SMED30003914

Overview
NameSMED30003914
Smed IDSMED30003914
Length (bp)694
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30003914 (SMED30003914) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30003914 (SMED30003914) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30003914 (SMED30003914) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30003914 (SMED30003914) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003914

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30003914SMESG000070289.1 SMESG000066561.1 SMESG000037674.1 dd_Smed_v4_6949_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30003914 vs. TrEMBL
Match: C4QR08 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 GN=Smp_183860 PE=4 SV=2)

HSP 1 Score: 51.9878 bits (123), Expect = 8.968e-12
Identity = 36/127 (28.35%), Postives = 60/127 (47.24%), Query Frame = 1
Query:  169 IKNIFYWPNIXXXIXXXXXRNXXXXXXXKVNQEQTKQIKKKPRVSSEFLDQIVIDIAYMKPIATTK----YAVVIIDRFTKLVSLTATSKQDDKAMYRVLLHQWVYKFGKPRSIVSDRGKCISERKI 537
            ++  F+WP++   +     +N       K +  QT +    P V++    ++ IDI  M P+ TTK    Y +V++D FTK        +QD   + R  +  WV ++G P S+ SD+G     R I
Sbjct: 1009 VRQRFWWPSMHEDVVQIC-KNCNTCYRFK-SPRQTSRAPLTPMVTTGPHQRVGIDI--MGPLTTTKKGNRYILVMVDYFTKWCEAVPLPQQDALTVARAFIDHWVSRYGAPFSLHSDQGPAFESRLI 1131          

HSP 2 Score: 38.891 bits (89), Expect = 8.968e-12
Identity = 19/60 (31.67%), Postives = 37/60 (61.67%), Query Frame = 2
Query:  512 ESAFLKEKLGVLGINQEFSSPHQHQSNGLVERTVRTTRDLITTYLAGVSEEKNWLEILPK 691
            ES  + E   +LGI +  ++ +  + NGLVERT R+ + ++  +++  S+E  W ++LP+
Sbjct: 1127 ESRLIAEICQLLGIRKTRTTAYHPEGNGLVERTNRSIKAILQAFVSRSSQEL-WDDVLPQ 1185          

HSP 3 Score: 27.335 bits (59), Expect = 8.968e-12
Identity = 15/42 (35.71%), Postives = 24/42 (57.14%), Query Frame = 2
Query:   26 NLKI-NDGLLIVNKNGIDLLLVPIEFTQQLVTKIHEETCHIG 148
            NLK+  D L ++N+    LL+VP    + +V ++H E  H G
Sbjct:  960 NLKLYGDTLFLINEARQPLLVVPRIKVESIVEQVHRELGHAG 1001          
BLAST of SMED30003914 vs. TrEMBL
Match: G4V6I5 (KRAB-A domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_195130 PE=4 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 9.040e-12
Identity = 36/127 (28.35%), Postives = 60/127 (47.24%), Query Frame = 1
Query:  169 IKNIFYWPNIXXXIXXXXXRNXXXXXXXKVNQEQTKQIKKKPRVSSEFLDQIVIDIAYMKPIATTK----YAVVIIDRFTKLVSLTATSKQDDKAMYRVLLHQWVYKFGKPRSIVSDRGKCISERKI 537
            ++  F+WP++   +     +N       K +  QT +    P V++    ++ IDI  M P+ TTK    Y +V++D FTK        +QD   + R  +  WV ++G P S+ SD+G     R I
Sbjct: 1009 VRQRFWWPSMHEDVVQIC-KNCNTCYRFK-SPRQTSRAPLTPMVTTGPHQRVGIDI--MGPLTTTKKGNRYILVMVDYFTKWCEAVPLPQQDALTVARAFIDHWVSRYGAPFSLHSDQGPAFESRLI 1131          

HSP 2 Score: 38.891 bits (89), Expect = 9.040e-12
Identity = 19/60 (31.67%), Postives = 37/60 (61.67%), Query Frame = 2
Query:  512 ESAFLKEKLGVLGINQEFSSPHQHQSNGLVERTVRTTRDLITTYLAGVSEEKNWLEILPK 691
            ES  + E   +LGI +  ++ +  + NGLVERT R+ + ++  +++  S+E  W ++LP+
Sbjct: 1127 ESRLIAEICQLLGIRKTRTTAYHPEGNGLVERTNRSIKAILQAFVSRSSQEL-WDDVLPQ 1185          

HSP 3 Score: 27.335 bits (59), Expect = 9.040e-12
Identity = 15/42 (35.71%), Postives = 24/42 (57.14%), Query Frame = 2
Query:   26 NLKI-NDGLLIVNKNGIDLLLVPIEFTQQLVTKIHEETCHIG 148
            NLK+  D L ++N+    LL+VP    + +V ++H E  H G
Sbjct:  960 NLKLYGDTLFLINEARQPLLVVPRIKVESIVEQVHRELGHAG 1001          
BLAST of SMED30003914 vs. TrEMBL
Match: G4LXM2 (KRAB-A domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_195120 PE=4 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 9.961e-12
Identity = 36/127 (28.35%), Postives = 60/127 (47.24%), Query Frame = 1
Query:  169 IKNIFYWPNIXXXIXXXXXRNXXXXXXXKVNQEQTKQIKKKPRVSSEFLDQIVIDIAYMKPIATTK----YAVVIIDRFTKLVSLTATSKQDDKAMYRVLLHQWVYKFGKPRSIVSDRGKCISERKI 537
            ++  F+WP++   +     +N       K +  QT +    P V++    ++ IDI  M P+ TTK    Y +V++D FTK        +QD   + R  +  WV ++G P S+ SD+G     R I
Sbjct:  988 VRQRFWWPSMHEDVVQIC-KNCNTCYRFK-SPRQTSRAPLTPMVTTGPHQRVGIDI--MGPLTTTKKGNRYILVMVDYFTKWCEAVPLPQQDALTVARAFIDHWVSRYGAPFSLHSDQGPAFESRLI 1110          

HSP 2 Score: 38.891 bits (89), Expect = 9.961e-12
Identity = 19/60 (31.67%), Postives = 37/60 (61.67%), Query Frame = 2
Query:  512 ESAFLKEKLGVLGINQEFSSPHQHQSNGLVERTVRTTRDLITTYLAGVSEEKNWLEILPK 691
            ES  + E   +LGI +  ++ +  + NGLVERT R+ + ++  +++  S+E  W ++LP+
Sbjct: 1106 ESRLIAEICQLLGIRKTRTTAYHPEGNGLVERTNRSIKAILQAFVSRSSQEL-WDDVLPQ 1164          

HSP 3 Score: 27.335 bits (59), Expect = 9.961e-12
Identity = 15/42 (35.71%), Postives = 24/42 (57.14%), Query Frame = 2
Query:   26 NLKI-NDGLLIVNKNGIDLLLVPIEFTQQLVTKIHEETCHIG 148
            NLK+  D L ++N+    LL+VP    + +V ++H E  H G
Sbjct:  939 NLKLYGDTLFLINEARQPLLVVPRIKVESIVEQVHRELGHAG 980          
BLAST of SMED30003914 vs. TrEMBL
Match: G4VF35 (KRAB-A domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_195160 PE=4 SV=1)

HSP 1 Score: 48.9062 bits (115), Expect = 4.701e-11
Identity = 35/115 (30.43%), Postives = 56/115 (48.70%), Query Frame = 1
Query:  181 FYWPNIXXXIXXXXXRNXXXXXXXKVNQEQTKQIKKKPRVSSEFLDQIVIDIAYMKPIATTK----YAVVIIDRFTKLVSLTATSKQDDKAMYRVLLHQWVYKFGKPRSIVSDRG 513
            F+WP++   +     +N       K +  QT +    P V++    +I IDI  M P+ TTK    Y +V++D FTK        +QD   + R  +  WV ++G P S+ SD+G
Sbjct:  516 FWWPSMHEDVVQIC-KNCNTCCRFK-SPRQTPRAPLTPMVTTGPHQRIGIDI--MGPLTTTKKGNCYILVMVDYFTKWCEAVPLPQQDALTVARAFIDHWVSRYGAPFSLNSDQG 626          

HSP 2 Score: 38.5058 bits (88), Expect = 4.701e-11
Identity = 19/60 (31.67%), Postives = 37/60 (61.67%), Query Frame = 2
Query:  512 ESAFLKEKLGVLGINQEFSSPHQHQSNGLVERTVRTTRDLITTYLAGVSEEKNWLEILPK 691
            ES  + E   +LGI +  ++ +  + NGLVERT R+ + ++  +++  S+E  W ++LP+
Sbjct:  630 ESHLIAEICQLLGIRKTRTTAYHPEGNGLVERTNRSIKAILQAFVSRSSQEL-WDDVLPQ 688          

HSP 3 Score: 27.7202 bits (60), Expect = 4.701e-11
Identity = 15/42 (35.71%), Postives = 24/42 (57.14%), Query Frame = 2
Query:   26 NLKI-NDGLLIVNKNGIDLLLVPIEFTQQLVTKIHEETCHIG 148
            NLK+  D L ++N+    LL+VP    + +V ++H E  H G
Sbjct:  463 NLKLYGDTLFLINEARQSLLVVPRIKVESIVEQVHRELGHAG 504          
BLAST of SMED30003914 vs. TrEMBL
Match: G4LU87 (KRAB-A domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_195140 PE=4 SV=1)

HSP 1 Score: 48.521 bits (114), Expect = 1.136e-10
Identity = 34/119 (28.57%), Postives = 58/119 (48.74%), Query Frame = 1
Query:  169 IKNIFYWPNIXXXIXXXXXRNXXXXXXXKVNQEQTKQIKKKPRVSSEFLDQIVIDIAYMKPIATTK----YAVVIIDRFTKLVSLTATSKQDDKAMYRVLLHQWVYKFGKPRSIVSDRG 513
            ++  F+WP++   +     +N       K +  QT +    P V++    ++ IDI  M P+ TTK    Y +V++D  TK        +QD   + RV +  WV ++G P S+ SD+G
Sbjct: 1009 VRQRFWWPSMHEDVVQIC-KNCNTCCRFK-SPRQTPRAPLTPMVTTGPHQRVGIDI--MGPLTTTKKGNRYILVMVDYLTKWCEAVPLPQQDALMVARVFIDHWVSRYGAPFSLHSDQG 1123          

HSP 2 Score: 38.5058 bits (88), Expect = 1.136e-10
Identity = 20/60 (33.33%), Postives = 36/60 (60.00%), Query Frame = 2
Query:  512 ESAFLKEKLGVLGINQEFSSPHQHQSNGLVERTVRTTRDLITTYLAGVSEEKNWLEILPK 691
            ES  + E   +LGI +  ++ +  + NGLVERT R+ + ++  +++  S+E  W  ILP+
Sbjct: 1127 ESHLIAEICQLLGIRKTRTTAYHPEGNGLVERTNRSIKAILQAFVSRSSQEL-WDAILPQ 1185          

HSP 3 Score: 27.335 bits (59), Expect = 1.136e-10
Identity = 15/42 (35.71%), Postives = 24/42 (57.14%), Query Frame = 2
Query:   26 NLKI-NDGLLIVNKNGIDLLLVPIEFTQQLVTKIHEETCHIG 148
            NLK+  D L ++N+    LL+VP    + +V ++H E  H G
Sbjct:  960 NLKLYGDTLFLINEARQPLLVVPRIKVESIVEQVHRELGHAG 1001          
BLAST of SMED30003914 vs. Ensembl Cavefish
Match: ENSAMXT00000058127.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:35454045:35455481:1 gene:ENSAMXG00000038477.1 transcript:ENSAMXT00000058127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 3.614e-11
Identity = 34/126 (26.98%), Postives = 60/126 (47.62%), Query Frame = 1
Query:  151 KKLVIYIKNIFYWPNIXXXIXXXXXRNXXXXXXXKVNQEQTKQIKKKPRVSSEFLDQIVIDIAYMKPIATT----KYAVVIIDRFTKLVSLTATSKQDDKAMYRVLLHQWVYKFGKPRSIVSDRGK 516
            +KL   I+  FYWP     +     R        K +    +     P V+S   ++I +DI  + P+  T    +Y +V+ D F+K     +   Q+ K + +VL  +W+ ++G PRSI +D+G+
Sbjct:   21 QKLKEKIRTRFYWPGWVEDVERWC-RECTDCASRKTSGPAPR-APLLPSVTSRPYERIALDI--LGPLPETPQKNRYILVVGDYFSKWTEAFSLPNQEAKTVAKVLTEEWICRYGAPRSIHTDQGR 142          

HSP 2 Score: 35.4242 bits (80), Expect = 3.614e-11
Identity = 17/59 (28.81%), Postives = 36/59 (61.02%), Query Frame = 2
Query:  512 ESAFLKEKLGVLGINQEFSSPHQHQSNGLVERTVRTTRDLITTYLAGVSEEKNWLEILP 688
            ES    E   +L +++  +SP++ QS+GL+ER  RT   +++ ++   + +++W  +LP
Sbjct:  145 ESHLFSELCRLLNMHKSRTSPYRPQSDGLIERFNRTLLSMLSLFVD--ANQQDWDALLP 201          
BLAST of SMED30003914 vs. Ensembl Cavefish
Match: ENSAMXT00000031920.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:11094903:11101818:1 gene:ENSAMXG00000039354.1 transcript:ENSAMXT00000031920.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 3.986e-11
Identity = 25/79 (31.65%), Postives = 46/79 (58.23%), Query Frame = 1
Query:  292 PRVSSEFLDQIVIDIAYMKPIATT----KYAVVIIDRFTKLVSLTATSKQDDKAMYRVLLHQWVYKFGKPRSIVSDRGK 516
            P V+S   ++I +DI  + P+  T    +Y +V+ D F+K     +   Q+ K + +VL  +W+ ++G PRSI +D+G+
Sbjct:   30 PSVTSRPYERIALDI--LGPLPETPQKNRYILVVGDYFSKWTEAFSLPNQEAKTVAKVLTEEWICRYGAPRSIHTDQGR 106          

HSP 2 Score: 35.8094 bits (81), Expect = 3.986e-11
Identity = 17/61 (27.87%), Postives = 37/61 (60.66%), Query Frame = 2
Query:  512 ESAFLKEKLGVLGINQEFSSPHQHQSNGLVERTVRTTRDLITTYLAGVSEEKNWLEILPKI 694
            ES    E   +L +++  +SP++ QS+GL+ER  RT   +++ ++   + +++W  +LP +
Sbjct:  109 ESHLFSELCRLLNMHKSRTSPYRPQSDGLIERFNRTLLSMLSLFVD--ANQQDWDALLPFV 167          
BLAST of SMED30003914 vs. Ensembl Cavefish
Match: ENSAMXT00000034735.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:30100297:30104277:-1 gene:ENSAMXG00000038047.1 transcript:ENSAMXT00000034735.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.8246 bits (107), Expect = 2.209e-8
Identity = 24/74 (32.43%), Postives = 40/74 (54.05%), Query Frame = 1
Query:  319 QIVIDIAYM-KPIATTKYAVVIIDRFTKLVSLTATSKQDDKAMYRVLLHQWVYKFGKPRSIVSDRGKCISERKI 537
             +V+D   M KP+   +Y +V+ DRF++     AT K+   A  R L+ + + +FG P +I SD G   + + I
Sbjct:  979 HLVMDYLDMGKPVRAFRYIIVVTDRFSRWTEAQATQKETATAAARFLIREVIPRFGVPDTISSDNGSHFANKVI 1052          

HSP 2 Score: 30.4166 bits (67), Expect = 2.209e-8
Identity = 16/48 (33.33%), Postives = 24/48 (50.00%), Query Frame = 2
Query:  545 LGINQEFSSPHQHQSNGLVERTVRTTRDLITTYLAGVSEEKNWLEILP 688
            LGI +     ++ QS G+VER     +  I   +A    + NWL+ LP
Sbjct: 1059 LGIKRRLGCVYRPQSQGIVERQNGVLKAKIAKIIAHSEGKINWLDALP 1106          
BLAST of SMED30003914 vs. Ensembl Cavefish
Match: ENSAMXT00000046506.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000413.1:32288:36199:-1 gene:ENSAMXG00000040932.1 transcript:ENSAMXT00000046506.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.8246 bits (107), Expect = 2.358e-8
Identity = 24/74 (32.43%), Postives = 40/74 (54.05%), Query Frame = 1
Query:  319 QIVIDIAYM-KPIATTKYAVVIIDRFTKLVSLTATSKQDDKAMYRVLLHQWVYKFGKPRSIVSDRGKCISERKI 537
             +V+D   M KP+   +Y +V+ DRF++     AT K+   A  R L+ + + +FG P +I SD G   + + I
Sbjct:  979 HLVMDYLDMGKPVRAFRYIIVVTDRFSRWTEAQATQKETATAAARFLIREVIPRFGVPDTISSDNGSHFANKVI 1052          

HSP 2 Score: 30.4166 bits (67), Expect = 2.358e-8
Identity = 16/48 (33.33%), Postives = 24/48 (50.00%), Query Frame = 2
Query:  545 LGINQEFSSPHQHQSNGLVERTVRTTRDLITTYLAGVSEEKNWLEILP 688
            LGI +     ++ QS G+VER     +  I   +A    + NWL+ LP
Sbjct: 1059 LGIKRRLGCVYRPQSQGIVERQNGVLKAKIAKIIAHSEGKINWLDALP 1106          
BLAST of SMED30003914 vs. Ensembl Cavefish
Match: ENSAMXT00000041754.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001938.1:55959:59870:1 gene:ENSAMXG00000043385.1 transcript:ENSAMXT00000041754.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 41.2022 bits (95), Expect = 3.232e-8
Identity = 22/66 (33.33%), Postives = 34/66 (51.52%), Query Frame = 1
Query:  322 IVIDIAYMKPIATTKYAVVII-DRFTKLVSLTATSKQDDKAMYRVLLHQWVYKFGKPRSIVSDRGK 516
            + ID   ++P +  K  V+I+ D FTK     AT  Q    +   L+  W ++FG P  I SD+G+
Sbjct:  929 LAIDFTILEPASDGKENVLILTDIFTKYTQAIATKDQRASTVAWALVQHWFHRFGPPVRIHSDQGR 994          

HSP 2 Score: 34.6538 bits (78), Expect = 3.232e-8
Identity = 20/61 (32.79%), Postives = 33/61 (54.10%), Query Frame = 2
Query:  512 ESAFLKEKLGVLGINQEFSSPHQHQSNGLVERTVRTTRDLITTYLAGVSEEKNWLEILPKI 694
            ES  +K+   V  I +  ++ ++ Q NG  ER  RT  DL+ T    V E+++W   LP++
Sbjct:  997 ESLLIKQLCKVYSIQKSRTTSYRPQGNGQCERFNRTLHDLLRTL--PVEEKRHWPRHLPQL 1055          
BLAST of SMED30003914 vs. Ensembl Medaka
Match: ENSORLT00000045127.1 (pep primary_assembly:ASM223467v1:10:587855:593081:1 gene:ENSORLG00000029202.1 transcript:ENSORLT00000045127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 1.931e-12
Identity = 26/77 (33.77%), Postives = 44/77 (57.14%), Query Frame = 1
Query:  298 VSSEFLDQIVIDIAYMKPIATT----KYAVVIIDRFTKLVSLTATSKQDDKAMYRVLLHQWVYKFGKPRSIVSDRGK 516
            V S   +++ ++I  + P+  T    KY +VI D F+K         Q+ +++ +VL  +WV +FG PRSI SD+G+
Sbjct:   33 VPSRPFERVALEI--LGPLPETPNKNKYILVISDYFSKWTEAFPLPNQEAQSIAKVLTEEWVCRFGAPRSIHSDQGR 107          

HSP 2 Score: 41.5874 bits (96), Expect = 1.931e-12
Identity = 22/61 (36.07%), Postives = 35/61 (57.38%), Query Frame = 2
Query:  512 ESAFLKEKLGVLGINQEFSSPHQHQSNGLVERTVRTTRDLITTYLAGVSEEKNWLEILPKI 694
            ES   KE   +L I++  +SP+  QS+GLVER  RT   L+  ++     + NW ++LP +
Sbjct:  110 ESTLFKELCSLLSIHKSRTSPYHPQSDGLVERFNRTLLSLLALFVED--NQLNWDKLLPYV 168          
BLAST of SMED30003914 vs. Ensembl Medaka
Match: ENSORLT00000042487.1 (pep primary_assembly:ASM223467v1:4:23584510:23586585:1 gene:ENSORLG00000030583.1 transcript:ENSORLT00000042487.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 42.743 bits (99), Expect = 3.190e-9
Identity = 20/69 (28.99%), Postives = 36/69 (52.17%), Query Frame = 1
Query:  313 LDQIVIDIAYMKPIATTKYAVVII-DRFTKLVSLTATSKQDDKAMYRVLLHQWVYKFGKPRSIVSDRGK 516
            L+ + +D   ++P +  +  V+++ D FTK      T  Q      +VLL +W  K+G P  + SD+G+
Sbjct:  296 LEVVAVDFTLLEPASDGRENVLVVTDVFTKFTQAFPTRDQKADTTAKVLLREWFMKYGVPERLHSDQGR 364          

HSP 2 Score: 36.5798 bits (83), Expect = 3.190e-9
Identity = 19/61 (31.15%), Postives = 32/61 (52.46%), Query Frame = 2
Query:  512 ESAFLKEKLGVLGINQEFSSPHQHQSNGLVERTVRTTRDLITTYLAGVSEEKNWLEILPKI 694
            ES  ++E   + G+ +  ++PH  Q N   ER  RT  DL+ T      +++ W E LP++
Sbjct:  367 ESEVIQELCKLYGVKKTRTTPHHPQGNAQCERFNRTLHDLLRTLPP--EKKRRWPEYLPEL 425          
BLAST of SMED30003914 vs. Ensembl Medaka
Match: ENSORLT00000044989.1 (pep primary_assembly:ASM223467v1:1:17572028:17576089:-1 gene:ENSORLG00000028051.1 transcript:ENSORLT00000044989.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 41.5874 bits (96), Expect = 7.009e-9
Identity = 20/69 (28.99%), Postives = 36/69 (52.17%), Query Frame = 1
Query:  313 LDQIVIDIAYMKPIATTKYAVVII-DRFTKLVSLTATSKQDDKAMYRVLLHQWVYKFGKPRSIVSDRGK 516
            L+ + +D   ++P +  +  V+++ D FTK      T  Q      +VLL +W  K+G P  + SD+G+
Sbjct:  921 LEVVAVDFTLLEPASDGRENVLVVTDVFTKFTQAFPTRDQKADTTAKVLLREWFMKYGVPERLHSDQGR 989          

HSP 2 Score: 36.1946 bits (82), Expect = 7.009e-9
Identity = 19/61 (31.15%), Postives = 32/61 (52.46%), Query Frame = 2
Query:  512 ESAFLKEKLGVLGINQEFSSPHQHQSNGLVERTVRTTRDLITTYLAGVSEEKNWLEILPKI 694
            ES  ++E   + G+ +  ++PH  Q N   ER  RT  DL+ T      +++ W E LP++
Sbjct:  992 ESEVIQELCKLYGVKKTRTTPHHPQGNAQCERFNRTLHDLLRTLPP--EKKRRWPEYLPEL 1050          
BLAST of SMED30003914 vs. Ensembl Medaka
Match: ENSORLT00000037906.1 (pep primary_assembly:ASM223467v1:16:28643737:28647831:-1 gene:ENSORLG00000027277.1 transcript:ENSORLT00000037906.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 40.4318 bits (93), Expect = 1.440e-8
Identity = 19/70 (27.14%), Postives = 36/70 (51.43%), Query Frame = 1
Query:  313 LDQIVIDIAYMKPIATTKYAVVII-DRFTKLVSLTATSKQDDKAMYRVLLHQWVYKFGKPRSIVSDRGKC 519
            L+ + +D   ++P +  +  V+I+ D F+K      T  Q    + + L+  W+  +G P  I SD+G+C
Sbjct:  955 LEVVAMDFTVLEPSSDRRENVLIMTDVFSKFTVAVPTRDQRAVTVVKALVKHWIQPYGVPSRIHSDQGRC 1024          

HSP 2 Score: 36.5798 bits (83), Expect = 1.440e-8
Identity = 18/51 (35.29%), Postives = 29/51 (56.86%), Query Frame = 2
Query:  542 VLGINQEFSSPHQHQSNGLVERTVRTTRDLITTYLAGVSEEKNWLEILPKI 694
            V GI +  ++P+  Q NG  ER  RT  DL+ T      +++ W+E LP++
Sbjct: 1036 VYGIRKSRTTPYHAQGNGQCERFNRTLHDLLRTLHP--HQKRRWVEYLPEL 1084          
BLAST of SMED30003914 vs. Ensembl Medaka
Match: ENSORLT00000028117.1 (pep primary_assembly:ASM223467v1:24:13054435:13059264:-1 gene:ENSORLG00000029879.1 transcript:ENSORLT00000028117.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 39.2762 bits (90), Expect = 4.570e-8
Identity = 19/72 (26.39%), Postives = 36/72 (50.00%), Query Frame = 1
Query:  313 LDQIVIDIAYMKPIATTKYAVVII-DRFTKLVSLTATSKQDDKAMYRVLLHQWVYKFGKPRSIVSDRGKCIS 525
            L+ + +D   ++P +  +  V+I+ D F+K      T  Q    + + L+  W+  +G P  I SD+G+C  
Sbjct:   38 LEVVAMDFTVLEPSSDRRENVLIMTDVFSKFTVAVPTRDQRAVTVVKALVKHWIQPYGVPSRIHSDQGRCFE 109          

HSP 2 Score: 36.1946 bits (82), Expect = 4.570e-8
Identity = 19/61 (31.15%), Postives = 33/61 (54.10%), Query Frame = 2
Query:  512 ESAFLKEKLGVLGINQEFSSPHQHQSNGLVERTVRTTRDLITTYLAGVSEEKNWLEILPKI 694
            E+  ++    V GI +  ++P+  Q NG  ER  RT  DL+ T      +++ W+E LP++
Sbjct:  109 EADVVQGLCKVYGIRKSRTTPYHAQGNGQCERFNRTLHDLLRTLHP--HQKRRWVEYLPEL 167          
BLAST of SMED30003914 vs. Planmine SMEST
Match: SMESG000047038.1 (SMESG000047038.1)

HSP 1 Score: 113.235 bits (282), Expect = 5.469e-51
Identity = 55/61 (90.16%), Postives = 58/61 (95.08%), Query Frame = 2
Query:  512 ESAFLKEKLGVLGINQEFSSPHQHQSNGLVERTVRTTRDLITTYLAGVSEEKNWLEILPKI 694
            ESAFLKEKL VLGINQEFSS +QHQSNGLVERT+RTTR+LITT LAGVSEEKNWLEILPKI
Sbjct:   92 ESAFLKEKLSVLGINQEFSSLYQHQSNGLVERTIRTTRELITTSLAGVSEEKNWLEILPKI 152          

HSP 2 Score: 85.8853 bits (211), Expect = 5.469e-51
Identity = 42/53 (79.25%), Postives = 44/53 (83.02%), Query Frame = 1
Query:  364 KYAVVIIDRFTKLVSLTATSKQDDKAMYRVLLHQWVYKFGKPRSIVSDRGKCI 522
            KY VVIIDRFTKLVSLTATSKQDDKA+YRVLL Q +YKFGKP     DRGKC 
Sbjct:   44 KYVVVIIDRFTKLVSLTATSKQDDKAIYRVLLQQCIYKFGKP-----DRGKCF 91          

HSP 3 Score: 41.2022 bits (95), Expect = 5.469e-51
Identity = 17/21 (80.95%), Postives = 19/21 (90.48%), Query Frame = 3
Query:  303 LRIFGSNCNRHCLYETNSDNE 365
            LRIFGSNCN HCLYETNS+ +
Sbjct:   24 LRIFGSNCNIHCLYETNSEKK 44          
BLAST of SMED30003914 vs. Planmine SMEST
Match: SMESG000047038.1 (SMESG000047038.1)

HSP 1 Score: 112.849 bits (281), Expect = 6.831e-51
Identity = 55/61 (90.16%), Postives = 58/61 (95.08%), Query Frame = 2
Query:  512 ESAFLKEKLGVLGINQEFSSPHQHQSNGLVERTVRTTRDLITTYLAGVSEEKNWLEILPKI 694
            ESAFLKEKL VLGINQEFSS +QHQSNGLVERT+RTTR+LITT LAGVSEEKNWLEILPKI
Sbjct:   89 ESAFLKEKLSVLGINQEFSSLYQHQSNGLVERTIRTTRELITTSLAGVSEEKNWLEILPKI 149          

HSP 2 Score: 85.8853 bits (211), Expect = 6.831e-51
Identity = 42/53 (79.25%), Postives = 44/53 (83.02%), Query Frame = 1
Query:  364 KYAVVIIDRFTKLVSLTATSKQDDKAMYRVLLHQWVYKFGKPRSIVSDRGKCI 522
            KY VVIIDRFTKLVSLTATSKQDDKA+YRVLL Q +YKFGKP     DRGKC 
Sbjct:   41 KYVVVIIDRFTKLVSLTATSKQDDKAIYRVLLQQCIYKFGKP-----DRGKCF 88          

HSP 3 Score: 40.817 bits (94), Expect = 6.831e-51
Identity = 17/21 (80.95%), Postives = 19/21 (90.48%), Query Frame = 3
Query:  303 LRIFGSNCNRHCLYETNSDNE 365
            LRIFGSNCN HCLYETNS+ +
Sbjct:   21 LRIFGSNCNIHCLYETNSEKK 41          
BLAST of SMED30003914 vs. Planmine SMEST
Match: SMESG000049233.1 (SMESG000049233.1)

HSP 1 Score: 132.88 bits (333), Expect = 1.002e-50
Identity = 74/106 (69.81%), Postives = 79/106 (74.53%), Query Frame = 1
Query:  151 KKLVIYIKNIFYWPNIXXXIXXXXXRNXXXXXXXKVNQEQTKQIKKKPRVSSEFLDQIVIDIAYMKPIATTKYAVVIIDRFTKLVSLTATSKQDDKAMYRVLLHQW 468
            KKLV YI NIFYWPN+   I     +        KVNQEQTK+I   P V SEF DQIVIDIAYMKPIAT KYAVVI D F+KLVSLTATSKQDDKA+YRVLLHQW
Sbjct:  370 KKLVHYINNIFYWPNLQSTIKECLQK-CQECARRKVNQEQTKEILL-PHVISEFSDQIVIDIAYMKPIATKKYAVVIKD-FSKLVSLTATSKQDDKAIYRVLLHQW 472          

HSP 2 Score: 85.5001 bits (210), Expect = 1.002e-50
Identity = 40/46 (86.96%), Postives = 44/46 (95.65%), Query Frame = 2
Query:   17 LRDNLKINDGLLIVNKNGIDLLLVPIEFTQQLVTKIHEETCHIGVK 154
            LRDNLK+NDGLLIVNKNG+DLLLVPIEFTQQLVTKIHE+ C +GVK
Sbjct:  325 LRDNLKMNDGLLIVNKNGMDLLLVPIEFTQQLVTKIHEKMCRVGVK 370          
BLAST of SMED30003914 vs. Planmine SMEST
Match: SMESG000049233.1 (SMESG000049233.1)

HSP 1 Score: 132.88 bits (333), Expect = 1.018e-50
Identity = 74/106 (69.81%), Postives = 79/106 (74.53%), Query Frame = 1
Query:  151 KKLVIYIKNIFYWPNIXXXIXXXXXRNXXXXXXXKVNQEQTKQIKKKPRVSSEFLDQIVIDIAYMKPIATTKYAVVIIDRFTKLVSLTATSKQDDKAMYRVLLHQW 468
            KKLV YI NIFYWPN+   I     +        KVNQEQTK+I   P V SEF DQIVIDIAYMKPIAT KYAVVI D F+KLVSLTATSKQDDKA+YRVLLHQW
Sbjct:  398 KKLVHYINNIFYWPNLQSTIKECLQK-CQECARRKVNQEQTKEILL-PHVISEFSDQIVIDIAYMKPIATKKYAVVIKD-FSKLVSLTATSKQDDKAIYRVLLHQW 500          

HSP 2 Score: 85.5001 bits (210), Expect = 1.018e-50
Identity = 40/46 (86.96%), Postives = 44/46 (95.65%), Query Frame = 2
Query:   17 LRDNLKINDGLLIVNKNGIDLLLVPIEFTQQLVTKIHEETCHIGVK 154
            LRDNLK+NDGLLIVNKNG+DLLLVPIEFTQQLVTKIHE+ C +GVK
Sbjct:  353 LRDNLKMNDGLLIVNKNGMDLLLVPIEFTQQLVTKIHEKMCRVGVK 398          
BLAST of SMED30003914 vs. Planmine SMEST
Match: SMESG000050541.1 (SMESG000050541.1)

HSP 1 Score: 110.538 bits (275), Expect = 2.595e-49
Identity = 52/61 (85.25%), Postives = 56/61 (91.80%), Query Frame = 2
Query:  512 ESAFLKEKLGVLGINQEFSSPHQHQSNGLVERTVRTTRDLITTYLAGVSEEKNWLEILPKI 694
            E AFLKEKLGV  INQEFSSP+QHQSNGLVER +RTTRDLITT LAGVSEEKNWLEILP++
Sbjct:   61 EIAFLKEKLGVFEINQEFSSPYQHQSNGLVERPIRTTRDLITTCLAGVSEEKNWLEILPRL 121          

HSP 2 Score: 103.605 bits (257), Expect = 2.595e-49
Identity = 47/60 (78.33%), Postives = 52/60 (86.67%), Query Frame = 1
Query:  343 MKPIATTKYAVVIIDRFTKLVSLTATSKQDDKAMYRVLLHQWVYKFGKPRSIVSDRGKCI 522
            MKPIAT +Y VV+IDRF KLVSLTATSKQD KA+YRV LHQW+YKF KP+SI SDRGKC 
Sbjct:    1 MKPIATKRYVVVLIDRFKKLVSLTATSKQDYKAIYRVFLHQWIYKFEKPKSIFSDRGKCF 60          
The following BLAST results are available for this feature:
BLAST of SMED30003914 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003914 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003914 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003914 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003914 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003914 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003914 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003914 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C4QR088.968e-1228.35Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
G4V6I59.040e-1228.35KRAB-A domain-containing protein OS=Schistosoma ma... [more]
G4LXM29.961e-1228.35KRAB-A domain-containing protein OS=Schistosoma ma... [more]
G4VF354.701e-1130.43KRAB-A domain-containing protein OS=Schistosoma ma... [more]
G4LU871.136e-1028.57KRAB-A domain-containing protein OS=Schistosoma ma... [more]
back to top
BLAST of SMED30003914 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000058127.13.614e-1126.98pep primary_assembly:Astyanax_mexicanus-2.0:16:354... [more]
ENSAMXT00000031920.13.986e-1131.65pep primary_assembly:Astyanax_mexicanus-2.0:12:110... [more]
ENSAMXT00000034735.12.209e-832.43pep primary_assembly:Astyanax_mexicanus-2.0:12:301... [more]
ENSAMXT00000046506.12.358e-832.43pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000041754.13.232e-833.33pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SMED30003914 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003914 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003914 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003914 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000045127.11.931e-1233.77pep primary_assembly:ASM223467v1:10:587855:593081:... [more]
ENSORLT00000042487.13.190e-928.99pep primary_assembly:ASM223467v1:4:23584510:235865... [more]
ENSORLT00000044989.17.009e-928.99pep primary_assembly:ASM223467v1:1:17572028:175760... [more]
ENSORLT00000037906.11.440e-827.14pep primary_assembly:ASM223467v1:16:28643737:28647... [more]
ENSORLT00000028117.14.570e-826.39pep primary_assembly:ASM223467v1:24:13054435:13059... [more]
back to top
BLAST of SMED30003914 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047038.15.469e-5190.16SMESG000047038.1[more]
SMESG000047038.16.831e-5190.16SMESG000047038.1[more]
SMESG000049233.11.002e-5069.81SMESG000049233.1[more]
SMESG000049233.11.018e-5069.81SMESG000049233.1[more]
SMESG000050541.12.595e-4985.25SMESG000050541.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003914 ID=SMED30003914|Name=SMED30003914|organism=Schmidtea mediterranea sexual|type=transcript|length=694bp
TTCCGATCTTTTTAAGCTAAGGGATAATTTGAAAATAAATGATGGTCTTT
TGATTGTAAATAAAAATGGGATTGATTTATTATTGGTCCCCATCGAATTC
ACTCAACAACTTGTTACTAAAATTCATGAAGAAACGTGCCATATCGGAGT
AAAAAACTAGTGATTTATATAAAAAATATATTCTATTGGCCAAACATACA
NTNNNCNATTNANNNNANNNNNNACAGAAATNTCNNNAANGNANNNGNNN
GAAAAGTAAACCAAGAACAAACAAAACAAATAAAAAAAAAACCTCGTGTA
AGCTCAGAATTTTTGGATCAAATTGTAATAGACATTGCTTATATGAAACC
AATAGCGACAACGAAATATGCTGTAGTTATAATTGACAGATTTACAAAAT
TAGTCAGTTTAACAGCTACTTCAAAACAAGACGATAAAGCTATGTATAGA
GTCTTGTTACATCAATGGGTTTATAAGTTTGGAAAGCCAAGGAGTATAGT
TTCAGATAGGGGAAAGTGCATTTCTGAAAGAAAAATTAGGTGTACTTGGG
ATTAACCAAGAATTTAGTTCACCTCATCAACATCAGTCAAATGGCTTGGT
TGAGCGCACAGTAAGAACCACGAGGGACCTCATAACTACATACTTGGCTG
GAGTAAGTGAGGAGAAAAATTGGTTGGAAATCCTACCGAAGATT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR012337RNaseH-like_sf
IPR001584Integrase_cat-core
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
Vocabulary: biological process
TermDefinition
GO:0015074DNA integration