Lipoma HMGIC fusion partner-like protein

Overview
NameLipoma HMGIC fusion partner-like protein
Smed IDSMED30003907
Length (bp)1195
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lipoma HMGIC fusion partner-like protein (SMED30003907) t-SNE clustered cells

Violin plots show distribution of expression levels for Lipoma HMGIC fusion partner-like protein (SMED30003907) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lipoma HMGIC fusion partner-like protein (SMED30003907) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lipoma HMGIC fusion partner-like protein (SMED30003907) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003907

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30003907SMESG000070312.1 SmedASXL_009053SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30003907SMESG000070312.1 dd_Smed_v6_9373_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30003907SMESG000070312.1 OX_Smed_1.0.20237ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Human
Match: LHFPL6 (LHFPL tetraspan subfamily member 6 [Source:HGNC Symbol;Acc:HGNC:6586])

HSP 1 Score: 88.5817 bits (218), Expect = 6.959e-20
Identity = 57/180 (31.67%), Postives = 87/180 (48.33%), Query Frame = 3
Query:  237 WSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIM-PGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTT 770
            W+ L++L A     G  +PYW+ GS +     F    G FRRC YPV      + +M   CG Y  F  +P   W++C ++  +   +L  +     +     D++    V +     QF+ G+L+   C LYPLGW    EV Q CG ++    LG+C +GWA+  T AG   ++L  T
Sbjct:   12 WALLSFLCAATSCVGFFMPYWLWGSQLGKPVSF----GTFRRCSYPVHDESRQMMVMVEECGRYASFQGIPSAEWRICTIVTGLGCGLLLLVALTALMGCCVSDLIS-RTVGRVAGGIQFLGGLLIGAGCALYPLGWDSE-EVRQTCGYTSGQFDLGKCEIGWAYYCTGAGATAAMLLCT 185          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Human
Match: LHFPL6 (LHFPL tetraspan subfamily member 6 [Source:HGNC Symbol;Acc:HGNC:6586])

HSP 1 Score: 88.5817 bits (218), Expect = 6.959e-20
Identity = 57/180 (31.67%), Postives = 87/180 (48.33%), Query Frame = 3
Query:  237 WSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIM-PGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTT 770
            W+ L++L A     G  +PYW+ GS +     F    G FRRC YPV      + +M   CG Y  F  +P   W++C ++  +   +L  +     +     D++    V +     QF+ G+L+   C LYPLGW    EV Q CG ++    LG+C +GWA+  T AG   ++L  T
Sbjct:   12 WALLSFLCAATSCVGFFMPYWLWGSQLGKPVSF----GTFRRCSYPVHDESRQMMVMVEECGRYASFQGIPSAEWRICTIVTGLGCGLLLLVALTALMGCCVSDLIS-RTVGRVAGGIQFLGGLLIGAGCALYPLGWDSE-EVRQTCGYTSGQFDLGKCEIGWAYYCTGAGATAAMLLCT 185          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Human
Match: LHFPL1 (LHFPL tetraspan subfamily member 1 [Source:HGNC Symbol;Acc:HGNC:6587])

HSP 1 Score: 82.8037 bits (203), Expect = 9.689e-18
Identity = 49/164 (29.88%), Postives = 83/164 (50.61%), Query Frame = 3
Query:  237 WSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIMPGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAF 725
            W+FL+ ++A+       LPYW+ GS +     F      FRRC YPVR   +++ ++  CG Y  F  +P + W++C V+      +L  +     +     +++    + +     QF+ G+L+   C LYPLGW    E+ Q CG+ ++   LG C +GWA+
Sbjct:   12 WAFLSLVTAVTSSTSYFLPYWLFGSQMGKPVSF----STFRRCNYPVRGEGHSLIMVEECGRYASFNAIPSLAWQMCTVVTGAGCALLLLVALAAVLGCCMEELIS-RMMGRCMGAAQFVGGLLISSGCALYPLGWNSP-EIMQTCGNVSNQFQLGTCRLGWAY 169          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Human
Match: LHFPL4 (LHFPL tetraspan subfamily member 4 [Source:HGNC Symbol;Acc:HGNC:29568])

HSP 1 Score: 57.7658 bits (138), Expect = 6.069e-9
Identity = 34/113 (30.09%), Postives = 59/113 (52.21%), Query Frame = 3
Query:  558 NVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNIETEFSNERDIYLSSTTRESVRYGSEVA 896
             V+K C   Q +A + +++ C+++P GW     +  +CG  T   SLG C V WA++L    G+L+ L  +  A +L N  Q+  ++ E   E   ++ ST    +R G +V+
Sbjct:  123 TVYKICAWMQLLAALCLVLGCMIFPDGWDAE-TIRDMCGAKTGKYSLGDCSVRWAYILAII-GILNALILSFLAFVLGNR-QTDLLQEELKPENKDFVGSTVSSVLRPGGDVS 232          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Human
Match: LHFPL3 (LHFPL tetraspan subfamily member 3 [Source:HGNC Symbol;Acc:HGNC:6589])

HSP 1 Score: 55.8398 bits (133), Expect = 1.951e-8
Identity = 33/104 (31.73%), Postives = 54/104 (51.92%), Query Frame = 3
Query:  558 NVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNIETEFSNERDIYLSSTTRE 869
             V+K C   Q  +   +++ C+++P GW  + EV ++CG+ T   +LG C V WA++L    G+L  L  +  A +L N   S+  E E   E  + LS  + E
Sbjct:  122 TVYKICAWMQLTSAACLVLGCMIFPDGWDSD-EVKRMCGEKTDKYTLGACSVRWAYILAII-GILDALILSFLAFVLGNRQDSLMAE-ELKAENKVLLSQYSLE 222          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Zebrafish
Match: lhfpl6 (LHFPL tetraspan subfamily member 6 [Source:NCBI gene;Acc:494110])

HSP 1 Score: 88.1965 bits (217), Expect = 6.085e-20
Identity = 57/187 (30.48%), Postives = 90/187 (48.13%), Query Frame = 3
Query:  216 MRCLWFSWSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRS-IKNTIKIMPGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTT 770
            + C    W+ L++L A     G  +PYW+ GS +     F    G FRRC YP+R   +    ++  CG Y  F  +P + W++C V+  I   +L  +     +     D++    + +     QF+ G+L+   C LYPLGW    EV Q C +S+    LG C +GWA+  T AG   +++  T
Sbjct:    5 LTCAGVIWALLSFLCAATSCVGFFMPYWLLGSQMGKPVSF----GTFRRCSYPIRDEARGGTVMLEQCGRYASFQGIPSLEWRICTVVTGIGCGLLLLVALTAIMGCCVTDLIS-RTIGRVAGGIQFVGGLLIGSGCALYPLGWDSE-EVRQTCSNSSDQFDLGSCEIGWAYYCTGAGAAAAMVLCT 185          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Zebrafish
Match: lhfpl6 (LHFPL tetraspan subfamily member 6 [Source:NCBI gene;Acc:494110])

HSP 1 Score: 88.1965 bits (217), Expect = 6.085e-20
Identity = 57/187 (30.48%), Postives = 90/187 (48.13%), Query Frame = 3
Query:  216 MRCLWFSWSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRS-IKNTIKIMPGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTT 770
            + C    W+ L++L A     G  +PYW+ GS +     F    G FRRC YP+R   +    ++  CG Y  F  +P + W++C V+  I   +L  +     +     D++    + +     QF+ G+L+   C LYPLGW    EV Q C +S+    LG C +GWA+  T AG   +++  T
Sbjct:    5 LTCAGVIWALLSFLCAATSCVGFFMPYWLLGSQMGKPVSF----GTFRRCSYPIRDEARGGTVMLEQCGRYASFQGIPSLEWRICTVVTGIGCGLLLLVALTAIMGCCVTDLIS-RTIGRVAGGIQFVGGLLIGSGCALYPLGWDSE-EVRQTCSNSSDQFDLGSCEIGWAYYCTGAGAAAAMVLCT 185          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Zebrafish
Match: lhfpl6 (LHFPL tetraspan subfamily member 6 [Source:NCBI gene;Acc:494110])

HSP 1 Score: 88.1965 bits (217), Expect = 6.085e-20
Identity = 57/187 (30.48%), Postives = 90/187 (48.13%), Query Frame = 3
Query:  216 MRCLWFSWSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRS-IKNTIKIMPGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTT 770
            + C    W+ L++L A     G  +PYW+ GS +     F    G FRRC YP+R   +    ++  CG Y  F  +P + W++C V+  I   +L  +     +     D++    + +     QF+ G+L+   C LYPLGW    EV Q C +S+    LG C +GWA+  T AG   +++  T
Sbjct:    5 LTCAGVIWALLSFLCAATSCVGFFMPYWLLGSQMGKPVSF----GTFRRCSYPIRDEARGGTVMLEQCGRYASFQGIPSLEWRICTVVTGIGCGLLLLVALTAIMGCCVTDLIS-RTIGRVAGGIQFVGGLLIGSGCALYPLGWDSE-EVRQTCSNSSDQFDLGSCEIGWAYYCTGAGAAAAMVLCT 185          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Zebrafish
Match: LHFPL6 (LHFPL tetraspan subfamily member 6 [Source:HGNC Symbol;Acc:HGNC:6586])

HSP 1 Score: 78.9518 bits (193), Expect = 6.942e-17
Identity = 52/170 (30.59%), Postives = 82/170 (48.24%), Query Frame = 3
Query:  216 MRCLWFSWSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIM-PGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLG--RCHV 713
            + C    W+ ++ LSA     G  +PYW+ GS +     F    G FRRC YPVR  +    +M   CG Y  F  +P V W++C V+  +   +L  +     +     +++   ++ ++    QF+ G+L+   C LYPLGW    EV Q C +S+    LG   CH+
Sbjct:    5 LTCTGVIWALVSLLSAAASCVGFFMPYWLLGSQMDKAVSF----GTFRRCSYPVRDEERQATVMLEQCGRYASFQGIPSVEWRICTVITGVGCGLLLLVGLTALMGCCISELIS-RSIGRAAGGIQFLGGLLIGSGCALYPLGWDSE-EVRQTCNNSSDQFELGTSSCHL 168          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Zebrafish
Match: lhfpl2b (LHFPL tetraspan subfamily member 2b [Source:ZFIN;Acc:ZDB-GENE-050417-10])

HSP 1 Score: 55.4546 bits (132), Expect = 1.734e-8
Identity = 40/147 (27.21%), Postives = 71/147 (48.30%), Query Frame = 3
Query:  345 LGIFRRCVYPVRSIKNTIKIMPGCGHY--EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPA 779
            LGI+ RC      +K   + +  CG Y  +F+++   +W+  ++ ++I   +L  +  L         ILK +++   C + Q IAG+ +++  +LYP GW    +V   CG   S   +G C +GWAF     G +L+ +     A
Sbjct:   58 LGIYNRC------LKVAQQKVVQCGPYATDFMEIASGFWQATVIFLVIGIFLLSVVGILSVFSMCFQSILK-KSIFNVCGLLQGIAGLFLILGLMLYPAGWGSK-KVVDYCGPDASAYKVGLCSLGWAFYTAIGGTVLTFICAMFSA 196          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Xenopus
Match: lhfpl6 (LHFPL tetraspan subfamily member 6 [Source:NCBI gene;Acc:100145781])

HSP 1 Score: 85.8853 bits (211), Expect = 5.219e-19
Identity = 57/187 (30.48%), Postives = 88/187 (47.06%), Query Frame = 3
Query:  216 MRCLWFSWSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRS-IKNTIKIMPGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTT 770
            + C    W+ L++L A     G  +PYW+ GS +     F    G FRRC YPVR   + T  ++  CG Y  F  +P   W++C ++  +   +L  +     +     +++    V +     QF+ G+L+   C LYPLGW    EV Q CG+ +    LG C  GWA+  T  G  + +L  T
Sbjct:    5 LTCAGVIWALLSFLCAAASCVGFFMPYWLLGSQLDKPVSF----GTFRRCSYPVRDETRQTTFMVEQCGRYASFEAIPSPEWRICTIVTGLGCGLLLLVALTAMMGCCVTELIS-RTVGRVAGGIQFLGGLLIGAGCALYPLGWDSE-EVRQACGNLSDQFELGTCRFGWAYYCTGGGAAVVMLICT 185          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Xenopus
Match: LHFPL1 (LHFPL tetraspan subfamily member 1 [Source:NCBI gene;Acc:100494122])

HSP 1 Score: 85.1149 bits (209), Expect = 1.011e-18
Identity = 55/179 (30.73%), Postives = 90/179 (50.28%), Query Frame = 3
Query:  237 WSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIMPGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTT 770
            W+ L+ L A LC     +PYW+ G  +     F S    FRRC YP ++ + ++ ++  CG Y  F  +P + W++   +I I   +L  ++    +     D++      +     QF+ G+L+   C LYPLGW    E+ Q CG+++S   LG C +GWA+  T AG   ++L  T
Sbjct:   12 WALLSMLCAALCSTSFFMPYWLFGFQMGKPVSFSS----FRRCTYPTQTGEESVVMVEECGRYASFHAIPSLSWQISTWVISIGCTLLLLVSLAAVLGCCIKDLIS-RMTGRLLGAAQFVGGLLISSGCALYPLGWNSP-EIQQACGNASSQFHLGTCKLGWAYYSTGAGAAAAMLICT 184          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Xenopus
Match: rtn4ip1 (Xenopus tropicalis LHFPL tetraspan subfamily member 3 (lhfpl3), transcript variant 2, mRNA. [Source:RefSeq mRNA;Acc:NM_001345945])

HSP 1 Score: 54.299 bits (129), Expect = 7.673e-8
Identity = 34/110 (30.91%), Postives = 55/110 (50.00%), Query Frame = 3
Query:  558 NVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNIETEFSNERDIYLSSTTRESVRYGS 887
             V+K C   Q  +   +++ C+++P GW  + EV ++CG+ T   SLG C V WA++L    G+L  L  +  A +L N   S+  E          L   ++ES R+ S
Sbjct:  129 TVYKICAWMQLCSAACLVLGCMIFPDGWDAD-EVKRMCGEKTDKYSLGACSVRWAYILAII-GILDALILSFLAFVLGNRLDSLMAEQ---------LKLESKESARHPS 227          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Xenopus
Match: rtn4ip1 (Xenopus tropicalis LHFPL tetraspan subfamily member 3 (lhfpl3), transcript variant 2, mRNA. [Source:RefSeq mRNA;Acc:NM_001345945])

HSP 1 Score: 53.9138 bits (128), Expect = 1.039e-7
Identity = 30/95 (31.58%), Postives = 49/95 (51.58%), Query Frame = 3
Query:  558 NVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNIETEFSNERD 842
             V+K C   Q  +   +++ C+++P GW  + EV ++CG+ T   SLG C V WA++L    G+L  L  +  A +L N   S+  E      +D
Sbjct:  129 TVYKICAWMQLCSAACLVLGCMIFPDGWDAD-EVKRMCGEKTDKYSLGACSVRWAYILAII-GILDALILSFLAFVLGNRLDSLMAEQLKLESKD 221          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Xenopus
Match: rtn4ip1 (Xenopus tropicalis LHFPL tetraspan subfamily member 3 (lhfpl3), transcript variant 2, mRNA. [Source:RefSeq mRNA;Acc:NM_001345945])

HSP 1 Score: 53.5286 bits (127), Expect = 1.149e-7
Identity = 32/99 (32.32%), Postives = 52/99 (52.53%), Query Frame = 3
Query:  558 NVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNIETEFSNERDIYLS 854
             V+K C   Q  +   +++ C+++P GW  + EV ++CG+ T   SLG C V WA++L    G+L  L  +  A +L N   S+  E +   E  + LS
Sbjct:  129 TVYKICAWMQLCSAACLVLGCMIFPDGWDAD-EVKRMCGEKTDKYSLGACSVRWAYILAII-GILDALILSFLAFVLGNRLDSLMAE-QLKLESKVLLS 224          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Mouse
Match: Lhfpl1 (lipoma HMGIC fusion partner-like 1 [Source:MGI Symbol;Acc:MGI:1891214])

HSP 1 Score: 84.3445 bits (207), Expect = 2.423e-18
Identity = 50/164 (30.49%), Postives = 82/164 (50.00%), Query Frame = 3
Query:  237 WSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIMPGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAF 725
            W+FL+ ++A+       LPYW+ GS +     F      FRRC YPVR   + + ++  CG Y  F  +P + W++C V+      +L  +     +     +++    + +     QF+ G+L+   C LYPLGW    EV Q CG+ ++   LG C +GWA+
Sbjct:   12 WAFLSLVTAVASSTSYFLPYWLFGSQLGKPVSF----STFRRCNYPVRGDGHNLIMVEECGRYASFTAIPSLAWQMCTVVTGAGCALLLLVALAAVLGCCMEELIS-RMMGRCMGAAQFVGGLLISAGCALYPLGWNSP-EVMQTCGNVSNQFQLGTCRLGWAY 169          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Mouse
Match: Lhfp (lipoma HMGIC fusion partner [Source:MGI Symbol;Acc:MGI:1920048])

HSP 1 Score: 82.0333 bits (201), Expect = 8.089e-18
Identity = 53/168 (31.55%), Postives = 81/168 (48.21%), Query Frame = 3
Query:  237 WSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIM-PGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLT 734
            W+ L++LSA     G  +PYW+ GS +     F    G FRRC YPV      + +M   CG Y  F  +P   W++C ++  +   +L  +     +     +++    V +     QF+ G+L+   C LYPLGW    EV Q CG  +    LG+C +GWA+  T
Sbjct:   12 WALLSFLSAATSCVGFFMPYWLWGSQLGKPVSF----GTFRRCSYPVHDESRQMMVMVEECGRYASFQGIPSTEWRICTIVTGLGCGLLLLVALTALMGCCVSELIS-RTVGRVAGGIQFLGGLLIGAGCALYPLGWDSE-EVRQTCGYISGQFDLGKCEIGWAYYCT 173          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Mouse
Match: Lhfp (lipoma HMGIC fusion partner [Source:MGI Symbol;Acc:MGI:1920048])

HSP 1 Score: 82.0333 bits (201), Expect = 8.089e-18
Identity = 53/168 (31.55%), Postives = 81/168 (48.21%), Query Frame = 3
Query:  237 WSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIM-PGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLT 734
            W+ L++LSA     G  +PYW+ GS +     F    G FRRC YPV      + +M   CG Y  F  +P   W++C ++  +   +L  +     +     +++    V +     QF+ G+L+   C LYPLGW    EV Q CG  +    LG+C +GWA+  T
Sbjct:   12 WALLSFLSAATSCVGFFMPYWLWGSQLGKPVSF----GTFRRCSYPVHDESRQMMVMVEECGRYASFQGIPSTEWRICTIVTGLGCGLLLLVALTALMGCCVSELIS-RTVGRVAGGIQFLGGLLIGAGCALYPLGWDSE-EVRQTCGYISGQFDLGKCEIGWAYYCT 173          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Mouse
Match: Lhfpl4 (lipoma HMGIC fusion partner-like protein 4 [Source:MGI Symbol;Acc:MGI:3057108])

HSP 1 Score: 57.7658 bits (138), Expect = 4.365e-9
Identity = 33/113 (29.20%), Postives = 59/113 (52.21%), Query Frame = 3
Query:  558 NVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNIETEFSNERDIYLSSTTRESVRYGSEVA 896
             V+K C   Q +A + +++ C+++P GW     +  +CG  T   SLG C V WA++L    G+L+ L  +  A +L N  Q+  ++ E   E   ++ +T    +R G +V+
Sbjct:  123 TVYKICAWMQLLAALCLVLGCMIFPDGWDAE-TIRDMCGAKTGKYSLGDCSVRWAYILAII-GILNALILSFLAFVLGNR-QTDLLQEELKQENKDFVGTTVSSVLRPGGDVS 232          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Mouse
Match: Lhfpl3 (lipoma HMGIC fusion partner-like 3 [Source:MGI Symbol;Acc:MGI:1925076])

HSP 1 Score: 53.9138 bits (128), Expect = 7.403e-8
Identity = 29/95 (30.53%), Postives = 50/95 (52.63%), Query Frame = 3
Query:  558 NVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNIETEFSNERD 842
             V+K C   Q  +   +++ C+++P GW  + EV ++CG+ T   +LG C V WA++L    G+L  L  +  A +L N   S+  E   +  +D
Sbjct:  132 TVYKICAWMQLTSAACLVLGCMIFPDGWDSD-EVKRMCGEKTDKYTLGACSVRWAYILAII-GILDALILSFLAFVLGNRQDSLMAEELKAENKD 224          
BLAST of Lipoma HMGIC fusion partner-like protein vs. UniProt/SwissProt
Match: sp|Q9Y693|LHPL6_HUMAN (LHFPL tetraspan subfamily member 6 protein OS=Homo sapiens OX=9606 GN=LHFPL6 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 3.342e-19
Identity = 57/180 (31.67%), Postives = 87/180 (48.33%), Query Frame = 3
Query:  237 WSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIM-PGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTT 770
            W+ L++L A     G  +PYW+ GS +     F    G FRRC YPV      + +M   CG Y  F  +P   W++C ++  +   +L  +     +     D++    V +     QF+ G+L+   C LYPLGW    EV Q CG ++    LG+C +GWA+  T AG   ++L  T
Sbjct:   12 WALLSFLCAATSCVGFFMPYWLWGSQLGKPVSF----GTFRRCSYPVHDESRQMMVMVEECGRYASFQGIPSAEWRICTIVTGLGCGLLLLVALTALMGCCVSDLIS-RTVGRVAGGIQFLGGLLIGAGCALYPLGWDSE-EVRQTCGYTSGQFDLGKCEIGWAYYCTGAGATAAMLLCT 185          
BLAST of Lipoma HMGIC fusion partner-like protein vs. UniProt/SwissProt
Match: sp|Q5PRC1|LHPL6_DANRE (LHFPL tetraspan subfamily member 6 protein OS=Danio rerio OX=7955 GN=lhfpl6 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 4.593e-19
Identity = 57/187 (30.48%), Postives = 90/187 (48.13%), Query Frame = 3
Query:  216 MRCLWFSWSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRS-IKNTIKIMPGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTT 770
            + C    W+ L++L A     G  +PYW+ GS +     F    G FRRC YP+R   +    ++  CG Y  F  +P + W++C V+  I   +L  +     +     D++    + +     QF+ G+L+   C LYPLGW    EV Q C +S+    LG C +GWA+  T AG   +++  T
Sbjct:    5 LTCAGVIWALLSFLCAATSCVGFFMPYWLLGSQMGKPVSF----GTFRRCSYPIRDEARGGTVMLEQCGRYASFQGIPSLEWRICTVVTGIGCGLLLLVALTAIMGCCVTDLIS-RTIGRVAGGIQFVGGLLIGSGCALYPLGWDSE-EVRQTCSNSSDQFDLGSCEIGWAYYCTGAGAAAAMVLCT 185          
BLAST of Lipoma HMGIC fusion partner-like protein vs. UniProt/SwissProt
Match: sp|Q80SV1|LHPL1_MOUSE (LHFPL tetraspan subfamily member 1 protein OS=Mus musculus OX=10090 GN=Lhfpl1 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.695e-17
Identity = 50/164 (30.49%), Postives = 82/164 (50.00%), Query Frame = 3
Query:  237 WSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIMPGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAF 725
            W+FL+ ++A+       LPYW+ GS +     F      FRRC YPVR   + + ++  CG Y  F  +P + W++C V+      +L  +     +     +++    + +     QF+ G+L+   C LYPLGW    EV Q CG+ ++   LG C +GWA+
Sbjct:   12 WAFLSLVTAVASSTSYFLPYWLFGSQLGKPVSF----STFRRCNYPVRGDGHNLIMVEECGRYASFTAIPSLAWQMCTVVTGAGCALLLLVALAAVLGCCMEELIS-RMMGRCMGAAQFVGGLLISAGCALYPLGWNSP-EVMQTCGNVSNQFQLGTCRLGWAY 169          
BLAST of Lipoma HMGIC fusion partner-like protein vs. UniProt/SwissProt
Match: sp|Q80WE5|LHPL1_RAT (LHFPL tetraspan subfamily member 1 protein OS=Rattus norvegicus OX=10116 GN=Lhfpl1 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 2.559e-17
Identity = 50/164 (30.49%), Postives = 82/164 (50.00%), Query Frame = 3
Query:  237 WSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIMPGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAF 725
            W+FL+ ++A+       LPYW+ GS +     F      FRRC YPVR   + + ++  CG Y  F  +P + W++C V+      +L  +     +     +++    + +     QF+ G+L+   C LYPLGW    EV Q CG+ ++   LG C +GWA+
Sbjct:   12 WAFLSLVTAVASSTSYFLPYWLFGSQLGKPVSF----STFRRCNYPVRGDGHNLIMVEECGRYASFAAIPSLAWQMCTVVTGAGCALLLLVALAAVLGCCMEELIS-RMMGRCMGAAQFVGGLLISSGCALYPLGWNSP-EVMQTCGNVSNQFQLGTCRLGWAY 169          
BLAST of Lipoma HMGIC fusion partner-like protein vs. UniProt/SwissProt
Match: sp|Q86WI0|LHPL1_HUMAN (LHFPL tetraspan subfamily member 1 protein OS=Homo sapiens OX=9606 GN=LHFPL1 PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 4.653e-17
Identity = 49/164 (29.88%), Postives = 83/164 (50.61%), Query Frame = 3
Query:  237 WSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIMPGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAF 725
            W+FL+ ++A+       LPYW+ GS +     F      FRRC YPVR   +++ ++  CG Y  F  +P + W++C V+      +L  +     +     +++    + +     QF+ G+L+   C LYPLGW    E+ Q CG+ ++   LG C +GWA+
Sbjct:   12 WAFLSLVTAVTSSTSYFLPYWLFGSQMGKPVSF----STFRRCNYPVRGEGHSLIMVEECGRYASFNAIPSLAWQMCTVVTGAGCALLLLVALAAVLGCCMEELIS-RMMGRCMGAAQFVGGLLISSGCALYPLGWNSP-EIMQTCGNVSNQFQLGTCRLGWAY 169          
BLAST of Lipoma HMGIC fusion partner-like protein vs. TrEMBL
Match: A0A4S2MBR2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002502 PE=4 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 1.960e-48
Identity = 126/352 (35.80%), Postives = 180/352 (51.14%), Query Frame = 3
Query:  216 MRCLWFSWSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKE------------------------------------FFSDLGIFRRCVYPV---RSIKNTIKIMPG-------------CGHYEFLDV-PHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNIETEFSNERDIYLSSTTRESVR---YGSEVATIRPYSQNATCETRFSNISYQSLLVPNTIKSGNGGSISRGDMPLR-HAGYLHPGHRFIAPNHAGSLLPS 1100
            MRCLW  WS LTWL+A+LC  GCLLPYW+KG +VH ++                                       +DLG+FRRC YPV   R+  ++  I  G             CGHY  L   PH+ W +  +M++ +  +LFF TF LFILGF L ++ I  +H+SCQ+   +AG+L LISC+LYP+GW  N EV Q CG+   I +LGRCH+GWA+VLTC+GGLLSL +  +P +  +N+    N +T  S   D++L    R S     +G     ++         T   NI +    +P+   S +  S+    +  R  +  LHP    ++P H+ S +PS
Sbjct:    3 MRCLWLIWSLLTWLAAILCTIGCLLPYWLKG-YVHFLRPTTATGLTSSLNLHTPESLGQTPVWKPDTNRLDTKSGIPTDLGLFRRCGYPVYVNRTASDSTAITKGQANLAQPVVWHSGCGHYSQLTSGPHIAWHIAFLMLVSACGLLFFATFFLFILGFALYLISIRTIHRSCQIMLLVAGLLALISCVLYPVGWTGNSEVRQACGEEAYIFNLGRCHIGWAYVLTCSGGLLSLFAALLPVIFPKNA----NQQTGSSRSHDLFLDKAGRSSNACQCFGKSNRQVK--------STTGENIPFYPRPMPSPANSLDAESVCFQSLSHRPDSMLLHPRPGGLSPTHSTSPVPS 341          
BLAST of Lipoma HMGIC fusion partner-like protein vs. TrEMBL
Match: A0A4S2MC29 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002502 PE=4 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 3.448e-48
Identity = 126/352 (35.80%), Postives = 180/352 (51.14%), Query Frame = 3
Query:  216 MRCLWFSWSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKE------------------------------------FFSDLGIFRRCVYPV---RSIKNTIKIMPG-------------CGHYEFLDV-PHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNIETEFSNERDIYLSSTTRESVR---YGSEVATIRPYSQNATCETRFSNISYQSLLVPNTIKSGNGGSISRGDMPLR-HAGYLHPGHRFIAPNHAGSLLPS 1100
            MRCLW  WS LTWL+A+LC  GCLLPYW+KG +VH ++                                       +DLG+FRRC YPV   R+  ++  I  G             CGHY  L   PH+ W +  +M++ +  +LFF TF LFILGF L ++ I  +H+SCQ+   +AG+L LISC+LYP+GW  N EV Q CG+   I +LGRCH+GWA+VLTC+GGLLSL +  +P +  +N+    N +T  S   D++L    R S     +G     ++         T   NI +    +P+   S +  S+    +  R  +  LHP    ++P H+ S +PS
Sbjct:    3 MRCLWLIWSLLTWLAAILCTIGCLLPYWLKG-YVHFLRPTTATGLTSSLNLHTPESLGQTPVWKPDTNRLDTKSGIPTDLGLFRRCGYPVYVNRTASDSTAITKGQANLAQPVVWHSGCGHYSQLTSGPHIAWHIAFLMLVSACGLLFFATFFLFILGFALYLISIRTIHRSCQIMLLVAGLLALISCVLYPVGWTGNSEVRQACGEEAYIFNLGRCHIGWAYVLTCSGGLLSLFAALLPVIFPKNA----NQQTGSSRSHDLFLDKAGRSSNACQCFGKSNRQVK--------STTGENIPFYPRPMPSPANSLDAESVCFQSLSHRPDSMLLHPRPGGLSPTHSTSPVPS 341          
BLAST of Lipoma HMGIC fusion partner-like protein vs. TrEMBL
Match: A0A419PYX8 (Lipoma HMGIC fusion partner-like protein OS=Clonorchis sinensis OX=79923 GN=lhfp PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 1.406e-46
Identity = 128/352 (36.36%), Postives = 182/352 (51.70%), Query Frame = 3
Query:  216 MRCLWFSWSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKE------------------------------------FFSDLGIFRRCVYPV---RSIKNTIKIMPG-------------CGHYEFLDV-PHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNIETEFSNERDIYLSSTTRESVR---YGSEVATIRPYSQNATCETRFSNISYQSLLVPNTIKSGNGGSISRGDMPLR-HAGYLHPGHRFIAPNHAGSLLPS 1100
            MRCLW  WS LTWL+A+LC  GCLLPYW+KG +VH ++                                       +DLG+FRRC YPV   R+  ++  I  G             CGHY  L   PH+ W +  +M++ +  +LFF TF LFILGF L ++ I  +H+SCQ+   +AG+L LISC+LYP+GW  N EV Q CG+   I +LGRCH+GWA+VLTC+GGLLSL +  +P +  +N+    N +T  S   D++L    R S     +G     ++    +AT E    NI +    +P+   S +  S+       R  +  LHP    ++P H+ S +PS
Sbjct:    3 MRCLWLIWSLLTWLAAILCTIGCLLPYWLKG-YVHFLRPTTAAGLTSSLDLHTPESLGQTPIWKPDTNRLDTKSGIPTDLGLFRRCGYPVYVNRTAIDSTAITKGQANLAQPVVWHSGCGHYSQLTSGPHIAWHIAFLMLVSACGLLFFATFFLFILGFALYLISIRTIHRSCQIMLVVAGLLALISCVLYPVGWTGNSEVRQACGEEAYIFNLGRCHIGWAYVLTCSGGLLSLFAALLPVIFPKNA----NQQTGSSRSDDLFLDKAGRSSNGCQCFGKSNRQMK----SATGE----NIPFYPGPMPSPANSLDAESVCFQSSSHRPDSMLLHPRPGGLSPTHSTSPVPS 341          
BLAST of Lipoma HMGIC fusion partner-like protein vs. TrEMBL
Match: G7Y8J0 (Lipoma HMGIC fusion partner homolog OS=Clonorchis sinensis OX=79923 GN=CLF_102794 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 4.699e-46
Identity = 128/352 (36.36%), Postives = 182/352 (51.70%), Query Frame = 3
Query:  216 MRCLWFSWSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKE------------------------------------FFSDLGIFRRCVYPV---RSIKNTIKIMPG-------------CGHYEFLDV-PHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNIETEFSNERDIYLSSTTRESVR---YGSEVATIRPYSQNATCETRFSNISYQSLLVPNTIKSGNGGSISRGDMPLR-HAGYLHPGHRFIAPNHAGSLLPS 1100
            MRCLW  WS LTWL+A+LC  GCLLPYW+KG +VH ++                                       +DLG+FRRC YPV   R+  ++  I  G             CGHY  L   PH+ W +  +M++ +  +LFF TF LFILGF L ++ I  +H+SCQ+   +AG+L LISC+LYP+GW  N EV Q CG+   I +LGRCH+GWA+VLTC+GGLLSL +  +P +  +N+    N +T  S   D++L    R S     +G     ++    +AT E    NI +    +P+   S +  S+       R  +  LHP    ++P H+ S +PS
Sbjct:    3 MRCLWLIWSLLTWLAAILCTIGCLLPYWLKG-YVHFLRPTTAAGLTSSLDLHTPESLGQTPIWKPDTNRLDTKSGIPTDLGLFRRCGYPVYVNRTAIDSTAITKGQANLAQPVVWHSGCGHYSQLTSGPHIAWHIAFLMLVSACGLLFFATFFLFILGFALYLISIRTIHRSCQIMLVVAGLLALISCVLYPVGWTGNSEVRQACGEEAYIFNLGRCHIGWAYVLTCSGGLLSLFAALLPVIFPKNA----NQQTGSSRSDDLFLDKAGRSSNGCQCFGKSNRQMK----SATGE----NIPFYPGPMPSPANSLDAESVCFQSSSHRPDSMLLHPRPGGLSPTHSTSPVPS 341          
BLAST of Lipoma HMGIC fusion partner-like protein vs. TrEMBL
Match: A0A0R3SQA8 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7246 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.219e-44
Identity = 93/205 (45.37%), Postives = 127/205 (61.95%), Query Frame = 3
Query:  216 MRCLWFSWSFLTWLSAMLCGGGCLLPYWIKGSF---------VHNMKEFFSDLGIFRRCVYPVRS---------IKNTIKIMPGCGHYEFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIP 776
            MRC W  WS L W SA+LC  GCL PYW+KG+F             K+  S +G+FRRCVYP  S         +++ I + P CGHY F D+PH+ WK+ L+ +  S  ILFF+TF LF+ GF + +L    V K CQ G  ++G+LV  +C +YP+GW+ N EV QICG S +  ++G C V WA+++T  GG+LSLLST +P
Sbjct:    5 MRCFWILWSLLAWSSAILCTAGCLFPYWLKGTFKVILWSSNATTADKQLTSHVGLFRRCVYPTYSQNLQFTGSAVESGIALQPNCGHYSFADIPHMTWKIGLITLTASCTILFFLTFFLFVSGFNVILLANSCVCKLCQFGFLVSGLLVGFTCAMYPIGWKDNEEVRQICGQSANTFNIGHCEVEWAYIITILGGVLSLLSTLLP 209          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Cavefish
Match: lhfpl6 (lipoma HMGIC fusion partner homolog [Source:NCBI gene;Acc:103046216])

HSP 1 Score: 91.2781 bits (225), Expect = 3.946e-21
Identity = 59/187 (31.55%), Postives = 90/187 (48.13%), Query Frame = 3
Query:  216 MRCLWFSWSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIM-PGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTT 770
            + C    W+ L+ L A     G  +PYW+ GS +     F    G FRRC YPVR       +M   CG Y  F  +P + W++C V+      +L  +     +     D++    + +     QF+ G+L+   C LYPLGW    EV Q C ++++   LG C +GWAF  T AG ++++L  T
Sbjct:    5 LTCAGVLWALLSLLCASASCVGFFMPYWLLGSQMGKPVSF----GTFRRCSYPVRDEAQGGTVMLEQCGRYASFQGIPSLEWRICTVVTGTGCGLLLLVALTAIMGCCVTDLIS-RTIGRVAGGIQFVGGLLIGAGCALYPLGWDSE-EVRQTCSNTSNQFQLGSCEIGWAFYCTGAGAVVAMLVCT 185          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Cavefish
Match: lhfpl6 (lipoma HMGIC fusion partner homolog [Source:NCBI gene;Acc:103046216])

HSP 1 Score: 91.2781 bits (225), Expect = 3.946e-21
Identity = 59/187 (31.55%), Postives = 90/187 (48.13%), Query Frame = 3
Query:  216 MRCLWFSWSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIM-PGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTT 770
            + C    W+ L+ L A     G  +PYW+ GS +     F    G FRRC YPVR       +M   CG Y  F  +P + W++C V+      +L  +     +     D++    + +     QF+ G+L+   C LYPLGW    EV Q C ++++   LG C +GWAF  T AG ++++L  T
Sbjct:    5 LTCAGVLWALLSLLCASASCVGFFMPYWLLGSQMGKPVSF----GTFRRCSYPVRDEAQGGTVMLEQCGRYASFQGIPSLEWRICTVVTGTGCGLLLLVALTAIMGCCVTDLIS-RTIGRVAGGIQFVGGLLIGAGCALYPLGWDSE-EVRQTCSNTSNQFQLGSCEIGWAFYCTGAGAVVAMLVCT 185          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Cavefish
Match: LHFPL6 (LHFPL tetraspan subfamily member 6 [Source:NCBI gene;Acc:103033992])

HSP 1 Score: 87.8113 bits (216), Expect = 6.480e-20
Identity = 59/187 (31.55%), Postives = 88/187 (47.06%), Query Frame = 3
Query:  216 MRCLWFSWSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIM-PGCGHYE-FLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTT 770
            + C    W+ ++ LSA     G  +PYW+ GS +     F    G FRRC YP+R  +    IM   CG Y  F  +P V W+VC V+      +L  +     +     +++    + +     QF+ G+L+   C LYPLGW    EV Q C + +    LG C +GWA+  T AG   ++L  T
Sbjct:    5 LTCAGVLWTLVSLLSAAASCVGFFMPYWLLGSQMGKPVSF----GTFRRCSYPIRDEQRQATIMLEQCGRYATFQGIPSVEWRVCTVVTGTGCGLLLLVALTALMGCCVSELIS-RAIGRVAGGIQFLGGLLIGSGCALYPLGWDSE-EVKQTCDNRSDQFQLGSCEIGWAYYCTGAGAASAILLCT 185          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Cavefish
Match: LHFPL6 (LHFPL tetraspan subfamily member 6 [Source:NCBI gene;Acc:103033992])

HSP 1 Score: 87.8113 bits (216), Expect = 6.480e-20
Identity = 59/187 (31.55%), Postives = 88/187 (47.06%), Query Frame = 3
Query:  216 MRCLWFSWSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIM-PGCGHYE-FLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTT 770
            + C    W+ ++ LSA     G  +PYW+ GS +     F    G FRRC YP+R  +    IM   CG Y  F  +P V W+VC V+      +L  +     +     +++    + +     QF+ G+L+   C LYPLGW    EV Q C + +    LG C +GWA+  T AG   ++L  T
Sbjct:    5 LTCAGVLWTLVSLLSAAASCVGFFMPYWLLGSQMGKPVSF----GTFRRCSYPIRDEQRQATIMLEQCGRYATFQGIPSVEWRVCTVVTGTGCGLLLLVALTALMGCCVSELIS-RAIGRVAGGIQFLGGLLIGSGCALYPLGWDSE-EVKQTCDNRSDQFQLGSCEIGWAYYCTGAGAASAILLCT 185          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Cavefish
Match: lhfpl3 (LHFPL tetraspan subfamily member 3 [Source:NCBI gene;Acc:103038499])

HSP 1 Score: 53.9138 bits (128), Expect = 5.473e-8
Identity = 28/80 (35.00%), Postives = 45/80 (56.25%), Query Frame = 3
Query:  555 ENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRN 794
              V+K C   Q  AG  +++ C++YP GW  + EV ++CG+ T   ++G C V WA++L    G+L  L  +  A +L N
Sbjct:  129 ATVYKICGWMQLAAGTCLVLGCLIYPDGWDAD-EVKRMCGEQTDKYTIGACSVRWAYILAIM-GILDALILSFLAFVLGN 206          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Sea Lamprey
Match: lhfpl5b (LHFPL tetraspan subfamily member 5b [Source:ZFIN;Acc:ZDB-GENE-080220-51])

HSP 1 Score: 53.9138 bits (128), Expect = 1.308e-8
Identity = 27/99 (27.27%), Postives = 53/99 (53.54%), Query Frame = 3
Query:  558 NVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNIETEFSNERDIYLS 854
             V+K C   Q  +  L+++ C++YP GW  + EV ++CGD+T   +LG C V +A+VL   G L + +   +  +L       +  + +   E++++ +
Sbjct:  122 TVYKVCAWMQLTSAALLVLGCMIYPDGWDAD-EVRRLCGDNTGKYTLGACTVRYAYVLAIVGILDAFVLAFLAFVLGNRQDNLLPDDFQVDEEKEVFFT 219          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Nematostella
Match: EDO45262 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTG9])

HSP 1 Score: 80.8777 bits (198), Expect = 7.138e-18
Identity = 54/176 (30.68%), Postives = 81/176 (46.02%), Query Frame = 3
Query:  237 WSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIMPGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLL 761
            W   + +S++LC     LPYWI+G  +     F    G+FRRC +  +    +  +M  CG Y  F D+P   WK C V+I I   +L  +           DI+  ++  K   + QF A   +  S   YP GW    EV Q CG      +LG+C +GWAF +   G  ++ +
Sbjct:   12 WVLSSVISSLLCCVSFYLPYWIEGKTLGVSVHF----GVFRRCNFLAKDEDGSTYVMQACGRYASFADIPSTSWKACTVLIGIGCGLLLLVCLTAICSCCMRDIIT-KSSGKVAGIVQFFAASFLGFSAAAYPSGW-GGVEVRQACGPDADSFNLGQCSLGWAFYIYILGTAMAFV 181          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Nematostella
Match: EDO35175 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM90])

HSP 1 Score: 46.595 bits (109), Expect = 4.912e-6
Identity = 50/192 (26.04%), Postives = 89/192 (46.35%), Query Frame = 3
Query:  216 MRCLWFSWSFLTWLSAMLCGGGCLLPYWIK----GSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKI-----MPGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTC-AGGLLSL 758
            M C+   W+ L+ L    C    + P+W +       V +    F   G+ R C+   R++++ +++        C  Y  F  +P ++WK  +V+  I   +L     L  I      + K  +V     V Q  A + ++IS +++PLG++  F V+Q CG  T + + G+C + WA+ L   + GLL L
Sbjct:    1 MSCVSVLWTVLSVLFTGACSLAIISPFWFERVPDPDDVSSDNSSFVAFGLLRFCIK--RNLESILEMDEWSDFKNCKFYSSFHGIPSLFWKFSVVLYGIGVLLLLVAILLAHISCCFKKVCK-RSVFGVAGVVQISAVIFLVISLVMFPLGFKSQF-VSQHCG-LTDMFNPGQCSISWAYTLAIMSTGLLML 187          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Medaka
Match: LHFPL6 (LHFPL tetraspan subfamily member 6 [Source:NCBI gene;Acc:101173878])

HSP 1 Score: 85.8853 bits (211), Expect = 2.739e-19
Identity = 53/166 (31.93%), Postives = 82/166 (49.40%), Query Frame = 3
Query:  279 GCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIM-PGCGHY-EFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTT 770
            G  +PYW+ G+ +     F    G FRRC YPVR  +  + +M   CG Y  F  +P + W++C V+  +   +L  +     +     D++    + +     QF+ G+L+   C LYPLGW    EV Q C +S+    LG C +GWA+  T AG   ++L  T
Sbjct:   26 GFFMPYWLLGTQMDKPVSF----GTFRRCSYPVRDEERQMTVMLEQCGRYASFHGIPSLQWRICTVVTGVGCGLLLLVALTALMGCCISDLIS-RTIGRVAGGIQFVGGLLIGSGCALYPLGWDSE-EVRQTCNNSSDQFKLGSCQIGWAYYCTGAGAAAAMLICT 185          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Medaka
Match: lhfpl5b (LHFPL tetraspan subfamily member 5 [Source:NCBI gene;Acc:101160479])

HSP 1 Score: 60.4622 bits (145), Expect = 6.649e-10
Identity = 32/76 (42.11%), Postives = 47/76 (61.84%), Query Frame = 3
Query:  558 NVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALL 785
            NV+K C   Q  +GVL++I C++YP GW    EV ++CG  T   SLG C V WA++L     ++S+L + + ALL
Sbjct:  124 NVYKICAWMQLASGVLMVIGCMIYPDGWDAP-EVKRMCGQRTDKYSLGNCTVRWAYIL----AIISILDSVLLALL 194          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Medaka
Match: ENSORLT00000038232.1 (LHFPL tetraspan subfamily member 3 protein [Source:NCBI gene;Acc:101157534])

HSP 1 Score: 58.151 bits (139), Expect = 1.836e-9
Identity = 31/100 (31.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  543 ILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNIETEFSNERD 842
            +L    V+K C   Q ++GV +++ C++YP GW  + EV ++CG+ T   SLG C + WA++L    G+L  L  +  A +L N    +  E   +  ++
Sbjct:  125 LLSTSTVYKICGWMQALSGVCLVLGCMIYPDGWDSD-EVRRMCGEKTDKYSLGACSMRWAYILAIM-GILDALILSFLAFVLGNRQDGLMTEELLAESKE 222          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Medaka
Match: lhfpl3 (LHFPL tetraspan subfamily member 3 protein [Source:NCBI gene;Acc:101156132])

HSP 1 Score: 56.6102 bits (135), Expect = 9.061e-9
Identity = 29/98 (29.59%), Postives = 54/98 (55.10%), Query Frame = 3
Query:  558 NVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNIETEFSNERDIYL 851
             V+K C   Q  AG  +++ C++YP GW  + EV ++CG+ T   +LG C + WA++L    G++  L  +  A +L N   S+  E   ++ ++ ++
Sbjct:  133 TVYKICGWMQLAAGTCLILGCMIYPDGWDSD-EVKRMCGEQTDKYTLGACSMRWAYILAIM-GIMDALILSFLAFVLGNRQDSLMSEELLADSKNSFI 228          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Medaka
Match: lhfpl3 (LHFPL tetraspan subfamily member 3 protein [Source:NCBI gene;Acc:101156132])

HSP 1 Score: 54.6842 bits (130), Expect = 3.533e-8
Identity = 29/93 (31.18%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  558 NVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNIETEFSNE 836
             V+K C   Q  AG  +++ C++YP GW  + EV ++CG+ T   +LG C + WA++L    G++  L  +  A +L N   S+  E   +++
Sbjct:  133 TVYKICGWMQLAAGTCLILGCMIYPDGWDSD-EVKRMCGEQTDKYTLGACSMRWAYILAIM-GIMDALILSFLAFVLGNRQDSLMSEELLADK 223          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Planmine SMEST
Match: SMESG000070312.1 (SMESG000070312.1)

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 312/312 (100.00%), Postives = 312/312 (100.00%), Query Frame = 3
Query:  216 MRCLWFSWSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIMPGCGHYEFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNIETEFSNERDIYLSSTTRESVRYGSEVATIRPYSQNATCETRFSNISYQSLLVPNTIKSGNGGSISRGDMPLRHAGYLHPGHRFIAPNHAGSLLPSTTASERNILSYSEEDES 1151
            MRCLWFSWSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIMPGCGHYEFLDVPHVYWKVCLVMIIISSCILFFITFLLFILGFCLDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNIETEFSNERDIYLSSTTRESVRYGSEVATIRPYSQNATCETRFSNISYQSLLVPNTIKSGNGGSISRGDMPLRHAGYLHPGHRFIAPNHAGSLLPSTTASERNILSYSEEDES
Sbjct:    1 MRCLWFSWSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIMPGCGHYEFLDVPHVYWKVCLVMIIISSCILFFITFLLFILGFCLDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNIETEFSNERDIYLSSTTRESVRYGSEVATIRPYSQNATCETRFSNISYQSLLVPNTIKSGNGGSISRGDMPLRHAGYLHPGHRFIAPNHAGSLLPSTTASERNILSYSEEDES 312          
BLAST of Lipoma HMGIC fusion partner-like protein vs. Planmine SMEST
Match: SMESG000070312.1 (SMESG000070312.1)

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 296/296 (100.00%), Postives = 296/296 (100.00%), Query Frame = 3
Query:  264 MLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIMPGCGHYEFLDVPHVYWKVCLVMXXXXXXXXXXXXXXXXXXXXXXDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNIETEFSNERDIYLSSTTRESVRYGSEVATIRPYSQNATCETRFSNISYQSLLVPNTIKSGNGGSISRGDMPLRHAGYLHPGHRFIAPNHAGSLLPSTTASERNILSYSEEDES 1151
            MLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIMPGCGHYEFLDVPHVYWKVCLVMIIISSCILFFITFLLFILGFCLDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNIETEFSNERDIYLSSTTRESVRYGSEVATIRPYSQNATCETRFSNISYQSLLVPNTIKSGNGGSISRGDMPLRHAGYLHPGHRFIAPNHAGSLLPSTTASERNILSYSEEDES
Sbjct:    1 MLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRCVYPVRSIKNTIKIMPGCGHYEFLDVPHVYWKVCLVMIIISSCILFFITFLLFILGFCLDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNIETEFSNERDIYLSSTTRESVRYGSEVATIRPYSQNATCETRFSNISYQSLLVPNTIKSGNGGSISRGDMPLRHAGYLHPGHRFIAPNHAGSLLPSTTASERNILSYSEEDES 296          
The following BLAST results are available for this feature:
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LHFPL66.959e-2031.67LHFPL tetraspan subfamily member 6 [Source:HGNC Sy... [more]
LHFPL66.959e-2031.67LHFPL tetraspan subfamily member 6 [Source:HGNC Sy... [more]
LHFPL19.689e-1829.88LHFPL tetraspan subfamily member 1 [Source:HGNC Sy... [more]
LHFPL46.069e-930.09LHFPL tetraspan subfamily member 4 [Source:HGNC Sy... [more]
LHFPL31.951e-831.73LHFPL tetraspan subfamily member 3 [Source:HGNC Sy... [more]
back to top
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lhfpl66.085e-2030.48LHFPL tetraspan subfamily member 6 [Source:NCBI ge... [more]
lhfpl66.085e-2030.48LHFPL tetraspan subfamily member 6 [Source:NCBI ge... [more]
lhfpl66.085e-2030.48LHFPL tetraspan subfamily member 6 [Source:NCBI ge... [more]
LHFPL66.942e-1730.59LHFPL tetraspan subfamily member 6 [Source:HGNC Sy... [more]
lhfpl2b1.734e-827.21LHFPL tetraspan subfamily member 2b [Source:ZFIN;A... [more]
back to top
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lhfpl65.219e-1930.48LHFPL tetraspan subfamily member 6 [Source:NCBI ge... [more]
LHFPL11.011e-1830.73LHFPL tetraspan subfamily member 1 [Source:NCBI ge... [more]
rtn4ip17.673e-830.91Xenopus tropicalis LHFPL tetraspan subfamily membe... [more]
rtn4ip11.039e-731.58Xenopus tropicalis LHFPL tetraspan subfamily membe... [more]
rtn4ip11.149e-732.32Xenopus tropicalis LHFPL tetraspan subfamily membe... [more]
back to top
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lhfpl12.423e-1830.49lipoma HMGIC fusion partner-like 1 [Source:MGI Sym... [more]
Lhfp8.089e-1831.55lipoma HMGIC fusion partner [Source:MGI Symbol;Acc... [more]
Lhfp8.089e-1831.55lipoma HMGIC fusion partner [Source:MGI Symbol;Acc... [more]
Lhfpl44.365e-929.20lipoma HMGIC fusion partner-like protein 4 [Source... [more]
Lhfpl37.403e-830.53lipoma HMGIC fusion partner-like 3 [Source:MGI Sym... [more]
back to top
BLAST of Lipoma HMGIC fusion partner-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y693|LHPL6_HUMAN3.342e-1931.67LHFPL tetraspan subfamily member 6 protein OS=Homo... [more]
sp|Q5PRC1|LHPL6_DANRE4.593e-1930.48LHFPL tetraspan subfamily member 6 protein OS=Dani... [more]
sp|Q80SV1|LHPL1_MOUSE1.695e-1730.49LHFPL tetraspan subfamily member 1 protein OS=Mus ... [more]
sp|Q80WE5|LHPL1_RAT2.559e-1730.49LHFPL tetraspan subfamily member 1 protein OS=Ratt... [more]
sp|Q86WI0|LHPL1_HUMAN4.653e-1729.88LHFPL tetraspan subfamily member 1 protein OS=Homo... [more]
back to top
BLAST of Lipoma HMGIC fusion partner-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MBR21.960e-4835.80Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2MC293.448e-4835.80Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A419PYX81.406e-4636.36Lipoma HMGIC fusion partner-like protein OS=Clonor... [more]
G7Y8J04.699e-4636.36Lipoma HMGIC fusion partner homolog OS=Clonorchis ... [more]
A0A0R3SQA81.219e-4445.37Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lhfpl63.946e-2131.55lipoma HMGIC fusion partner homolog [Source:NCBI g... [more]
lhfpl63.946e-2131.55lipoma HMGIC fusion partner homolog [Source:NCBI g... [more]
LHFPL66.480e-2031.55LHFPL tetraspan subfamily member 6 [Source:NCBI ge... [more]
LHFPL66.480e-2031.55LHFPL tetraspan subfamily member 6 [Source:NCBI ge... [more]
lhfpl35.473e-835.00LHFPL tetraspan subfamily member 3 [Source:NCBI ge... [more]
back to top
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lhfpl5b1.308e-827.27LHFPL tetraspan subfamily member 5b [Source:ZFIN;A... [more]
back to top
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO452627.138e-1830.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351754.912e-626.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lipoma HMGIC fusion partner-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LHFPL62.739e-1931.93LHFPL tetraspan subfamily member 6 [Source:NCBI ge... [more]
lhfpl5b6.649e-1042.11LHFPL tetraspan subfamily member 5 [Source:NCBI ge... [more]
ENSORLT00000038232.11.836e-931.00LHFPL tetraspan subfamily member 3 protein [Source... [more]
lhfpl39.061e-929.59LHFPL tetraspan subfamily member 3 protein [Source... [more]
lhfpl33.533e-831.18LHFPL tetraspan subfamily member 3 protein [Source... [more]
back to top
BLAST of Lipoma HMGIC fusion partner-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000070312.10.000e+0100.00SMESG000070312.1[more]
SMESG000070312.10.000e+0100.00SMESG000070312.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003907 ID=SMED30003907|Name=Lipoma HMGIC fusion partner-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1195bp
GTAGAAATTTTCTCTGTATCGAAAAACCATCTAGTTGCTCACTCTATAAA
TTTAAAAACATTTCTTTCCTCCTGTCGAGAAACGATGGGAAAACTTGCTC
ATTGAGAGAGAGAAAATTCATATTTTGAAGTCGCATCCAATCACAATCTG
TCATATGTTTACATTAAATCGTGAAAGATTTTTCATTCTGTAAAATTTTT
CAATATTGAAAATAGATGCGCTGTTTGTGGTTTTCTTGGTCGTTTCTAAC
ATGGCTTTCAGCAATGCTCTGCGGTGGCGGTTGCCTGTTGCCGTACTGGA
TCAAAGGATCTTTCGTTCATAATATGAAAGAATTTTTCAGTGATCTTGGA
ATATTTCGAAGATGCGTTTATCCAGTTCGTTCAATCAAAAATACGATTAA
AATCATGCCTGGCTGTGGACATTATGAATTTCTCGATGTTCCACACGTTT
ATTGGAAGGTTTGCCTGGTGATGATAATTATCTCTAGTTGCATCCTATTT
TTCATTACATTTTTATTATTTATTCTTGGATTTTGTTTGGATATACTTAA
AATTGAAAACGTACACAAGTCTTGTCAGGTTGGCCAGTTTATTGCAGGAG
TTCTGGTGCTAATTTCGTGTATTCTCTATCCTCTGGGGTGGCGTAAGAAT
TTTGAAGTAACACAAATCTGTGGGGATTCTACGTCCATTCTATCTCTAGG
ACGATGCCATGTTGGATGGGCATTTGTACTGACTTGTGCCGGAGGATTGT
TGTCCCTACTAAGTACAACGATACCAGCCTTATTATTAAGAAATTCCTGT
CAATCAGTGAACATTGAAACAGAATTTTCCAATGAACGAGACATCTATCT
TTCATCTACAACGAGAGAGAGTGTTCGATATGGGAGTGAAGTCGCTACAA
TTCGGCCGTATTCTCAAAATGCTACTTGTGAGACACGATTTAGTAATATC
AGTTACCAATCACTGCTCGTGCCAAATACGATAAAATCTGGTAACGGTGG
ATCCATTAGTAGGGGGGATATGCCTTTACGTCACGCCGGCTATCTTCACC
CGGGACATAGATTCATTGCACCGAATCACGCTGGTTCTTTATTGCCATCA
ACAACGGCGTCAGAACGAAATATACTATCCTACAGTGAAGAAGATGAATC
GTAGCGATGAAATTAATTTTTAAAAATATTTAATTTTAAATAATT
back to top

protein sequence of SMED30003907-orf-1

>SMED30003907-orf-1 ID=SMED30003907-orf-1|Name=SMED30003907-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=313bp
MRCLWFSWSFLTWLSAMLCGGGCLLPYWIKGSFVHNMKEFFSDLGIFRRC
VYPVRSIKNTIKIMPGCGHYEFLDVPHVYWKVCLVMIIISSCILFFITFL
LFILGFCLDILKIENVHKSCQVGQFIAGVLVLISCILYPLGWRKNFEVTQ
ICGDSTSILSLGRCHVGWAFVLTCAGGLLSLLSTTIPALLLRNSCQSVNI
ETEFSNERDIYLSSTTRESVRYGSEVATIRPYSQNATCETRFSNISYQSL
LVPNTIKSGNGGSISRGDMPLRHAGYLHPGHRFIAPNHAGSLLPSTTASE
RNILSYSEEDES*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR019372LHFPL
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019372Lipoma HMGIC fusion partner-like proteinPFAMPF10242L_HMGIC_fplcoord: 8..188
e-value: 4.9E-28
score: 98.6
IPR019372Lipoma HMGIC fusion partner-like proteinPANTHERPTHR12489LIPOMA HMGIC FUSION PARTNER-LIKE PROTEINcoord: 8..187
NoneNo IPR availableGENE3DG3DSA:1.20.140.150coord: 4..208
e-value: 9.5E-7
score: 30.3
NoneNo IPR availablePANTHERPTHR12489:SF16LHFPL TETRASPAN SUBFAMILY MEMBER 6 PROTEINcoord: 8..187
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..23
score: 0.509
NoneNo IPR availableTMHMMTMhelixcoord: 125..142
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 82..104
NoneNo IPR availableTMHMMTMhelixcoord: 169..191