SMED30003903

Overview
NameSMED30003903
Smed IDSMED30003903
Length (bp)325
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30003903 (SMED30003903) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30003903 (SMED30003903) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30003903 (SMED30003903) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30003903 (SMED30003903) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003903

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30003903 dd_Smed_v6_1571_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30003903 dd_Smed_v6_1571_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003903 dd_Smed_v6_1571_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30003903 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002725:42357..42681 -1616
v31.002725:42843..44142 +1189
v31.002725:45279..45605 -968
v31.002725:46257..46583 -950
v31.002725:46746..47073 -913
v31.002725:47235..47565 -620
Homology
BLAST of SMED30003903 vs. Planmine SMEST
Match: SMESG000023005.1 (SMESG000023005.1)

HSP 1 Score: 217.238 bits (552), Expect = 9.715e-67
Identity = 106/107 (99.07%), Postives = 107/107 (100.00%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKA+KSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE
Sbjct: 3483 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 3589          

HSP 2 Score: 217.238 bits (552), Expect = 9.715e-67
Identity = 106/107 (99.07%), Postives = 107/107 (100.00%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKA+KSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE
Sbjct: 3807 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 3913          

HSP 3 Score: 167.933 bits (424), Expect = 1.668e-49
Identity = 82/107 (76.64%), Postives = 92/107 (85.98%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            +L  D EVSCQTGHLI++SECQTE D+  DT+TIT++SKD+ E       +Y EKEIQFETTE+SYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE
Sbjct: 3321 RLYDDFEVSCQTGHLIMNSECQTEIDNEIDTLTITMHSKDYSERLFREPIKYFEKEIQFETTENSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 3427          

HSP 4 Score: 167.933 bits (424), Expect = 1.668e-49
Identity = 82/107 (76.64%), Postives = 92/107 (85.98%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            +L  D EVSCQTGHLI++SECQTE D+  DT+TIT++SKD+ E       +Y EKEIQFETTE+SYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE
Sbjct: 3645 RLYDDFEVSCQTGHLIMNSECQTEIDNEIDTLTITMHSKDYSERLFREPIKYFEKEIQFETTENSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 3751          

HSP 5 Score: 159.458 bits (402), Expect = 1.650e-46
Identity = 78/101 (77.23%), Postives = 86/101 (85.15%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDD 305
            KLEGDLEVSCQTGHLIIDSECQTEFDDL+DTV ITLNSKD+GE  E+ LKEYLEKE+QFE  E+SY+  VK   S KVQVG PRL+EN EVECQSG +MDD
Sbjct: 4133 KLEGDLEVSCQTGHLIIDSECQTEFDDLTDTVIITLNSKDYGEKNENPLKEYLEKEMQFEPIEESYTRLVKTYASMKVQVGFPRLDENREVECQSGSIMDD 4233          

HSP 6 Score: 151.369 bits (381), Expect = 1.025e-43
Identity = 76/107 (71.03%), Postives = 87/107 (81.31%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            +L+ D EVSCQTGHLIIDSECQTE D+  DT+TIT++SKDF E      K YLEKEIQFET E S S+ VK  KSKK+QVGHPRLN++LE ECQSGC+MDDIGVQCE
Sbjct: 2834 RLDVDFEVSCQTGHLIIDSECQTEIDNEIDTLTITMHSKDFSEKLFKEPKNYLEKEIQFETAEVSDSQLVKTKKSKKIQVGHPRLNKSLEGECQSGCIMDDIGVQCE 2940          

HSP 7 Score: 147.132 bits (370), Expect = 3.642e-42
Identity = 74/108 (68.52%), Postives = 89/108 (82.41%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENK-EDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            +L+GD EVSCQTG +I DSECQT+ +D  +T+TIT++SKDF E   ++ +KEY EKEIQ ET   S SEH KA+KSKKVQVGHPRLNE L+VECQSGC+MDDIGVQCE
Sbjct: 2671 RLDGDFEVSCQTGRIIKDSECQTDLNDSVETLTITMHSKDFSEKLFKEPMKEYYEKEIQCETPNYSISEHNKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCE 2778          

HSP 8 Score: 146.362 bits (368), Expect = 5.636e-42
Identity = 72/108 (66.67%), Postives = 90/108 (83.33%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENK-EDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            +L+GD EVSCQTG +I DSECQT+ +D  +T+ IT++SKDF E   ++ +KEY EKEIQ ET +DS S+ +KA+KSKKVQVGHPRLNE L+VECQSGC+MDDIGVQCE
Sbjct: 2036 RLDGDFEVSCQTGRIIKDSECQTDLNDSVETLMITMHSKDFSEKLFKEPMKEYYEKEIQCETPDDSTSDQIKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCE 2143          

HSP 9 Score: 146.362 bits (368), Expect = 5.636e-42
Identity = 72/108 (66.67%), Postives = 90/108 (83.33%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENK-EDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            +L+GD EVSCQTG +I DSECQT+ +D  +T+ IT++SKDF E   ++ +KEY EKEIQ ET +DS S+ +KA+KSKKVQVGHPRLNE L+VECQSGC+MDDIGVQCE
Sbjct: 2362 RLDGDFEVSCQTGRIIKDSECQTDLNDSVETLMITMHSKDFSEKLFKEPMKEYYEKEIQCETPDDSTSDQIKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCE 2469          

HSP 10 Score: 138.658 bits (348), Expect = 3.508e-39
Identity = 72/108 (66.67%), Postives = 86/108 (79.63%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKE-DSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            K+ GDLEVSCQTGHL+IDSE QT+ ++ +D +T T  SK F E      +K+Y +KEIQ ETT+DS SEH KA+KSKKVQVGHPRLNE L+VECQSG +MDDIGVQCE
Sbjct: 2199 KMNGDLEVSCQTGHLVIDSESQTQLEEPNDKLTTTTYSKVFSEEILIGPIKDYFDKEIQCETTDDSISEHNKANKSKKVQVGHPRLNEILDVECQSGYIMDDIGVQCE 2306          

HSP 11 Score: 135.961 bits (341), Expect = 2.996e-38
Identity = 78/111 (70.27%), Postives = 87/111 (78.38%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSL----KEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            +L+ D EVSCQTGHLI+DS  QT+ DD+ D + IT   +DF    ED L    K   +KEIQFETTEDSYSEH K+SKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE
Sbjct: 3969 RLDADPEVSCQTGHLIMDSGDQTDIDDIKDKIIITAQPRDFS--VEDKLFQEKKIVFDKEIQFETTEDSYSEHGKSSKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 4077          

HSP 12 Score: 132.88 bits (333), Expect = 3.457e-37
Identity = 66/108 (61.11%), Postives = 88/108 (81.48%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENK-EDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            +L+ DLEVSCQTGHLI +SECQTEFD+  D +T  LN++DF E K + S+ E++ KEIQFE ++D++S   K++KSKKVQVGH +L+E +EVECQSG +MD+IGVQCE
Sbjct: 4447 RLDSDLEVSCQTGHLITESECQTEFDEKVDEITFLLNAQDFSEEKPKRSVFEFVNKEIQFEASDDTHSISDKSNKSKKVQVGHAKLHEGVEVECQSGYMMDEIGVQCE 4554          

HSP 13 Score: 131.724 bits (330), Expect = 7.442e-37
Identity = 66/108 (61.11%), Postives = 85/108 (78.70%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGEN-KEDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            +L+G+LEVSCQTGHLI+DS CQT+ D+L+DT  IT +  DF E    + LKE+ EKE+Q+   +D    H +A+KSKKVQVGHPRLNE+L+VECQ+GCLMDDI VQC+
Sbjct: 4284 RLDGELEVSCQTGHLILDSHCQTDLDELTDTFIITNHLPDFTERLNREFLKEFAEKEVQYGDFDDYSLIHDEANKSKKVQVGHPRLNESLDVECQTGCLMDDIEVQCK 4391          

HSP 14 Score: 127.872 bits (320), Expect = 1.832e-35
Identity = 68/108 (62.96%), Postives = 81/108 (75.00%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGE-NKEDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            +L+GDLEVSCQTGHLIIDS+CQTEFD L DT  ITL SKDF +  ++ SL +  EKEIQFE  +DS+    K  KSKK+QVG  +L+E  E ECQ+GCLMDD GVQ E
Sbjct: 2996 RLDGDLEVSCQTGHLIIDSQCQTEFDWLPDTSAITLVSKDFNQVARKYSLTDLAEKEIQFELIDDSFLRDEKCKKSKKIQVGFSKLSECSEAECQTGCLMDDTGVQYE 3103          

HSP 15 Score: 120.553 bits (301), Expect = 7.104e-33
Identity = 63/97 (64.95%), Postives = 76/97 (78.35%), Query Frame = 3
Query:   36 TGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKE-DSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            T HL+IDSE QT+ ++ +D +T T  SK F E      +K+Y +KEIQ ETT+DS SEH KA+KSKKVQVGHPRLNE L+VECQSGC+MDDIGVQCE
Sbjct: 2519 TRHLVIDSESQTQLEEPNDKLTTTTYSKVFSEEILIGPIKDYFDKEIQCETTDDSISEHNKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCE 2615          

HSP 16 Score: 116.316 bits (290), Expect = 2.231e-31
Identity = 61/108 (56.48%), Postives = 79/108 (73.15%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYL-EKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            KL  DLE SCQTGHLIIDSECQTEFD+ ++ ++++LN +DF E     + +Y  +KEIQF+   DS  + +   KSKK+QVGH RLN+  EVECQSGC+MDD+ VQ E
Sbjct: 3159 KLGFDLEASCQTGHLIIDSECQTEFDNNNEIISLSLNYQDFSEESSGKIIKYFDDKEIQFDALCDSIPK-LHPIKSKKIQVGHTRLNDYREVECQSGCIMDDVEVQTE 3265          

HSP 17 Score: 112.849 bits (281), Expect = 3.449e-30
Identity = 58/107 (54.21%), Postives = 81/107 (75.70%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            KL+ DLEVSCQTG LI++SECQTEF++    + IT+NS DF + K    K+++EKE+Q ++ ++S  +  K +KS KVQ+G  R+NE  EVECQSGC+MDD+GVQC+
Sbjct: 4610 KLDEDLEVSCQTGRLIMNSECQTEFNE---QIIITMNSPDFTDLKIQQKKDFMEKEMQCDSLDNSLLKENKITKSMKVQMGLARINECREVECQSGCMMDDVGVQCD 4713          

HSP 18 Score: 105.531 bits (262), Expect = 1.229e-27
Identity = 59/107 (55.14%), Postives = 76/107 (71.03%), Query Frame = 3
Query:    6 LEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGEN-KEDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            L+ D EVSCQTGHL+I+SECQTE  D  DT+  T +++DF E   E  +KE++EKEIQFET + S S++     SK+VQVG  RL E+ EV CQS  LM+DIGV+ E
Sbjct: 5083 LDSDSEVSCQTGHLLIESECQTELGDEFDTIIKTEHTQDFSEELMERPMKEFVEKEIQFETAKSSLSKYNTLENSKEVQVGQSRLVESREVGCQSEYLMNDIGVETE 5189          

HSP 19 Score: 94.3597 bits (233), Expect = 1.061e-23
Identity = 55/108 (50.93%), Postives = 69/108 (63.89%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGE-NKEDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            +LE D ++SCQ GHL+ DSECQTE     D+++IT    DF E   E  LK+++EKEIQFE  ED  S       SK VQVG  RL E  +VECQ+ C+ DD+GVQ E
Sbjct: 4769 RLELDSDMSCQVGHLVFDSECQTES---FDSISITKYRSDFSEVPTERHLKDFVEKEIQFELLEDCSSTINNVKISKNVQVGQARLAEGRDVECQAVCMKDDVGVQNE 4873          

HSP 20 Score: 89.3521 bits (220), Expect = 5.276e-22
Identity = 52/109 (47.71%), Postives = 66/109 (60.55%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTI--TLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            +LE D + SCQTGH++ D   QTE ++   ++ I   L   +F E          E EIQ +         +  +KSKKVQVGHPRLNE L+VECQSGC+MDDIGVQCE
Sbjct: 1872 RLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNEFQEMTSKDSISLREIEIQTDDFPGFSVNIINMNKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCE 1980          

HSP 21 Score: 89.3521 bits (220), Expect = 6.727e-22
Identity = 50/107 (46.73%), Postives = 73/107 (68.22%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            +L+ D EVSCQTG+ I+DSECQTE +D +D + IT   ++F E ++  ++E++EKEIQ E      S + K S S+ +QVG  +LNE  EVECQS  ++ ++GVQ E
Sbjct: 4928 RLDIDSEVSCQTGNFIMDSECQTEVEDSTDMILITHQFQNFEEERKPHVREFVEKEIQSEF----LSRYNKPSSSQVIQVGLSKLNEYKEVECQSEFIVFEMGVQTE 5030          

HSP 22 Score: 80.8777 bits (198), Expect = 6.302e-19
Identity = 48/110 (43.64%), Postives = 71/110 (64.55%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTE---FDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            ++E D + SCQ GHL+ + E QT+   FD     +T+  +  +  +N   +  E++EKE+Q     D  SE  K+ KSKKVQVGHPRLN+NL+VECQSG L++++ +Q E
Sbjct: 1553 RIEIDYDTSCQAGHLVRELEIQTDQEPFDGFETQITMVKDQLE-SQNIVRTTTEFIEKEVQ----PDFVSE--KSRKSKKVQVGHPRLNDNLDVECQSGTLLNEMEIQTE 1655          

HSP 23 Score: 70.4774 bits (171), Expect = 2.156e-15
Identity = 42/109 (38.53%), Postives = 64/109 (58.72%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTV--TITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            +LE D + SCQTGHL+ +SE QTE D+    +   I L ++      E   KEY+++E+Q +  +D      + +K KKVQVG+PRLN  +  ECQS  ++ +  +Q E
Sbjct: 1710 RLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQTQFQNELLFKEYVDQEVQLD-IDDFTGPIPRNTKCKKVQVGYPRLNLQIHAECQSEIVLQNEDIQTE 1817          

HSP 24 Score: 64.3142 bits (155), Expect = 3.134e-13
Identity = 50/112 (44.64%), Postives = 67/112 (59.82%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQT--EFDDLSDTVTITLNSKDFGEN--KEDSLKEYLEKEIQFETTEDSYSEHVKAS-KSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            KL  +L+ SCQ G++  ++ECQT  EF D  + V   + ++   +N   E   KEY EKEIQ   T        KAS K KK+QVGHP+LNE +EVECQS   +++I VQ E
Sbjct: 1394 KLFMELDESCQIGYVKHEAECQTDNEFSD-EELVITEVQAELQSQNVLMESKKKEYTEKEIQPILT------FYKASNKGKKIQVGHPKLNEFVEVECQSEISIEEIAVQTE 1498          

HSP 25 Score: 56.225 bits (134), Expect = 2.428e-10
Identity = 36/105 (34.29%), Postives = 49/105 (46.67%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQ 317
            +L+GD E SCQTGH++ D E QTE D                         Y E +IQ  T  ++        K KKVQVG+P+LN + E   Q G  ++D  +Q
Sbjct: 1137 RLDGDFETSCQTGHIVKDFESQTEND-------------------------YTEHQIQLVTMANNLQAVKSQMKGKKVQVGYPQLNMSFEFGSQFGDDLNDATIQ 1216          

HSP 26 Score: 52.373 bits (124), Expect = 6.497e-9
Identity = 40/107 (37.38%), Postives = 59/107 (55.14%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDD--LSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQ 317
            +L  +LEV CQ+G L+ D   Q E D+  + +T    L +  F E+  D   +Y +K + F     + + H K  K KK+QVG PRL+ + EV CQ+G L+ D G Q
Sbjct: 3890 RLNENLEVECQSGCLMDDIGVQCEVDEFMIMETKERNLEASLFVEDLIDEATQYDDKNLHF-----TIAAH-KDVKGKKLQVGTPRLDADPEVSCQTGHLIMDSGDQ 3990          

HSP 27 Score: 50.8322 bits (120), Expect = 1.786e-8
Identity = 36/115 (31.30%), Postives = 61/115 (53.04%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSL--------KEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            +L G++++ CQTGHL++D+ECQT            + + D  EN ++ L        K    +E Q++  E    E V + +++ +QVG P+L+++ E+ CQS     D  VQ E
Sbjct: 5243 RLLGEMDLLCQTGHLMLDNECQTN----------KMTTNDIMENFQNELNADESFPTKSLSNQESQYDLCE----ETVLSCQNQALQVGFPKLHQSQEISCQSTVETVDAVVQSE 5343          

HSP 28 Score: 49.2914 bits (116), Expect = 6.702e-8
Identity = 35/107 (32.71%), Postives = 56/107 (52.34%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            +L  +L+V CQ+G L+ + E QTE D+     T  +N     EN   S +E +E+ +Q+E+           +K KK+Q G  RL  + +  CQ+G L+ +  VQ E
Sbjct: 1632 RLNDNLDVECQSGTLLNEMEIQTELDEFIIEQTTQIN-----ENLTQSSEEMIEELVQYESENLRPITLKTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTE 1733          

HSP 29 Score: 48.1358 bits (113), Expect = 1.502e-7
Identity = 33/94 (35.11%), Postives = 46/94 (48.94%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQ 284
            +L  D E SCQTGH++ + E QTEF               F + +    KEY  KE Q E+        +  +K KK+QVG+P +N+  E E Q
Sbjct: 1260 RLNADYEASCQTGHIVNEIETQTEF---------------FYKTESILPKEYSNKETQPES-------EMAITKGKKIQVGYPHINKISEKEIQ 1331          

HSP 30 Score: 45.4394 bits (106), Expect = 1.378e-6
Identity = 33/94 (35.11%), Postives = 50/94 (53.19%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQ 284
            +LEG+LE SCQTGH++ +   QTE  +L     + L SK+   + E + K  +  E+                K KKVQVG+P+  + ++VECQ
Sbjct: 1019 RLEGNLESSCQTGHVVDEFHTQTE--ELLFMEPMGLLSKEIQSDIESADKYQIRLEM----------------KGKKVQVGYPQTYDRIDVECQ 1094          

HSP 31 Score: 44.669 bits (104), Expect = 3.086e-6
Identity = 42/112 (37.50%), Postives = 63/112 (56.25%), Query Frame = 3
Query:    3 KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSL--KEYLEKEIQFETTEDSYSEHV---KASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCE 323
            +L   LE  CQ+G ++ D   Q E D+      I  N++   +N E SL   + +E+ IQ+  +++S S  V   K  K KK+QVG+PRL+ +LEV CQ+G L+ D   Q E
Sbjct: 2917 RLNKSLEGECQSGCIMDDIGVQCETDEF----MIEENNE---QNLEASLLIDDLIEENIQY--SDESSSVTVLSQKEQKRKKLQVGNPRLDGDLEVSCQTGHLIIDSQCQTE 3019          
The following BLAST results are available for this feature:
BLAST of SMED30003903 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003903 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003903 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003903 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003903 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003903 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003903 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003903 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003903 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003903 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003903 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003903 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003903 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003903 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000023005.19.715e-6799.07SMESG000023005.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003903 ID=SMED30003903|Name=SMED30003903|organism=Schmidtea mediterranea sexual|type=transcript|length=325bp
CAAAATTAGAAGGAGATTTGGAAGTATCATGTCAGACAGGACATTTAATA
ATAGATTCAGAATGTCAGACTGAGTTCGATGACCTAAGTGATACCGTGAC
AATAACATTGAATTCTAAAGATTTTGGTGAAAATAAAGAAGACTCGTTAA
AAGAGTATCTAGAGAAAGAAATACAATTTGAAACAACTGAAGATTCTTAT
TCGGAACATGTTAAAGCAAGTAAATCAAAGAAAGTCCAAGTCGGTCATCC
AAGATTGAATGAAAATTTAGAAGTGGAATGCCAATCAGGATGCCTAATGG
ATGACATCGGGGTTCAATGTGAAGT
back to top

protein sequence of SMED30003903-orf-1

>SMED30003903-orf-1 ID=SMED30003903-orf-1|Name=SMED30003903-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=107bp
KLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLK
EYLEKEIQFETTEDSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMD
DIGVQCE
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte