = 3
Query:   48 MSRRKRSPDSSDEEYNDKSKRFVGHHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLYNDPNLAI--LVQQSRPHKLPQLSLTLST--SVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDGAPKTLSCQKIARELATMIKSQGKIDEIIDFLRKISDDRVLIVSAXXXXXXXXXXXVNEDVKITNNEESENLNVEKMEPENYEEDIVETSENIEATHIVSGLYPGVTRRVIDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLAR 2288
            MSRR+ S ++ D     K ++    ++ ++ LE+LI ++G+K   +L ++L+ +A +L+ D    K +IL +L   A  +PEKLTIY TL+GL+N ++Y+ G EFVE +++  KE++K  N+++  +L+RF+SDL+N  VI   S++ ++   ++   E++ PQ+  DW VY  + SLPW   +L  +  +E+D++  + E Y+++R   H+ +LQVWT+++  PQE+++DCLW Q++ ++   W+E+ + R    P LA   ++ ++  H LP  +    T  SVYP+P VIFR+FDYT                          D+PE  V                 +PGSHS+ERF++EE    I+      RK CA  L++ P + ++P++Y IVE I  ELF+LP      V YT+LLIELC+    S+P VLAQATEML+ R++ M   C++RF+ WFSHHLSNF+F+WSW DW+ C+   ++ PK +F+ EVL++ +R SY +++  IVP  F+ L P  P  + KYGD +  +L    +A  L+   KS+   DEI   L+ + +                        ++ +++E    N  K+E                                  V +  +L+L +K+F+H+F  L KF +V K   + +  K+ +L  ++ VW+   QM+ V+ ++++  +++   A+  W+FS E+       +VWEI+ + + +
Sbjct:    1 MSRRRHSYEN-DGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANNYNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVSVTQEEDVPQVRRDWYVYAFLSSLPWVGKELYEKKDAEMDRIFSSTESYLKRRQKTHVPMLQVWTADKPHPQEEYLDCLWAQIQKLKKDRWQERHILR----PYLAFDSILCEALQHNLPPFTPPPHTEDSVYPMPRVIFRMFDYT--------------------------DDPEGPV-----------------MPGSHSVERFVIEENLHCIIKSYWKERKTCAAQLVSYPGKNKIPLNYHIVEVIFAELFQLPAPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMLYMRLDTMSTTCVDRFINWFSHHLSNFQFRWSWEDWSDCLTQDLESPKPKFVREVLEKCMRLSYHQHILDIVPPTFSALCPANPTCIYKYGDESSNSLPGHSVALCLSVAFKSKATNDEIFSILKDVPNPN----------------------QVDDDDEGFRFNPLKIE----------------------------------VFVQTLLHLAAKSFSHSFSALAKFHEVFKTLAESDKGKLHVLRVMFEVWRNHPQMIAVLVDKMIRTQIVDCAAVANWIFSSELSRDFTRLFVWEILHSTIRK 647          
BLAST of Nuclear cap-binding protein subunit 1 vs. UniProt/SwissProt
Match: sp|Q3UYV9|NCBP1_MOUSE (Nuclear cap-binding protein subunit 1 OS=Mus musculus OX=10090 GN=Ncbp1 PE=1 SV=2)

HSP 1 Score: 460.299 bits (1183), Expect = 1.708e-146
Identity = 243/751 (32.36%), Postives = 409/751 (54.46%), Query Frame = 3
Query:   48 MSRRKRSPDSSDEEYNDKSKRFVGHHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLYNDPNLAI--LVQQSRPHKLPQLSLTLST--SVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDGAPKTLSCQKIARELATMIKSQGKIDEIIDFLRKISDDRVLIVSAXXXXXXXXXXXVNEDVKITNNEESENLNVEKMEPENYEEDIVETSENIEATHIVSGLYPGVTRRVIDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLAR 2288
            MSRR+ S ++ D     K ++    ++ ++ LE+LI ++G+K   +L ++L+ +A +L+ D    K +IL +L   A  +PEKLTIY TL+GL+N ++Y+ G EFVE +++  KE++K  N+++  +L+RF+SDL+N  VI   S++ ++   ++   E++ PQ+  DW VY  + SLPW   +L  +  +E+D++    E Y+++R   H+ +LQVWT+++  PQE+++DCLW Q++ ++   W+E+ + R    P LA   ++ ++  H LP  +    T  SVYP+P VIFR+FDYT                          D+PE  V                 +PGSHS+ERF++EE    I+      RK CA  L++ P + ++P++Y IVE I  ELF+LP      V YT+LLIELC+    S+P VLAQATEML+ R++ M   C++RF+ WFSHHLSNF+F+WSW DW+ C+   ++ PK +F+ EVL++ +R SY +++  IVP  F+ L P  P  + KYGD +  +L    +A  L+   KS+   DEI   L+ + +                        ++ +++E    N  K+E                                  V +  +L+L +K+F+H+F  L KF +V K   + +  K+ +L  ++ VW+   QM+ V+ ++++  +++   A+  W+FS E+       +VWEI+ + + +
Sbjct:    1 MSRRRHSYEN-DGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANNYNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVSVTQEEDVPQVRRDWYVYAFLSSLPWVGKELYEKKDAEMDRIFSTTESYLKRRQKTHVPMLQVWTADKPHPQEEYLDCLWAQIQKLKKDRWQERHILR----PYLAFDSILCEALQHNLPPFTPPPHTEDSVYPMPRVIFRMFDYT--------------------------DDPEGPV-----------------MPGSHSVERFVIEENLHCIIKSYWKERKTCAAQLVSYPGKNKIPLNYHIVEVIFAELFQLPAPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMLYMRLDTMSTTCVDRFINWFSHHLSNFQFRWSWEDWSDCLTQDLESPKPKFVREVLEKCMRLSYHQHILDIVPPTFSALCPANPTCIYKYGDESSNSLPGHSVALCLSVAFKSKATNDEIFSILKDVPNPN----------------------QVDDDDEGFRFNPLKIE----------------------------------VFVQTLLHLAAKSFSHSFSALAKFHEVFKTLAESDKGKLHVLRVMFEVWRNHPQMIAVLVDKMIRTQIVDCAAVANWIFSSELSRDFTRLFVWEILHSTIRK 647          
BLAST of Nuclear cap-binding protein subunit 1 vs. UniProt/SwissProt
Match: sp|C0H906|NCBP1_SALSA (Nuclear cap-binding protein subunit 1 OS=Salmo salar OX=8030 GN=ncbp1 PE=2 SV=1)

HSP 1 Score: 455.292 bits (1170), Expect = 1.609e-144
Identity = 257/773 (33.25%), Postives = 413/773 (53.43%), Query Frame = 3
Query:   48 MSRRKRSPDSSDEEYNDKSKRFVGHHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLY--NDPNLAILVQQSRPHKLPQLSLTLSTSVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDGAPKTLSCQKIARELATMIKSQGKIDEIIDFLRKISDDRVLIVSAXXXXXXXXXXXVNEDVKITNNEESENLNVEKMEPENYEEDIVETSENIEATHIVSGLYPGVTRRVIDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLARASLEENCAWNKLQ-EMEDANDENE 2357
            MSRR+ S D  D   + K +R     ++++ LE+LI  +G+K   +L ++L+ +A +L+ D    K +IL IL   A  +PEKLT+Y TL+GL+N ++Y+ G EFVE +++  KE +K   + D  +L+RF+ DL+N  VI   S++ ++   ++   E++ PQ+ SDW VY V+ SLPW   +L  +   E+D+++  I+ Y+++RL  H+ +LQVWT+ +  PQE+++DCL+ Q++ ++   W+E+ + R Y   D  L   +Q + P   P     +    YP+P VIFR+FDYTD                                           A E  ++PGSHS+ERF++E+    I+      RK CA  L++ P + ++P++Y IVE I GELF+LP      V YT+LLIELC+    S+P VLAQATEM++ R++ M  +CI+R + WFSHHLSNF+F+WSW DW  C+    DKPK +F+ EVL++ +R SY + +  IVP  F+ L+P  P    KY D A   L    +A  +   IK++   +EI+  L+ + +                     ED    +++E E  N  K+E                                  V +  +L+L +K+F+H+F  L KF +++K     +  K+ +L  +Y VW+   QMV V+ ++L+  +++   A+  WLFS  M  +   FYVWEI+ + + +     N    K+Q E+E+A D+ E
Sbjct:    1 MSRRRHS-DGDDGGQSHKRRRTSEPVEIEDRLESLICRVGEKSTSSLESNLEGLAGVLEADLPNYKNKILRILCAVARLLPEKLTVYTTLVGLLNARNYNFGGEFVEAMIRQLKETLKANLYTDALYLVRFLCDLVNCHVIAAPSMVAMFENFVSVTQEEDVPQVRSDWFVYAVLSSLPWVGKELDEKKDVEMDRLLNQIDGYLKRRLKTHVPMLQVWTAEKPHPQEEYLDCLYAQIQKLKKDRWQERHILRPYIAFDSVLCEALQHNLPPFTP--PAHMPDCQYPMPRVIFRMFDYTD-------------------------------------------APEGPVMPGSHSVERFVIEDNLHNIIKSHWKERKTCAAQLLSYPGKNKIPLNYHIVEVIFGELFQLPCPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMMYVRLDTMNTICIDRLLNWFSHHLSNFQFRWSWDDWVDCLALDADKPKPKFVKEVLEKCMRLSYHQRIVDIVPPTFSGLIPADPIFFYKYQDEANSALPGYAVAIAVGNAIKNRASNEEILTVLKDVPNPN------------------QED----DDDEGEGFNPLKIE----------------------------------VFLQTLLHLAAKSFSHSFSALAKFHEILKALTDCDEGKLHILRVVYEVWKNHPQMVSVLVDKLIRTQIVDCAAVANWLFSPSMAHEFTRFYVWEILHSTIRKM----NKHVQKIQKELEEAKDKLE 667          
BLAST of Nuclear cap-binding protein subunit 1 vs. UniProt/SwissProt
Match: sp|Q16UN6|NCBP1_AEDAE (Nuclear cap-binding protein subunit 1 OS=Aedes aegypti OX=7159 GN=Cbp80 PE=3 SV=1)

HSP 1 Score: 433.335 bits (1113), Expect = 4.742e-136
Identity = 253/753 (33.60%), Postives = 398/753 (52.86%), Query Frame = 3
Query:   48 MSRRKRSPDSSD--EEYNDKSKRFVGHHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLY--NDPNLAILVQQSRP--HKLPQLSLTLSTSVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDGAPKTLSCQKIARELATMIKSQGKIDEIIDFLRKISDDRVLIVSAXXXXXXXXXXXVNEDVKITNNEESENLNVEKMEPENYEEDIVETSENIEATHIVSGLYPGVTRRVIDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLAR 2288
            M+RR+   D  D   E + K +R   + +++E LE LI  +G+    +L ++L+ + S+L+ D    + +IL IL  C   +PEK TIY T++GL+N K+Y+ G EFV+ ++K FKE++K    D  ++ LRF+SDL+N  VI   S++ L + ++  A ED+ PQ+  DW V+ V+ +LPW   +L  +  S L+ ++  IE+++ KR   H   L+VW+ +   PQE+++DCLW Q++ +R  +W EK + R Y   D  L   +Q + P  H  P       +  YP+P V++R+FDYTD                       AG                       ILPG+HSIERFL+EE    I+      RK CA  L+ L  + ++P+ Y IVE I  ELFK+P      +CY S+LIELC+   + +P VLAQATE+LF RI+ M   C +RF  WFS+HLSNF+F+WSW DW SC+    + P+ +FI EVL + LR SY +   +++P  +++L+PKPP    KY      +L     A +L   I+ +   +++++ L+ + + R                           E SEN             D+VE++ N                  IDV +  +LNLGSK+F+H F  + KF  V K   + E  ++ +LH+++ +W   QQM+VVI ++LL+ +++   A+  W+FS EM  +    Y+WEI+   + +
Sbjct:    1 MNRRRAYEDDGDFYGERSRKRRRVSENQEMEERLETLILRVGENSSSSLESNLEGLVSVLESDLGNFRSKILRILSECPIKMPEKCTIYSTMVGLMNAKNYNFGGEFVDHMVKTFKESLKQCRWDAARYALRFLSDLVNCHVISTNSLLQLLDNMVDAANEDSVPQVRRDWYVFAVLSTLPWVGRELYEKKESALENLLVRIEVFLNKRTKKHHNSLRVWSVDAPHPQEEYLDCLWAQIRKLRQDNWAEKHIPRPYLAFDSVLCEALQHNLPLIHPPPH----QDSFEYPMPWVVYRMFDYTDC---------------------PAGP----------------------ILPGAHSIERFLIEEHLHSIIEAHHWERKDCAANLLNLSYKDKIPLEYCIVEVIFAELFKMPTPRYLDICYGSILIELCKLQPSKMPQVLAQATEILFMRIDSMNTSCFDRFANWFSYHLSNFQFRWSWDDWDSCLLLEPEHPRPKFIEEVLLKCLRLSYHDRFKEMMPETYSKLIPKPPMPTYKYTMEGAASLPGTATAHKLVVAIRQKCTPEDVLNELKDLPNPR---------------------------ETSEN-------------DMVESTFNPLK---------------IDVFVQTLLNLGSKSFSHTFAAISKFHLVFKTLAETEEAQICILHNVFELWVNHQQMMVVIIDKLLKTQIVECSAVATWVFSKEMVGEFTKMYLWEILHLTIKK 651          
BLAST of Nuclear cap-binding protein subunit 1 vs. TrEMBL
Match: A4V6J9 (Cap binding protein 80 (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 324/427 (75.88%), Postives = 373/427 (87.35%), Query Frame = 3
Query: 1479 ASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDGAPKTLSCQKIARELATMIKSQGKIDEIIDFLRKISDDRVLIVSAXXXXXXXXXXXVNEDVKITNNEESENLNVEKMEPENYEEDIVETSENIEAT-HIVSGLYPGVTRRVIDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLARASLEENCAWNKLQEMEDANDE--NEDVKITAKQKYAQSRKIYMDLVTQSLAGIVCRLNQYSTKQSVSSRFQLDLVEMLVYFSSNPANPGSGPAPSLAITDETRTWLLGRVENLLLSVDLPHNFVLKQMDRFISRINAPDQLLEIYGVYRATVNQAA 2750
            ASCVQDS+DKPKTRFI+EVLQRLLRFSYFEYVSKIVP +FARLLPKPPG VNKYG+GAPK L+CQKIA EL   ++S  +   +IDFL +I+D R+ +VS K EKT E+TE   +DVK+   EESENL VEKME ENYE+D V+  E+ ++  + + GLYPGVTRRVIDVLMT +LNLGSKTFTHAFLYLDK+RDVIKEFV +E D+VEMLHSL+GVWQEQQQMVVV+TERLLEV+L+S RAI+CWLFSDEM  Q NCFYVWE+IDA+LARASLEEN AWN+LQEMEDA DE  NE+VK+TAKQKYAQSRKIYMDLVTQSLAGIVCR+NQYSTK+S++SRF+LDLVE+LV++S++P    +    SL ITDETRTWLLGRVENLLLSVDLPHNFVLKQMDRFISRIN+PDQLLEIYGVYRATVNQAA
Sbjct:    5 ASCVQDSIDKPKTRFIIEVLQRLLRFSYFEYVSKIVPTDFARLLPKPPGPVNKYGEGAPKKLACQKIALELTAKLRSHEQTSVLIDFLNEIADKRMRVVSTKMEKTIEVTEE-EKDVKVNEIEESENLIVEKMEAENYEDDTVDALESADSVDNKLIGLYPGVTRRVIDVLMTSLLNLGSKTFTHAFLYLDKYRDVIKEFVSDEEDQVEMLHSLFGVWQEQQQMVVVLTERLLEVDLVSSRAIICWLFSDEMIGQINCFYVWEVIDAILARASLEENAAWNRLQEMEDAADEEVNEEVKVTAKQKYAQSRKIYMDLVTQSLAGIVCRINQYSTKESINSRFKLDLVELLVFYSTHPDMEVNS---SLTITDETRTWLLGRVENLLLSVDLPHNFVLKQMDRFISRINSPDQLLEIYGVYRATVNQAA 427          
BLAST of Nuclear cap-binding protein subunit 1 vs. TrEMBL
Match: A0A154PSU0 (Nuclear cap-binding protein subunit 1 OS=Dufourea novaeangliae OX=178035 GN=WN55_07404 PE=4 SV=1)

HSP 1 Score: 478.789 bits (1231), Expect = 4.584e-151
Identity = 263/750 (35.07%), Postives = 403/750 (53.73%), Query Frame = 3
Query:   48 MSRRKRSPDSSDEEYNDKSKRFVG-HHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLY--NDPNLAILVQQSRPHKLPQLSLTLSTSVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDGAPKTLSCQKIARELATMIKSQGKIDEIIDFLRKISDDRVLIVSAXXXXXXXXXXXVNEDVKITNNEESENLNVEKMEPENYEEDIVETSENIEATHIVSGLYPGVTRRVIDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLAR 2288
            MSRR+   +    E   K +R V  + ++++ LE+LI  +G+K   +L ++L+ +AS+L+ D  + + +IL IL  CA  +PEK TIY TL+GL+N K+++ G EFV+ ++K+FK+A+K    D  ++ LRF++DL+N  V+   S+M L++ ++  A ED  PQ+  DW VY V+ +LPW   +L  +   ELD +M  IEI++ KR   H   L+VW+S+   PQE+++DCLW Q++ +R  +W EK + R Y   D  L   +Q + P  +P       +  YPLP V+FR+FDYTD                                          PA E  +LPGSH+IERFL+EE  R I+N     RK CA  L+  P + ++P+ Y IVE I GELF+LP      +CY S+LIELC+   +++P VLAQATE+LF RI+ M     +RFV WF++HLSNF+F+WSW DW SC+Q   + P+ +FI EVL + LR SYF+ +  ++P  +A L+P  P  + KY      +L     A EL   I+ +  ++E+++ L  +   R                          NEE+ N N  K                                  IDV +  +LNLGSK+F+H+F  + KF  V K   + E  ++ +L ++Y +W+   QM+VV+T++ L+  +I   AI  W+FS EM  +    Y+WEI+   + +
Sbjct:    1 MSRRRVHEEEDGYERAYKKRRRVSENQEIEDRLESLILRVGEKSTSSLESNLEGLASVLEADLGLFRSKILRILTECAIRMPEKCTIYTTLVGLLNAKNFNFGGEFVDYMVKNFKDALKACKWDVARYSLRFLADLVNCHVLSCGSLMQLFDNMLDTANEDGVPQVRRDWYVYAVLSTLPWVGRELYEKKEQELDHLMVTIEIFLNKRSKKHQPALRVWSSDTPHPQEEYLDCLWAQVRKLRQDNWAEKHIPRPYLAFDSILCEALQHNLPTIMPPPH--HESYSYPLPTVVFRMFDYTDC-----------------------------------------PA-EGPLLPGSHAIERFLIEEHLRQIINNCFNERKDCAAQLLNFPYKAKIPLDYCIVEVIFGELFRLPAPKHLEICYGSILIELCKLQPSTMPQVLAQATEILFRRIDSMAATAFDRFVWWFAYHLSNFQFRWSWEDWDSCLQRDPEHPRPKFIREVLLKALRLSYFQRIRDMMPESYAELIPALPEPIYKYTSEGASSLPGTAAAHELVVSIRRKCTLEEVLNVLNTLPGPR-------------------------ENEETNNFNPLK----------------------------------IDVFVQTLLNLGSKSFSHSFAAIGKFHYVFKVLAETEEAQICILRNMYALWKNHYQMIVVLTDKFLKTGIIECSAIANWIFSKEMTPEFTKLYIWEILHLTIRK 647          
BLAST of Nuclear cap-binding protein subunit 1 vs. TrEMBL
Match: A0A088A145 (MIF4G domain-containing protein OS=Apis mellifera OX=7460 GN=Cbp80 PE=4 SV=1)

HSP 1 Score: 478.404 bits (1230), Expect = 6.645e-151
Identity = 262/750 (34.93%), Postives = 404/750 (53.87%), Query Frame = 3
Query:   48 MSRRKRSPDSSDEEYNDKSKRFVG-HHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLY--NDPNLAILVQQSRPHKLPQLSLTLSTSVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDGAPKTLSCQKIARELATMIKSQGKIDEIIDFLRKISDDRVLIVSAXXXXXXXXXXXVNEDVKITNNEESENLNVEKMEPENYEEDIVETSENIEATHIVSGLYPGVTRRVIDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLAR 2288
            MSRR+   +    E   K +R V  + ++++ LE+LI  +G+K   +L ++L+ +AS+L+ D  + + +IL IL  CA  +PEK TIY TL+GL+N K+++ G EFV+ ++K+FK+A+K    D  ++ LRF++DL+N  V+   S+M L++ ++  A ED  PQ+  DW VY V+ +LPW   +L  +   ELD +M  IEI++ KR   H   L+VW+S+   PQE+++DCLW Q++ +R  +W EK + R Y   D  L   +Q + P  +P       +  YPLP V+FR+FDYTD                                          PA E  +LPGSH+IERFL+EE  R I+N     RK CA  L+  P + ++P+ Y IVE I GELF+LP      +CY S+LIELC+   +++P VLAQATE+LF RI+ M     +RFV WF++HLSNF+F+WSW DW SC+Q   + P+ +FI EVL + LR SY++ +  ++P  +A L+P PP  + KY      +L     A EL   I+ +   +E+++ L  +   R                          NEE+ N N  K                                  IDV +  +LNLGSK+F+H+F  + KF  V +   + E  ++ +L ++Y +W+   QM+VV+T++ L+  +I   AI  W+FS EM ++    Y+WEI+   + +
Sbjct:    1 MSRRRVHEEEDGYERAYKKRRRVSENQEIEDRLESLILRVGEKSTSSLESNLEGLASVLEADLGLFRSKILRILTECAIRMPEKCTIYTTLVGLLNAKNFNFGGEFVDYMVKNFKDALKACKWDVARYSLRFLADLVNCHVLSCGSLMQLFDNMLDTANEDGVPQVRRDWYVYAVLSTLPWVGRELYEKKEQELDHLMVTIEIFLNKRNKKHQPALRVWSSDTPHPQEEYLDCLWAQVRKLRQDNWAEKHIPRPYLAFDSILCEALQHNLPTIMPPPH--HESYSYPLPTVVFRMFDYTDC-----------------------------------------PA-EGPLLPGSHAIERFLIEEHLRQIINNYFFERKDCAAQLLNFPYKAKIPLDYCIVEVIFGELFRLPAPKHLEICYGSILIELCKLQPSTMPQVLAQATEILFRRIDSMAATAFDRFVWWFAYHLSNFQFRWSWEDWDSCLQRDPEHPRPKFIREVLLKALRLSYYQRIRDMMPESYAELIPAPPEPIYKYTSEGASSLPGTAAAHELVVSIRRKCTPEEVLNVLNTLPGPR-------------------------ENEETNNFNPLK----------------------------------IDVFVQTLLNLGSKSFSHSFAAIGKFHYVFQVLAETEEAQICILRNMYALWKNHYQMMVVLTDKFLKTGIIECSAIANWIFSKEMVSEFTKLYIWEILHLTIRK 647          
BLAST of Nuclear cap-binding protein subunit 1 vs. TrEMBL
Match: A0A2C9K216 (MIF4G domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106078519 PE=4 SV=1)

HSP 1 Score: 478.404 bits (1230), Expect = 6.933e-151
Identity = 271/773 (35.06%), Postives = 416/773 (53.82%), Query Frame = 3
Query:   54 RRKRSPDSSDEEYNDKSKRFVGHHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLY--NDPNLAILVQQSRPHKLPQLSLTLSTSVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDGAPKTLSCQKIARELATMIKSQGKIDEIIDFLRKISDDRVLIVSAXXXXXXXXXXXVNEDVKITNNEESENLNVEKMEPENYEEDIVETSENIEATHIVSGLYPGVTRRVIDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLARASLEENCAWNKLQEMEDANDENEDVK 2366
            RRK +PD  D               +++ LE+LI  +G++   +L ++L+ +AS+L+ D    K +I++IL  C  N+PEKLT+Y TL+GL+N K+Y+ G EFVE+L+++ KEA+K G  ++ + ++RF+SDL+N  V+   S++ +++  +   LEDN PQ+ SD  VY+V+ SLPW   +L  +  S+L+ M+  IE Y+ KR   HL  L+VW ++    QE+++DCLW Q+KN+R   W EK + R Y   D  L   +Q + P  +P       + VYPLP V+FRLFDYTDV +                                             +LPGSH+IER+L+EEQ   I++     RK CA AL+  P + ++P++YMIVE + G+LF+LP+     + Y S  IELC+    S+P VLAQA+EMLFDR++ M  +CIERFV WFS+HLSNF+++WSW DW  CV    + PK++F+ EVL + LRFSY++ V + VP  FA LLP  P  + KY      +L     A +L + IKS+   +E    L+ + +                           N +E+EN +   ++                                IDV  + +L+LGSK+ +H+F  L KF   +K   + +  K+ +L  LY  W+  QQM+VV+ ++LL  E++   ++  WLFS EM      FYVWEI+ + + + S   +      QE++ A+D+ E  K
Sbjct:   23 RRKIAPDGVD---------------IEDRLESLITRVGERSTSSLESNLEGLASVLEADIPNYKHQIMKILCQCVVNLPEKLTVYTTLVGLLNAKNYNCGGEFVEMLVRNLKEALKTGEFENARMMVRFLSDLVNCHVLVATSLLQMFDSFVEVTLEDNIPQVRSDIYVYLVLSSLPWVGRELFEKKESDLNSMLVTIENYLSKRQKIHLPALRVWLNDGPHLQEEYLDCLWAQIKNLRNNKWIEKQILRPYLAFDGVLCDALQHTLPQIIPPSH--NKSMVYPLPRVVFRLFDYTDVPQGP-------------------------------------------VLPGSHAIERYLIEEQINRIIHTHHLERKDCAAALLEYPAKAKIPLNYMIVEVMFGQLFELPRPPYIEIFYGSTFIELCKNQPTSMPEVLAQASEMLFDRLDSMHSICIERFVHWFSYHLSNFQYKWSWEDWVECVAMDPNAPKSKFVREVLLKCLRFSYYQRVVESVPESFAALLPPEPKPIYKYEQEGAGSLPGTMHAHKLMSAIKSKCTPEEAAVLLKDLPN------------------------AYPNGQENENSSFNPLK--------------------------------IDVFFSTLLHLGSKSISHSFAALAKFHPNLKSLAEFDDGKICLLKVLYETWKNNQQMMVVLVDKLLRTEVVECSSVANWLFSFEMQHDFTSFYVWEIMHSTIKKMSRHVD---QLQQEVDSAHDKQEAAK 676          
BLAST of Nuclear cap-binding protein subunit 1 vs. TrEMBL
Match: A0A2A3EN24 (Nuclear cap-binding protein subunit OS=Apis cerana cerana OX=94128 GN=APICC_05336 PE=4 SV=1)

HSP 1 Score: 477.633 bits (1228), Expect = 1.060e-150
Identity = 262/750 (34.93%), Postives = 404/750 (53.87%), Query Frame = 3
Query:   48 MSRRKRSPDSSDEEYNDKSKRFVG-HHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLY--NDPNLAILVQQSRPHKLPQLSLTLSTSVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDGAPKTLSCQKIARELATMIKSQGKIDEIIDFLRKISDDRVLIVSAXXXXXXXXXXXVNEDVKITNNEESENLNVEKMEPENYEEDIVETSENIEATHIVSGLYPGVTRRVIDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLAR 2288
            MSRR+   +    E   K +R V  + ++++ LE+LI  +G+K   +L ++L+ +AS+L+ D  + + +IL IL  CA  +PEK TIY TL+GL+N K+++ G EFV+ ++K+FK+A+K    D  ++ LRF++DL+N  V+   S+M L++ ++  A ED  PQ+  DW VY V+ +LPW   +L  +   ELD +M  IEI++ KR   H   L+VW+S+   PQE+++DCLW Q++ +R  +W EK + R Y   D  L   +Q + P  +P       +  YPLP V+FR+FDYTD                                          PA E  +LPGSH+IERFL+EE  R I+N     RK CA  L+  P + ++P+ Y IVE I GELF+LP      +CY S+LIELC+   +++P VLAQATE+LF RI+ M     +RFV WF++HLSNF+F+WSW DW SC+Q   + P+ +FI EVL + LR SY++ +  ++P  +A L+P PP  + KY      +L     A EL   I+ +   +E+++ L  +   R                          NEE+ N N  K                                  IDV +  +LNLGSK+F+H+F  + KF  V +   + E  ++ +L ++Y +W+   QM+VV+T++ L+  +I   AI  W+FS EM ++    Y+WEI+   + +
Sbjct:    1 MSRRRVHEEEDGYERAYKKRRRVSENQEIEDRLESLILRVGEKSTSSLESNLEGLASVLEADLGLFRSKILRILTECAIRMPEKCTIYTTLVGLLNAKNFNFGGEFVDYMVKNFKDALKACKWDVARYSLRFLADLVNCHVLSCGSLMQLFDNMLDTANEDGVPQVRLDWYVYAVLSTLPWVGRELYEKKEQELDHLMVTIEIFLNKRNKKHQPALRVWSSDTPHPQEEYLDCLWAQVRKLRQDNWAEKHIPRPYLAFDSILCEALQHNLPTIMPPPH--HESYSYPLPTVVFRMFDYTDC-----------------------------------------PA-EGPLLPGSHAIERFLIEEHLRQIINNYFFERKDCAAQLLNFPYKAKIPLDYCIVEVIFGELFRLPAPKHLEICYGSILIELCKLQPSTMPQVLAQATEILFRRIDSMAATAFDRFVWWFAYHLSNFQFRWSWEDWDSCLQRDPEHPRPKFIREVLLKALRLSYYQRIRDMMPESYAELIPAPPEPIYKYTSEGASSLPGTAAAHELVVSIRRKCTPEEVLNVLNTLPGPR-------------------------ENEETNNFNPLK----------------------------------IDVFVQTLLNLGSKSFSHSFAAIGKFHYVFQVLAETEEAQICILRNMYALWKNHYQMMVVLTDKFLKTGIIECSAIANWIFSKEMVSEFTKLYIWEILHLTIRK 647          
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Cavefish
Match: NCBP1 (nuclear cap binding protein subunit 1 [Source:NCBI gene;Acc:103040430])

HSP 1 Score: 408.683 bits (1049), Expect = 9.519e-128
Identity = 209/574 (36.41%), Postives = 339/574 (59.06%), Query Frame = 3
Query:   48 MSRRKRSPDSSDEEYNDKSKRFVGHHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLYNDPNLAI--LVQQSRPHKLPQLSLTLST--SVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDGAPKTLSCQKIARELATMIKSQGKIDEIIDFLRKISD 1757
            MSRR+ S D +D     K +R     ++++ LE+LI  +G+K   +L ++L+ +A +L+ D    K +IL IL   A  +PEKLT+Y TL+GL+N ++Y+ G EFVE +++  KE +K   + +  +L+RF+SDL+N  VI   S++ ++   ++   E++ PQ+ SDW V+ V+  LPW   +L  +   E+D+++  I+ Y+++R   H+ +LQVWT+ +  PQE+++DCLW Q++ ++   W+E+ + R    P +A   ++ ++  H LP  +    +  +VYP+P VIFR+FDYTD                                           A E  ++PGSHS+ERF++EE    I+      RK CA  L++ P + ++P++Y IVE I GELF+LP      V YT+LLIELC+    S+P VLAQATEM++ R++ M   CI+RF+ WFSHHLSNF+F+WSW DWA C+   +DKPK +F+ EVL++ +R SY + +  IVPA F+ L+P  P    KY D +  +L    +A  ++  IK++   +E++  L+++ +
Sbjct:    1 MSRRRHS-DENDGGQPHKRRRTSEPIEIEDRLESLICRVGEKSTSSLESNLEGLAGVLEADLPNFKNKILRILCAVARLLPEKLTVYTTLVGLLNARNYNFGGEFVEAMIRQLKETLKSNLYTEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVSVTQEEDIPQVRSDWYVFAVLSCLPWVGKELYEKKDVEMDRLLNQIDGYLKRRQKTHVPMLQVWTAEKPHPQEEYLDCLWAQVQKLKKDRWQERHILR----PYIAFDSVLCEALQHNLPPFTPPAHSDDAVYPMPRVIFRMFDYTD-------------------------------------------APEGPVMPGSHSVERFVIEENLHCIIKSHWRERKTCAAQLLSYPGKNKIPLNYHIVEVIFGELFQLPSPPHIDVMYTALLIELCKLQPGSLPQVLAQATEMMYMRLDTMNTSCIDRFISWFSHHLSNFQFRWSWEDWADCLTVDLDKPKPKFVKEVLEKSMRLSYHQRIVDIVPASFSALIPAEPLFQYKYDDESKSSLPGYPMAITVSNAIKNRASNEELLTILKEVPN 526          

HSP 2 Score: 80.1073 bits (196), Expect = 8.178e-15
Identity = 39/128 (30.47%), Postives = 75/128 (58.59%), Query Frame = 3
Query: 1977 IDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLARASLEENCAWNKLQ-EMEDANDENE 2357
            IDV +  +L+L +K+F+H+F  L KF +V+K   + +  K+ +L  +Y  W+   QM+ V+ ++++  +++   A+  W+FS +M      FY+WEI+ + + +     N    K+Q E+E+A D+ E
Sbjct:  544 IDVFLQTLLHLAAKSFSHSFSALAKFHEVLKALTETDEGKLHILKVVYEAWRNHPQMIAVLVDKMIRTQIVDCAAVANWIFSPDMAHDFTRFYMWEILHSTIRKM----NKHVQKIQKELEEAKDKLE 667          
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Sea Lamprey
Match: NCBP1 (nuclear cap binding protein subunit 1 [Source:HGNC Symbol;Acc:HGNC:7658])

HSP 1 Score: 365.155 bits (936), Expect = 2.921e-112
Identity = 199/507 (39.25%), Postives = 297/507 (58.58%), Query Frame = 3
Query:   48 MSRRKRSPDSSDEEYNDKSKRFVGH-HDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLYNDPNLAI--LVQQSRPHKLPQLSLTLST--SVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLR 1553
            MSRR++  D  D+  N   +R       +++ LE+LI  +G+K   +L ++L+ +A +L+ D    K +IL IL   A  +PEKLTIY TL GL+N ++Y+ G E VE L++  KEA+K   + D+ +++RF++DL+N  VI   S++ ++   +A   E+  PQ+ SDW VY V+ SLPW   +L  +   E+++++  IE Y++KR   H+ +LQVWTS++  PQE+++DCLW Q + MR   W+E+ L R    P LA   ++ ++  H LP  +    +  SVYP P VIFRLFDYTD                                           A E  ++PGSH++ERF++EE  R I+      RK CA  L++   R ++P++YM++E I GELF+LP      V YT+LLIELC+   +S+P VLAQ  EML+ R+E M   CI+RF+ WFSHHLSNF+F+WSW DWA C+      PK +F+ EVL++ LR
Sbjct:    1 MSRRRKIDDDDDDGANQHKRRRTSEPMKIEDRLESLICRVGEKSTSSLESNLEGLAGVLEADLPNYKSKILRILTAVARLLPEKLTIYTTLSGLLNARNYNFGGELVESLMRQLKEALKGNYYTDSLYIVRFLADLVNCHVIAAPSLVAMFENFVAVTQEEEIPQVRSDWYVYAVLSSLPWVGKELYEKKDVEMERILTQIEAYIKKRKKLHMPMLQVWTSDKPHPQEEYLDCLWAQTQKMRSDRWQERHLLR----PYLAFDSVLCEALQHNLPPFTPPPHSQDSVYPKPHVIFRLFDYTD-------------------------------------------APEGPVMPGSHAMERFVIEENLRCIIKTHWRERKTCAVQLVSYLGRTKIPLNYMVIEVIFGELFQLPCPPCIEVMYTALLIELCKLQPSSLPQVLAQTAEMLYMRLENMNTTCIDRFINWFSHHLSNFQFRWSWEDWADCLTLDQGGPKPKFVREVLEKCLR 460          

HSP 2 Score: 58.151 bits (139), Expect = 9.775e-9
Identity = 29/107 (27.10%), Postives = 55/107 (51.40%), Query Frame = 3
Query: 2034 FLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLARASLEENCAWNKLQEMEDANDEN 2354
            F  L  F ++ K     +  KV +L S+Y VW+   QM+ V+ ++++ + ++   A+  W+FS +M  +    YVWEII + + + +        +L+E  D  D +
Sbjct:  566 FSVLSLFHEIFKLLADTDEGKVHILKSMYDVWRNHPQMMSVLVDKMIRMRIVDCAAVANWVFSADMAQEFTRLYVWEIIHSTVRKMNKHVQKVQRELEEARDKLDRH 672          
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Yeast
Match: STO1 (Large subunit of the nuclear mRNA cap-binding protein complex; interacts with Npl3p to carry nuclear poly(A)+ mRNA to cytoplasm; also involved in nuclear mRNA degradation and telomere maintenance; orthologous to mammalian CBP80 [Source:SGD;Acc:S000004732])

HSP 1 Score: 80.8777 bits (198), Expect = 5.584e-16
Identity = 43/145 (29.66%), Postives = 72/145 (49.66%), Query Frame = 3
Query: 1197 PMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVD------KPKTRFIVEVLQRLLRF-SYFEYVSKIVPAEFARLL 1610
            P+     +  + +ETILG +FKLP   Q    + +LL+++C+ +  +I  V  +A    +  ++ +      R++ WFS  +SNF F W W++W     DS+        PK  F   ++Q+ LR  S F  V   +P EF + L
Sbjct:  407 PLAPTFKIEDLAIETILGLIFKLPSVSQPFAYFYTLLVDICQNSPKAIAPVFGRAFRFFYSHLDSLDFELKLRYLDWFSIQMSNFNFSWKWNEWE---DDSIKFGKYFYNPKVNFAKNLIQKELRLTSNFSEVEDSLPQEFTKYL 548          
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Nematostella
Match: EDO33158 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST09])

HSP 1 Score: 386.726 bits (992), Expect = 6.849e-120
Identity = 204/574 (35.54%), Postives = 331/574 (57.67%), Query Frame = 3
Query:   48 MSRRKRSPDSSDEEYNDKSKRFVGHHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLY--NDPNLAILVQQSRPHKLPQLSLTLST--SVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLL-PKPPGSVNKYGDGAPKTLSCQKIARELATMIKSQGKIDEIIDFLRKIS 1754
            MSR ++     D     K +R     D+++ LE+LI  +G+K   +L ++L+ +A++L+ D    K  IL I+  CA N+PEK++IY TL+GL+N K Y  GEEF+++++ + K+ +     +  + ++RFMSDL+N  VI P S++ L+   +A ++E + PQ+ +DW VY ++ +LPW+  +L+ +  S+L++++  ++ Y+ +R   H+  L+VW++++  PQE+++DCLW Q+K ++   W+EK + R Y   D  L   +Q    H +P L++   T  +VYPLP +++R+FDYTDV E                                       PA     +PG+HSIERFLVEE  R ++N    +RK CA  L+ +P + ++P +Y I+E I  ELF+LP      V Y SL IELC+    SIP +LAQAT +LFDR++ M   C++R   W SHHLSNF ++WSW +W     +S   PK  F+ E+ ++L RFSY +Y+ +I+P +F  ++ PKP  S     DG P       IA++L   I+++   +E+   L +IS
Sbjct:    1 MSRDRKRYYDDDGGRARKRRRTTEIVDIEDRLESLITRVGEKSTSSLESNLEGLANVLEADLPNYKERILSIICTCAANLPEKISIYSTLVGLLNVKTYKCGEEFLDMMINNIKDVMANHQFERARLMIRFMSDLVNCRVILPISLIELFEKFMAASMESDVPQVRTDWFVYCILSALPWTGKELSDKKGSDLERLLTTVDSYISQRKKTHIPALRVWSTDDVHPQEEYLDCLWAQIKKLKADGWQEKHIRRPYLSFDSVLGDALQ----HTIPPLTIPPHTDDTVYPLPTIVYRMFDYTDVPEG--------------------------------------PA-----MPGAHSIERFLVEEGIRRVINAHYKDRKECANQLMNMPGKSKVPFNYCIIEVIFSELFRLPSPPHIEVFYASLFIELCKLQPESIPGILAQATYLLFDRLDTMNTSCVDRLKDWLSHHLSNFNYKWSWDEWIQ-YANSPGTPKFMFLCELFEKLHRFSYHDYLLEILPDDFLNIIPPKPLPSYRFSKDGLPGG----DIAKQLTEAIRAKKDPEELQALLNEIS 522          

HSP 2 Score: 70.4774 bits (171), Expect = 2.453e-12
Identity = 32/121 (26.45%), Postives = 65/121 (53.72%), Query Frame = 3
Query: 1977 IDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLARASLEENCAWNKLQEMED 2339
            IDV +  IL LGSK+ +H++  L KF  ++K  +  E  ++  L +L   W    QM +++ ++L+ ++++   A++ WL   +M       Y WE++   + R +++ N    + +E +D
Sbjct:  550 IDVFLQTILYLGSKSISHSYSALTKFHKILKSLIPTEEAQIHALKTLKEFWCNSPQMTIILVDKLIRMQVVECTAVINWLLCKDMSQDFTKSYTWELMTTTIRRMNMQVNKVREESREAKD 670          
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Medaka
Match: NCBP1 (nuclear cap binding protein subunit 1 [Source:NCBI gene;Acc:101171258])

HSP 1 Score: 459.144 bits (1180), Expect = 5.317e-147
Identity = 248/749 (33.11%), Postives = 408/749 (54.47%), Query Frame = 3
Query:   48 MSRRKRSPDSSDEEYNDKSKRFVGHHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLY--NDPNLAILVQQSRPHKLPQLSLTLSTSVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDGAPKTLSCQKIARELATMIKSQGKIDEIIDFLRKISDDRVLIVSAXXXXXXXXXXXVNEDVKITNNEESENLNVEKMEPENYEEDIVETSENIEATHIVSGLYPGVTRRVIDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLAR 2288
            MSRR+ S D SD     K +R     ++++ LE+LI  +G+K   +L ++L+ +A +L+ D    K +IL IL   A  +PEKLT+Y TL+GL+N ++Y+ G EFVE +++  KE +K   +++  +L+RF+SDL+N  VI   S++ ++   I+   E++ PQ+  DW VY+V+  LPW   +L  +   E+D+++  IE Y+++R+  H+ +LQVWT+ +  PQE+++DCLW Q++ ++   W+E+ + R Y   D  L   +Q + P   P     +  + YP+P VIFR+FDYTD                                           A E  ++PGSHS+ERF++EE    I+      RK CA  L++ P + ++P++Y IVE I GELF+LP      V YTSLLIELC+    S+P VLAQATEML+ R++ M   C++RF+ WF+HHLSNF+F+WSW DWA C+   +DKPK +F+ EVL++ +R SY + +  IVPA F+ L+P  P    KY D    +L     +  ++  IK++   +EI+  L+++ +                     ED    +++E E  N  K                                  IDV +  +L+L +K+F+H+F  L KF +++K   + +  K+ +L  +Y VW+   QM+ V+ ++++  +++   A+  WLFS +M  +    ++WEI+ + + +
Sbjct:    1 MSRRRHS-DDSDGGQAHKRRRTSEPIEIEDRLESLICRVGEKSTSSLESNLEGLAGVLEADLPNYKNKILRILCAVARLLPEKLTVYTTLVGLLNARNYNFGGEFVEAMIRQLKETLKNNFYNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFISVTQEEDVPQVRLDWFVYVVLSCLPWVGKELYEKKDVEMDRLLSQIEGYLKRRVKTHVPMLQVWTAEKPHPQEEYLDCLWAQIQKLKKDRWQERHILRPYIAFDSVLCEALQHNLPPFTP--PGHMPDAQYPMPRVIFRMFDYTD-------------------------------------------APEGPVMPGSHSVERFVIEENLHCIIKTHWRERKTCAAQLLSYPGKNKIPLNYHIVEVIFGELFQLPSPPHIDVMYTSLLIELCKLQPGSLPQVLAQATEMLYMRLDTMNTSCMDRFINWFAHHLSNFQFRWSWDDWADCLTVDLDKPKPKFVKEVLEKSMRLSYHQRIVDIVPATFSALIPADPIFTFKYEDETASSLPGYPTSVTVSNAIKNRASNEEILAILKEVPNPN------------------QED----DDDEGEAFNPLK----------------------------------IDVFLQTLLHLAAKSFSHSFSALGKFHEILKTLTESDEGKLHILKVVYDVWRNHPQMIAVLVDKMVRTQIVDCAAVANWLFSQDMAHEFTRLFIWEILHSTIRK 647          
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Medaka
Match: NCBP1 (nuclear cap binding protein subunit 1 [Source:NCBI gene;Acc:101171258])

HSP 1 Score: 416.387 bits (1069), Expect = 1.216e-131
Identity = 219/667 (32.83%), Postives = 361/667 (54.12%), Query Frame = 3
Query:  294 KLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLY--NDPNLAILVQQSRPHKLPQLSLTLSTSVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDGAPKTLSCQKIARELATMIKSQGKIDEIIDFLRKISDDRVLIVSAXXXXXXXXXXXVNEDVKITNNEESENLNVEKMEPENYEEDIVETSENIEATHIVSGLYPGVTRRVIDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLAR 2288
            KLT+Y TL+GL+N ++Y+ G EFVE +++  KE +K   +++  +L+RF+SDL+N  VI   S++ ++   I+   E++ PQ+  DW VY+V+  LPW   +L  +   E+D+++  IE Y+++R+  H+ +LQVWT+ +  PQE+++DCLW Q++ ++   W+E+ + R Y   D  L   +Q + P   P     +  + YP+P VIFR+FDYTD                                           A E  ++PGSHS+ERF++EE    I+      RK CA  L++ P + ++P++Y IVE I GELF+LP      V YTSLLIELC+    S+P VLAQATEML+ R++ M   C++RF+ WF+HHLSNF+F+WSW DWA C+   +DKPK +F+ EVL++ +R SY + +  IVPA F+ L+P  P    KY D    +L     +  ++  IK++   +EI+  L+++ +                     ED    +++E E  N  K                                  IDV +  +L+L +K+F+H+F  L KF +++K   + +  K+ +L  +Y VW+   QM+ V+ ++++  +++   A+  WLFS +M  +    ++WEI+ + + +
Sbjct:   11 KLTVYTTLVGLLNARNYNFGGEFVEAMIRQLKETLKNNFYNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFISVTQEEDVPQVRLDWFVYVVLSCLPWVGKELYEKKDVEMDRLLSQIEGYLKRRVKTHVPMLQVWTAEKPHPQEEYLDCLWAQIQKLKKDRWQERHILRPYIAFDSVLCEALQHNLPPFTP--PGHMPDAQYPMPRVIFRMFDYTD-------------------------------------------APEGPVMPGSHSVERFVIEENLHCIIKTHWRERKTCAAQLLSYPGKNKIPLNYHIVEVIFGELFQLPSPPHIDVMYTSLLIELCKLQPGSLPQVLAQATEMLYMRLDTMNTSCMDRFINWFAHHLSNFQFRWSWDDWADCLTVDLDKPKPKFVKEVLEKSMRLSYHQRIVDIVPATFSALIPADPIFTFKYEDETASSLPGYPTSVTVSNAIKNRASNEEILAILKEVPNPN------------------QED----DDDEGEAFNPLK----------------------------------IDVFLQTLLHLAAKSFSHSFSALGKFHEILKTLTESDEGKLHILKVVYDVWRNHPQMIAVLVDKMVRTQIVDCAAVANWLFSQDMAHEFTRLFIWEILHSTIRK 576          
BLAST of Nuclear cap-binding protein subunit 1 vs. Planmine SMEST
Match: SMESG000073304.1 (SMESG000073304.1)

HSP 1 Score: 1817.36 bits (4706), Expect = 0.000e+0
Identity = 898/921 (97.50%), Postives = 899/921 (97.61%), Query Frame = 3
Query:   48 MSRRKRSPDSSDEEYNDKSKRFVGHHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLYNDPNLAILVQQSRPHKLPQLSLTLSTSVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDGAP--------------------KTLSCQKIARELATMIKSQGKIDEIIDFLRKISDDRVLIVSAXXXXXXXXXXXVNEDVKITNNEESENLNVEKMEPENYEEDIVETSENIEATHIVSGLYPGVTRRVIDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLARASLEENCAWNKLQEMEDANDENEDVKITAKQKYAQSRKIYMDLVTQSLAGIVCRLNQYSTKQSVSSRFQLDLVEMLVYFSSNPANPGSGPAPSLAITDETRTWLLGRVENLLLSVDLPHNFVLKQMDRFISRINAPDQLLEIYGVYRATVNQAA 2750
            MSRRKRSPDSSDEEYNDKSKRFVGHHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLYNDPNLAILVQQSRPHKLPQLSLTLSTSVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDG P                    +TLSCQKIARELATMIKSQGKIDEIIDFLRKISDDRVLIVSAKTEKTTEITETVNEDVKITNNEESENLNVEKMEPENYEEDIVETSENIEATHIVSGLYPGVTRRVIDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLARASLEENCAWNKLQEMEDANDENEDVKITAKQKYAQSRKIYMDLVTQSLAGIVCRLN YSTKQSVSSRFQLDLVEMLVYFSSNPANPGSGPAPSLAITDETRTWLLGRVENLLLSVDLPHNFVLKQMDRFISRINAPDQLLEIYGVYRATVNQAA
Sbjct:    1 MSRRKRSPDSSDEEYNDKSKRFVGHHDVQETLENLIYELGDKDLYALPNDLQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYSLGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLYNVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNIEIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVLWRLYNDPNLAILVQQSRPHKLPQLSLTLSTSVYPLPMVIFRLFDYTDVIEDELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGSHSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETILGELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMRPVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRLLRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDGLPAICIINETTFLVYSKRKPNLETLSCQKIARELATMIKSQGKIDEIIDFLRKISDDRVLIVSAKTEKTTEITETVNEDVKITNNEESENLNVEKMEPENYEEDIVETSENIEATHIVSGLYPGVTRRVIDVLMTVILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQMVVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLARASLEENCAWNKLQEMEDANDENEDVKITAKQKYAQSRKIYMDLVTQSLAGIVCRLNHYSTKQSVSSRFQLDLVEMLVYFSSNPANPGSGPAPSLAITDETRTWLLGRVENLLLSVDLPHNFVLKQMDRFISRINAPDQLLEIYGVYRATVNQAA 921          
The following BLAST results are available for this feature:
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NCBP14.170e-13237.28nuclear cap binding protein subunit 1 [Source:HGNC... [more]
back to top
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ncbp-13.743e-7629.49Nuclear cap-binding protein subunit 1 [Source:Uni... [more]
back to top
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Cbp805.982e-12436.17gene:FBgn0022942 transcript:FBtr0070683[more]
Cbp805.982e-12436.17gene:FBgn0022942 transcript:FBtr0070684[more]
CG79071.025e-6526.54gene:FBgn0038887 transcript:FBtr0113261[more]
CG79071.025e-6526.54gene:FBgn0038887 transcript:FBtr0113262[more]
back to top
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ncbp14.575e-13437.63nuclear cap binding protein subunit 1 [Source:NCBI... [more]
ncbp11.363e-9736.30nuclear cap binding protein subunit 1 [Source:NCBI... [more]
back to top
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ncbp12.442e-14732.36nuclear cap binding protein subunit 1 [Source:MGI ... [more]
back to top
BLAST of Nuclear cap-binding protein subunit 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6GQD0|NBP1B_XENLA4.451e-15234.49Nuclear cap-binding protein subunit 1-B OS=Xenopus... [more]
sp|Q56A27|NCBP1_RAT1.637e-14632.36Nuclear cap-binding protein subunit 1 OS=Rattus no... [more]
sp|Q3UYV9|NCBP1_MOUSE1.708e-14632.36Nuclear cap-binding protein subunit 1 OS=Mus muscu... [more]
sp|C0H906|NCBP1_SALSA1.609e-14433.25Nuclear cap-binding protein subunit 1 OS=Salmo sal... [more]
sp|Q16UN6|NCBP1_AEDAE4.742e-13633.60Nuclear cap-binding protein subunit 1 OS=Aedes aeg... [more]
back to top
BLAST of Nuclear cap-binding protein subunit 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A4V6J90.000e+075.88Cap binding protein 80 (Fragment) OS=Dugesia japon... [more]
A0A154PSU04.584e-15135.07Nuclear cap-binding protein subunit 1 OS=Dufourea ... [more]
A0A088A1456.645e-15134.93MIF4G domain-containing protein OS=Apis mellifera ... [more]
A0A2C9K2166.933e-15135.06MIF4G domain-containing protein OS=Biomphalaria gl... [more]
A0A2A3EN241.060e-15034.93Nuclear cap-binding protein subunit OS=Apis cerana... [more]
back to top
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NCBP19.519e-12836.41nuclear cap binding protein subunit 1 [Source:NCBI... [more]
back to top
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NCBP12.921e-11239.25nuclear cap binding protein subunit 1 [Source:HGNC... [more]
back to top
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
STO15.584e-1629.66Large subunit of the nuclear mRNA cap-binding prot... [more]
back to top
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO331586.849e-12035.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nuclear cap-binding protein subunit 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
NCBP15.317e-14733.11nuclear cap binding protein subunit 1 [Source:NCBI... [more]
NCBP11.216e-13132.83nuclear cap binding protein subunit 1 [Source:NCBI... [more]
back to top
BLAST of Nuclear cap-binding protein subunit 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000073304.10.000e+097.50SMESG000073304.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003920 ID=SMED30003920|Name=Nuclear cap-binding protein subunit 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3131bp
TTATTGTTTAAATAACCAACCGTTCACATCATTTGAATTAACTAACAATG
TCTCGCAGAAAACGTTCTCCCGACTCGTCAGATGAAGAATATAATGATAA
AAGTAAACGTTTTGTGGGTCATCATGATGTTCAAGAGACACTAGAAAATT
TAATTTATGAATTAGGAGATAAAGATCTCTATGCCTTGCCAAATGATTTG
CAGTCAGTTGCATCGATTCTTAAAAAGGATTCTTCTATAATGAAATTTGA
AATACTTGAAATTCTCGTAAATTGCGCCGAAAATATTCCCGAAAAATTAA
CTATTTATGTTACATTAATAGGCTTAGTGAATTTCAAAGATTATTCTCTT
GGTGAAGAATTTGTTGAGTTATTACTTAAGCACTTTAAAGAAGCTATTAA
ATGCGGTAATCATGATGACACTAAATTTCTGTTGAGATTTATGTCTGATT
TAATAAACACTTGTGTCATTCACCCTCAATCGATTATGCTTTTATATAAC
GTTTTAATTGCGCAAGCTTTAGAAGATAATACGCCCCAGTTATGTTCAGA
TTGGTTGGTGTATATTGTGATGTATTCATTGCCATGGTCTGCGTCAAAGC
TCGCATCACAATGTCACAGTGAATTGGACAAAATGATGCAAAATATCGAA
ATCTATATGGAAAAAAGACTTGTCGATCATTTGGGGATATTACAAGTTTG
GACAAGTAATGAATTTCAACCCCAGGAAGATTTTATGGACTGTTTATGGA
ATCAATTGAAAAATATGCGTATGCAAAGCTGGCGAGAAAAGGTATTATGG
CGATTATACAACGACCCGAATCTGGCAATCTTAGTTCAACAGTCTCGACC
CCACAAATTGCCTCAACTTTCCTTGACATTGTCAACGTCAGTATATCCAT
TACCTATGGTCATATTTAGGTTGTTTGATTATACCGATGTTATTGAAGAT
GAATTACAAACAAGTAAAAAGGAGCCAATGCCGAGTCTCGATGATCAAAA
TAACATCGCTGGTGATGAGCCCGAGGTGAAGGTGTTGGAGAAAATGGAAG
TCACTGAAAGCAAACCAGCAATTGAACAGCTAATTTTACCCGGTTCACAT
TCCATTGAAAGATTTCTAGTAGAAGAGCAATATAGAATAATTGTCAACGG
ATTGAAAACCAATAGGAAGCTTTGTGCCAAGGCGTTGATTGCGTTGCCAA
TGCGAGTCCGATTGCCGGTGTCGTACATGATCGTGGAAACGATATTAGGA
GAACTATTCAAGCTGCCGAAATCCGATCAAACCCATGTCTGTTACACGTC
GCTGTTGATTGAATTGTGCCGAGAAGCCGCCAATTCCATTCCATTGGTTC
TGGCACAGGCAACGGAAATGCTGTTCGATCGAATCGAACAAATGCGACCG
GTGTGCATTGAGCGGTTCGTTTGTTGGTTCTCTCACCATCTGAGCAACTT
CAAATTCCAATGGAGCTGGTCGGATTGGGCGTCTTGTGTACAAGACTCCG
TCGACAAACCCAAAACGCGATTCATCGTGGAAGTCCTACAGCGATTGCTG
CGGTTTTCGTATTTTGAATATGTCAGCAAAATCGTTCCAGCAGAATTTGC
CCGATTGTTACCGAAACCACCGGGATCCGTCAATAAATACGGTGATGGGG
CTCCCAAAACTCTATCATGCCAAAAAATTGCCAGAGAATTGGCCACAATG
ATCAAAAGCCAGGGCAAAATCGATGAAATCATAGACTTTCTCAGAAAAAT
ATCCGATGATCGAGTATTGATTGTGTCGGCTAAAACGGAAAAAACTACTG
AAATAACGGAAACTGTAAACGAAGACGTCAAAATCACTAATAACGAAGAG
TCTGAAAATCTTAATGTTGAAAAGATGGAACCAGAAAATTATGAAGAAGA
TATAGTTGAAACATCAGAAAATATCGAAGCTACTCATATAGTTTCGGGAT
TATATCCAGGTGTGACCAGGCGAGTGATAGATGTTCTCATGACAGTTATT
CTCAATCTCGGTTCAAAGACATTTACTCATGCCTTTCTTTATTTGGACAA
GTTTAGAGATGTAATTAAAGAATTTGTTAAAGAAGAAGGAGATAAAGTAG
AAATGTTACATAGCTTATACGGGGTCTGGCAGGAACAACAACAGATGGTT
GTAGTTATTACCGAACGATTATTAGAAGTTGAATTAATCTCACCTCGCGC
CATTTTATGCTGGTTATTTTCGGATGAGATGTTTACCCAAACAAATTGTT
TCTATGTTTGGGAAATTATTGATGCAGTCTTAGCCAGAGCATCTTTAGAA
GAAAATTGTGCTTGGAATAAACTTCAAGAAATGGAAGATGCAAACGATGA
AAACGAAGATGTGAAAATTACAGCTAAACAGAAATATGCACAATCTCGTA
AAATATATATGGATCTTGTTACACAGAGCTTGGCCGGAATAGTTTGTAGA
CTAAATCAGTATTCAACTAAGCAATCCGTCAGTTCACGATTTCAACTGGA
CTTAGTTGAAATGCTGGTTTATTTTTCGTCTAATCCGGCGAATCCAGGGA
GTGGACCTGCCCCATCATTAGCTATTACCGATGAAACACGAACATGGTTA
CTTGGACGAGTTGAAAATCTTTTACTGAGTGTCGATTTGCCTCATAATTT
TGTATTGAAACAAATGGACCGATTCATCAGCCGTATAAATGCCCCAGATC
AATTGCTGGAAATTTATGGTGTTTACAGAGCTACCGTTAACCAGGCAGCA
TAAATGTTCGTTGTATTTTATGTTCTAATTAAAAGCGTTCTCATATCTTT
CTCGAATGAATCATTTATATGCTTGTTAATTTCACTATCCGGATTCACAT
AAATTTAGATTTTTGTGTAATTTCATTTTGTCACCAAAATTTCATATGTT
GGCGCTTAGAGGCTAAACTAATTCGAGATTACAAAGGATAACCGTGGTGT
TATTGGCAGCTCATCTCTTTTTGCGAGATATAATGATTTATGTTGATGTT
TGCAACTGTAGACGATTTTTAATTTTATTTTTGTTGTGTTTTTAGTCTAT
TTACTGTTTCACATAATTTTGATATCTGTTTGCAGTGCGTGCTTATATGC
AGTAGCTAATTTAACAACTTCTAACACTTAG
back to top

protein sequence of SMED30003920-orf-1

>SMED30003920-orf-1 ID=SMED30003920-orf-1|Name=SMED30003920-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=902bp
MSRRKRSPDSSDEEYNDKSKRFVGHHDVQETLENLIYELGDKDLYALPND
LQSVASILKKDSSIMKFEILEILVNCAENIPEKLTIYVTLIGLVNFKDYS
LGEEFVELLLKHFKEAIKCGNHDDTKFLLRFMSDLINTCVIHPQSIMLLY
NVLIAQALEDNTPQLCSDWLVYIVMYSLPWSASKLASQCHSELDKMMQNI
EIYMEKRLVDHLGILQVWTSNEFQPQEDFMDCLWNQLKNMRMQSWREKVL
WRLYNDPNLAILVQQSRPHKLPQLSLTLSTSVYPLPMVIFRLFDYTDVIE
DELQTSKKEPMPSLDDQNNIAGDEPEVKVLEKMEVTESKPAIEQLILPGS
HSIERFLVEEQYRIIVNGLKTNRKLCAKALIALPMRVRLPVSYMIVETIL
GELFKLPKSDQTHVCYTSLLIELCREAANSIPLVLAQATEMLFDRIEQMR
PVCIERFVCWFSHHLSNFKFQWSWSDWASCVQDSVDKPKTRFIVEVLQRL
LRFSYFEYVSKIVPAEFARLLPKPPGSVNKYGDGAPKTLSCQKIARELAT
MIKSQGKIDEIIDFLRKISDDRVLIVSAKTEKTTEITETVNEDVKITNNE
ESENLNVEKMEPENYEEDIVETSENIEATHIVSGLYPGVTRRVIDVLMTV
ILNLGSKTFTHAFLYLDKFRDVIKEFVKEEGDKVEMLHSLYGVWQEQQQM
VVVITERLLEVELISPRAILCWLFSDEMFTQTNCFYVWEIIDAVLARASL
EENCAWNKLQEMEDANDENEDVKITAKQKYAQSRKIYMDLVTQSLAGIVC
RLNQYSTKQSVSSRFQLDLVEMLVYFSSNPANPGSGPAPSLAITDETRTW
LLGRVENLLLSVDLPHNFVLKQMDRFISRINAPDQLLEIYGVYRATVNQA
A*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000184nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:00063707-methylguanosine mRNA capping
GO:0006397mRNA processing
GO:0006406mRNA export from nucleus
GO:0006417regulation of translation
GO:0006446regulation of translational initiation
GO:0008380RNA splicing
GO:0031047gene silencing by RNA
GO:0031442positive regulation of mRNA 3'-end processing
GO:0098789pre-mRNA cleavage required for polyadenylation
GO:0016070RNA metabolic process
GO:0045292mRNA cis splicing, via spliceosome
GO:0051028mRNA transport
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005845mRNA cap binding complex
GO:0005846nuclear cap binding complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR003890MIF4G-like_typ-3
IPR016021MIF4-like_sf
IPR015174MIF4G-like_typ-2
IPR015172MIF4G-like_typ-1
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003723RNA binding
GO:0005488binding
GO:0000339RNA cap binding