Tetratricopeptide repeat protein 21B

Overview
NameTetratricopeptide repeat protein 21B
Smed IDSMED30003902
Length (bp)4150
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tetratricopeptide repeat protein 21B (SMED30003902) t-SNE clustered cells

Violin plots show distribution of expression levels for Tetratricopeptide repeat protein 21B (SMED30003902) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tetratricopeptide repeat protein 21B (SMED30003902) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tetratricopeptide repeat protein 21B (SMED30003902) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003902

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30003902SMESG000011579.1 SmedASXL_017627SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30003902SMESG000011579.1 dd_Smed_v4_12056_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30003902SMESG000011579.1 dd_Smed_v4_12056_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003902SMESG000011579.1 dd_Smed_v4_12056_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30003902SMESG000011579.1 dd_Smed_v4_12056_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30003902SMESG000011579.1 dd_Smed_v6_12056_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30003902SMESG000011579.1 dd_Smed_v4_12056_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Human
Match: TTC21B (tetratricopeptide repeat domain 21B [Source:HGNC Symbol;Acc:HGNC:25660])

HSP 1 Score: 1030.78 bits (2664), Expect = 0.000e+0
Identity = 564/1343 (42.00%), Postives = 846/1343 (62.99%), Query Frame = 1
Query:   91 ELMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQ-SSNSNPL--ILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQ-KPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSGQ-SALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVS-GNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMIN---IESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            EL T I Y+ +E+Y+H  +   ++G+KRYG++P  +  +A   + E + QE++RE E + ++ +V++ +LL+L+ A K +P PD+  I E + ++++ RKG  + + + AG+ L+   R+DKAREY+ R +K++  +K+   L  W+D+   KE + KKA K F+E      GN+  +L+GK + LE++ N S A++ V++IIV    FLPA ++KM+LQL   DW+    TA R L+ +S  V+A + Q L  +C +G  E+ S +L  L   LD  EP+N   ++     F+R CGR++ +LQ+   L ERA  L P   E+   LG  M++Q + ++A+K++K A+  DE++++A+ G I CQL EG L++A  QLEFL+EIQ +I K++       E  YL A++   KN+ Q E+I  L++ +  HFS L    LG +Y   LNPDFL+ IV EY++FCP Q +S   PL  +L++   +LE VVR +PGL Q  FL+AK  ++SGD+E +   L+ CLE + ++ + HLL+A VYL     K    +LE+ LS++F+VR+ PL+HL+K +   +  +  ++ K+L  A  LPG++ +   ++ K  ++ +  S RLSI+LEL   HRL GE HE+ K+LQDA  +FSG+ EE R+TI NADLA+ +GDIE AL+IL++V  +  YF+EAR+ MA+IYLK+RKDK LY  CF+E+AER   P S +LLGDAYM I +P++AI  YE+A      D  LA+K+G AL+KTHNY+ AI YY   +K+GQ + L  DL+ LL+ L+ YD A+ VL   ++  +  N     +E     VLLA+VY    +    I+ L  A  +Q ++LKRV  E P+++  +K LA EIC +IA+    + D E +IK+Y+EAL + E+  + +LELARL +   D ++C   C  LLQ D  N                 +AT+MMA+LM ++ D++ A+FHL++LL + PD++  L+ LID+LRR G+LE+V  +F   E+ N ++ L  G+ +CKGL  WY G  ++AL+ FN AR D +W + A+YNM+EICLNPDN TVGG+V + LD   GNS  + E         SV   ++TAE +L  L     +   Q  LR M N   + +K K ++E+AL+ F E+  ++ E+I AL G A   M+LKQ+ +A+  L  I+K+NW    AEE EKS LLLADIYIQ      A D LK C+++N+S  KAYEY G + EKEQ Y  A+ +Y  AW + N+ +P +GYKLAFNYLK ++Y++SID C QVL++ P YPKI+K+ILDKA
Sbjct:    5 ELKTLINYYCQERYFHHVLLVASEGIKRYGSDPVFRFYHAYGTLMEGKTQEALREFEAIKNKQDVSLCSLLALIYAHKMSPNPDREAILESDARVKEQRKGAGEKALYHAGLFLWHIGRHDKAREYIDRMIKISDGSKQGHVLKAWLDITRGKEPYTKKALKYFEEG--LQDGNDTFALLGKAQCLEMRQNYSGALETVNQIIVNFPSFLPAFVKKMKLQLALQDWDQTVETAQRLLLQDSQNVEALRMQALYYVCREGDIEKASTKLENLGNTLDAMEPQNAQLFYNITLAFSRTCGRSQLILQKIQTLLERAFSLNPQQSEFATELGYQMILQGRVKEALKWYKTAMTLDETSVSALVGFIQCQLIEGQLQDADQQLEFLNEIQQSIGKSA-------ELIYLHAVLAMKKNKRQEEVINLLNDVLDTHFSQLEGLPLGIQYFEKLNPDFLLEIVMEYLSFCPMQPASPGQPLCPLLRRCISVLETVVRTVPGLLQTVFLIAKVKYLSGDIEAAFNNLQHCLEHNPSYADAHLLLAQVYLSQEKVKLCSQSLELCLSYDFKVRDYPLYHLIKAQSQKKMGEIADAIKTLHMAMSLPGMKRIGASTKSKDRKTEVDTSHRLSIFLELIDVHRLNGEQHEATKVLQDAIHEFSGTSEEVRVTIANADLALAQGDIERALSILQNVTAEQPYFIEAREKMADIYLKHRKDKMLYITCFREIAERMANPRSFLLLGDAYMNILEPEEAIVAYEQALNQNPKDGTLASKMGKALIKTHNYSMAITYYEAALKTGQKNYLCYDLAELLLKLKWYDKAEKVLQHALAH-EPVNELSALMEDGRCQVLLAKVYSKMEKLGDAITALQQARELQARVLKRVQMEQPDAVPAQKHLAAEICAEIAKHSVAQRDYEKAIKFYREALVHCETDNKIMLELARLYLAQDDPDSCLRQCALLLQSDQDN----------------EAATMMMADLMFRKQDYEQAVFHLQQLLERKPDNYMTLSRLIDLLRRCGKLEDVPRFFSMAEKRNSRAKLEPGFQYCKGLYLWYTGEPNDALRHFNKARKDRDWGQNALYNMIEICLNPDNETVGGEVFENLDGDLGNSTEKQE---------SVQLAVRTAEKLLKELKPQTVQGHVQ--LRIMENYCLMATKQKSNVEQALNTFTEIAASEKEHIPALLGMATAYMILKQTPRARNQLKRIAKMNWNAIDAEEFEKSWLLLADIYIQSAKYDMAEDLLKRCLRHNRSCCKAYEYMGYIMEKEQAYTDAALNYEMAWKYSNRTNPAVGYKLAFNYLKAKRYVDSIDICHQVLEAHPTYPKIRKDILDKA 1310          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Human
Match: TTC21B (tetratricopeptide repeat domain 21B [Source:HGNC Symbol;Acc:HGNC:25660])

HSP 1 Score: 969.148 bits (2504), Expect = 0.000e+0
Identity = 536/1303 (41.14%), Postives = 811/1303 (62.24%), Query Frame = 1
Query:   91 ELMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQ-SSNSNPL--ILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQ-KPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSGQ-SALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVS-GNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMIN---IESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGY 3972
            EL T I Y+ +E+Y+H  +   ++G+KRYG++P  +  +A   + E + QE++RE E + ++ +V++ +LL+L+ A K +P PD+  I E + ++++ RKG  + + + AG+ L+   R+DKAREY+ R +K++  +K+   L  W+D+   KE + KKA K F+E      GN+  +L+GK + LE++ N S A++ V++IIV    FLPA ++KM+LQL   DW+    TA R L+ +S  V+A + Q L  +C +G  E+ S +L  L   LD  EP+N   ++     F+R CGR++ +LQ+   L ERA  L P   E+   LG  M++Q + ++A+K++K A+  DE++++A+ G I CQL EG L++A  QLEFL+EIQ +I K++       E  YL A++   KN+ Q E+I  L++ +  HFS L    LG +Y   LNPDFL+ IV EY++FCP Q +S   PL  +L++   +LE VVR +PGL Q  FL+AK  ++SGD+E +   L+ CLE + ++ + HLL+A VYL     K    +LE+ LS++F+VR+ PL+HL+K +   +  +  ++ K+L  A  LPG++ +   ++ K  ++ +  S RLSI+LEL   HRL GE HE+ K+LQDA  +FSG+ EE R+TI NADLA+ +GDIE AL+IL++V  +  YF+EAR+ MA+IYLK+RKDK LY  CF+E+AER   P S +LLGDAYM I +P++AI  YE+A      D  LA+K+G AL+KTHNY+ AI YY   +K+GQ + L  DL+ LL+ L+ YD A+ VL   ++  +  N     +E     VLLA+VY    +    I+ L  A  +Q ++LKRV  E P+++  +K LA EIC +IA+    + D E +IK+Y+EAL + E+  + +LELARL +   D ++C   C  LLQ D  N                 +AT+MMA+LM ++ D++ A+FHL++LL + PD++  L+ LID+LRR G+LE+V  +F   E+ N ++ L  G+ +CKGL  WY G  ++AL+ FN AR D +W + A+YNM+EICLNPDN TVGG+V + LD   GNS  + E         SV   ++TAE +L  L     +   Q  LR M N   + +K K ++E+AL+ F E+  ++ E+I AL G A   M+LKQ+ +A+  L  I+K+NW    AEE EKS LLLADIYIQ      A D LK C+++N+S  KAYEY G + EKEQ Y  A+ +Y  AW + N+ +P +G+
Sbjct:    5 ELKTLINYYCQERYFHHVLLVASEGIKRYGSDPVFRFYHAYGTLMEGKTQEALREFEAIKNKQDVSLCSLLALIYAHKMSPNPDREAILESDARVKEQRKGAGEKALYHAGLFLWHIGRHDKAREYIDRMIKISDGSKQGHVLKAWLDITRGKEPYTKKALKYFEEG--LQDGNDTFALLGKAQCLEMRQNYSGALETVNQIIVNFPSFLPAFVKKMKLQLALQDWDQTVETAQRLLLQDSQNVEALRMQALYYVCREGDIEKASTKLENLGNTLDAMEPQNAQLFYNITLAFSRTCGRSQLILQKIQTLLERAFSLNPQQSEFATELGYQMILQGRVKEALKWYKTAMTLDETSVSALVGFIQCQLIEGQLQDADQQLEFLNEIQQSIGKSA-------ELIYLHAVLAMKKNKRQEEVINLLNDVLDTHFSQLEGLPLGIQYFEKLNPDFLLEIVMEYLSFCPMQPASPGQPLCPLLRRCISVLETVVRTVPGLLQTVFLIAKVKYLSGDIEAAFNNLQHCLEHNPSYADAHLLLAQVYLSQEKVKLCSQSLELCLSYDFKVRDYPLYHLIKAQSQKKMGEIADAIKTLHMAMSLPGMKRIGASTKSKDRKTEVDTSHRLSIFLELIDVHRLNGEQHEATKVLQDAIHEFSGTSEEVRVTIANADLALAQGDIERALSILQNVTAEQPYFIEAREKMADIYLKHRKDKMLYITCFREIAERMANPRSFLLLGDAYMNILEPEEAIVAYEQALNQNPKDGTLASKMGKALIKTHNYSMAITYYEAALKTGQKNYLCYDLAELLLKLKWYDKAEKVLQHALAH-EPVNELSALMEDGRCQVLLAKVYSKMEKLGDAITALQQARELQARVLKRVQMEQPDAVPAQKHLAAEICAEIAKHSVAQRDYEKAIKFYREALVHCETDNKIMLELARLYLAQDDPDSCLRQCALLLQSDQDN----------------EAATMMMADLMFRKQDYEQAVFHLQQLLERKPDNYMTLSRLIDLLRRCGKLEDVPRFFSMAEKRNSRAKLEPGFQYCKGLYLWYTGEPNDALRHFNKARKDRDWGQNALYNMIEICLNPDNETVGGEVFENLDGDLGNSTEKQE---------SVQLAVRTAEKLLKELKPQTVQGHVQ--LRIMENYCLMATKQKSNVEQALNTFTEIAASEKEHIPALLGMATAYMILKQTPRARNQLKRIAKMNWNAIDAEEFEKSWLLLADIYIQSAKYDMAEDLLKRCLRHNRSCCKAYEYMGYIMEKEQAYTDAALNYEMAWKYSNRTNPAVGF 1270          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Human
Match: TTC21A (tetratricopeptide repeat domain 21A [Source:HGNC Symbol;Acc:HGNC:30761])

HSP 1 Score: 848.966 bits (2192), Expect = 0.000e+0
Identity = 493/1355 (36.38%), Postives = 794/1355 (58.60%), Query Frame = 1
Query:   73 MAFEDPELMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSE--------RLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSNPLI---LKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVK-SGQSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSL---STSNEKDLRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            M+  D  LM  I+Y+ +EKY+H   +    GL+++ N+P LK   A  ++ E+ IQ++I +LE +   P+V++ + ++L+ A KR    D+  IQE E  ++++RK  S  + ++AG+ L+L  R+DKA+EY+ R LK++   +E   L GWVD+ S+K    KKA +  ++        +V  LMGK  Y  +Q N S+A+++V++I VT+  FLPAL+ KM+L L   DWE       R L  +   +DA +   +  L  +G+   +S          +  L++ L+  EP+N   + +   + +R+CG ++ +L       ER     P  V     LG + +++N+ ++A+ ++  A+  D+  +  + G+I C + EG L+EA  +LEFL E+Q ++ K+           +L A++   K++ + E    L E++++HFS +    LG EY   L+P FL+ I KEY+ FCP+Q      ++   LK++  IL  VV+  P L    +L+A+  + S +LE ++++L+ CLE D A ++ HLLM  +YL  GNF    H LE+G+SHNFQVR++PL+HL+K R   +   Y E+ K+L    +LP ++   G+  K    S+  S+R SI LEL  + RL GE HE+ K++QD   +F G+ EE RITI N DL + +G+++ AL +LR++ P  + ++EAR+ MA IYL+  +D++LY  C++EL E    P + +LLGDA M I +P+KA+ VY+EA +    D  LA+++G A VK H YTEAI+YY    K +GQ  L  DL  LL+ L+  + A+ VL + + E     +    +  V+  +LLA+VYKS  + E  I  L  AL++Q++ILKRV  E PE +  +K+LA  ICI+ A+ Y   ++ + +++ YK+  SY  +  + +LELA+L +  G ++ C+  C  LLQ            E+N E     +A+++MA+LM ++   + A+    ++L K PD+F  L  LID+LRR+G+LE++  +F+  ++ + +  L  G+N+C+G+  W+IG  +EALK  N AR DS W + A+Y+MV+ICLNPDN  VGG+  +      N   + E+            G+ TAE +L      S S++  LR   L+ +  + ++ K ++E AL  F ++ + + +++ AL   A   + LKQ  KA+  L  ++K  W+   AE++EKS LLLADIY Q      AL+ L+ C++YNKS YKAYEY G + EKEQ Y+ A T+Y  AW + +  +P IG+KLAFNYLK +K++E+I+ C  VL+  P YPKI++EIL+KA
Sbjct:    1 MSSNDSSLMAGIIYYSQEKYFHHVQQAAAVGLEKFSNDPVLKFFKAYGVLKEEHIQDAISDLESIRHHPDVSLCSTMALIYAHKRCEIIDREAIQELEYSLKEIRKTVSGTALYYAGLFLWLIGRHDKAKEYIDRMLKISRGFREAYVLRGWVDLTSDKPHTAKKAIEYLEQG--IQDTKDVLGLMGKAMYFMMQQNYSEALEVVNQITVTSGSFLPALVLKMQLFLARQDWEQTVEMGHRILEKDESNIDACQILTVHELAREGNMTTVSSLKTQKATNHVRNLIKALETREPENPSLHLKKIIVVSRLCGSHQVILGLVCSFIERTFMATPSYVHVATELGYLFILKNQVKEALLWYSEAMKLDKDGMAGLTGIILCHILEGHLEEAEYRLEFLKEVQKSLGKSEV-------LIFLQALLMSRKHKGEEETTALLKEAVELHFSSMQGIPLGSEYFEKLDPYFLVCIAKEYLLFCPKQPRLPGQIVSPLLKQVAVILNPVVKAAPALIDPLYLMAQVRYYS-ELENAQSILQRCLELDPASVDAHLLMCQIYLAQGNFGMCFHCLELGVSHNFQVRDHPLYHLIKARALNKAGDYPEAIKTLKMVIKLPALKKEEGR--KFLRPSVQPSQRASILLELVEALRLNGELHEATKVMQDTINEFGGTPEENRITIANVDLVLSKGNVDVALNMLRNILPKQSCYMEAREKMANIYLQTLRDRRLYIRCYRELCEHLPGPHTSLLLGDALMSILEPEKALEVYDEAYRQNPHDASLASRIGHAYVKAHQYTEAIEYYEAAQKINGQDFLCCDLGKLLLKLKKVNKAEKVLKQAL-EHDIVQDIPSMMNDVKCLLLLAKVYKSHKK-EAVIETLNKALDLQSRILKRVPLEQPEMIPSQKQLAASICIQFAEHYLAEKEYDKAVQSYKDVFSYLPTDNKVMLELAQLYLLQGHLDLCEQHCAILLQ-----------TEQNHE-----TASVLMADLMFRKQKHEAAINLYHQVLEKAPDNFLVLHKLIDLLRRSGKLEDIPAFFELAKKVSSRVPLEPGFNYCRGIYCWHIGQPNEALKFLNKARKDSTWGQSAIYHMVQICLNPDNEVVGGEAFENQGAESNYMEKKELE---------QQGVSTAEKLLREFYPHSDSSQTQLR--LLQGLCRLATREKANMEAALGSFIQIAQAEKDSVPALLALAQAYVFLKQIPKARMQLKRLAKTPWVLSEAEDLEKSWLLLADIYCQGSKFDLALELLRRCVQYNKSCYKAYEYMGFIMEKEQSYKDAVTNYKLAWKYSHHANPAIGFKLAFNYLKDKKFVEAIEICNDVLREHPDYPKIREEILEKA 1314          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Human
Match: TTC21A (tetratricopeptide repeat domain 21A [Source:HGNC Symbol;Acc:HGNC:30761])

HSP 1 Score: 823.157 bits (2125), Expect = 0.000e+0
Identity = 479/1347 (35.56%), Postives = 774/1347 (57.46%), Query Frame = 1
Query:   73 MAFEDPELMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSNPLI---LKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVK-SGQSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSL---STSNEKDLRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            M+  D  LM  I+Y+ +EKY+H   +    GL+++ N+P LK   A  ++ E+ IQ++I +LE +   P+V++ + ++L+ A KR    D+  IQE E  ++++RK  S  + ++AG+ L+L  R+DKA+EY+ R LK++   +E M                                           Y  +Q N S+A+++V++I VT+  FLPAL+ KM+L L   DWE       R L  +   +DA +   +  L  +G+    +  +  L++ L+  EP+N   + +   + +R+CG ++ +L       ER     P  V     LG + +++N+ ++A+ ++  A+  D+  +  + G+I C + EG L+EA  +LEFL E+Q ++ K+           +L A++   K++ + E    L E++++HFS +    LG EY   L+P FL+ I KEY+ FCP+Q      ++   LK++  IL  VV+  P L    +L+A+  + SG+LE ++++L+ CLE D A ++ HLLM  +YL  GNF    H LE+G+SHNFQVR++PL+HL+K R   +   Y E+ K+L    +LP ++   G+  K    S+  S+R SI LEL  + RL GE HE+ K++QD   +F G+ EE RITI N DL + +G+++ AL +LR++ P  + ++EAR+ MA IYL+  +D++LY  C++EL E    P + +LLGDA M I +P+KA+ VY+EA +    D  LA+++G A VK H YTEAI+YY    K +GQ  L  DL  LL+ L+  + A+ VL + + E     +    +  V+  +LLA+VYKS  + E  I  L  AL++Q++ILKRV  E PE +  +K+LA  ICI+ A+ Y   ++ + +++ YK+  SY  +  + +LELA+L +  G ++ C+  C  LLQ            E+N E     +A+++MA+LM ++   + A+    ++L K PD+F  L  LID+LRR+G+LE++  +F+  ++ + +  L  G+N+C+G+  W+IG  +EALK  N AR DS W + A+Y+MV+ICLNPDN  VGG+  +      N   + E+            G+ TAE +L      S S++  LR   L+ +  + ++ K ++E AL  F ++ + + +++ AL   A   + LKQ  KA+  L  ++K  W+   AE++EKS LLLADIY Q      AL+ L+ C++YNKS YKAYEY G + EKEQ Y+ A T+Y  AW + +  +P IG+KLAFNYLK +K++E+I+ C  VL+  P YPKI++EIL+KA
Sbjct:    1 MSSNDSSLMAGIIYYSQEKYFHHVQQAAAVGLEKFSNDPVLKFFKAYGVLKEEHIQDAISDLESIRHHPDVSLCSTMALIYAHKRCEIIDREAIQELEYSLKEIRKTVSGTALYYAGLFLWLIGRHDKAKEYIDRMLKISRGFREAM-------------------------------------------YFMMQQNYSEALEVVNQITVTSGSFLPALVLKMQLFLARQDWEQTVEMGHRILEKDESNIDACQILTVHELAREGNMTTATNHVRNLIKALETREPENPSLHLKKIIVVSRLCGSHQVILGLVCSFIERTFMATPSYVHVATELGYLFILKNQVKEALLWYSEAMKLDKDGMAGLTGIILCHILEGHLEEAEYRLEFLKEVQKSLGKSEV-------LIFLQALLMSRKHKGEEETTALLKEAVELHFSSMQGIPLGSEYFEKLDPYFLVCIAKEYLLFCPKQPRLPGQIVSPLLKQVAVILNPVVKAAPALIDPLYLMAQVRYYSGELENAQSILQRCLELDPASVDAHLLMCQIYLAQGNFGMCFHCLELGVSHNFQVRDHPLYHLIKARALNKAGDYPEAIKTLKMVIKLPALKKEEGR--KFLRPSVQPSQRASILLELVEALRLNGELHEATKVMQDTINEFGGTPEENRITIANVDLVLSKGNVDVALNMLRNILPKQSCYMEAREKMANIYLQTLRDRRLYIRCYRELCEHLPGPHTSLLLGDALMSILEPEKALEVYDEAYRQNPHDASLASRIGHAYVKAHQYTEAIEYYEAAQKINGQDFLCCDLGKLLLKLKKVNKAEKVLKQAL-EHDIVQDIPSMMNDVKCLLLLAKVYKSHKK-EAVIETLNKALDLQSRILKRVPLEQPEMIPSQKQLAASICIQFAEHYLAEKEYDKAVQSYKDVFSYLPTDNKVMLELAQLYLLQGHLDLCEQHCAILLQ-----------TEQNHE-----TASVLMADLMFRKQKHEAAINLYHQVLEKAPDNFLVLHKLIDLLRRSGKLEDIPAFFELAKKVSSRVPLEPGFNYCRGIYCWHIGQPNEALKFLNKARKDSTWGQSAIYHMVQICLNPDNEVVGGEAFENQGAESNYMEKKELE---------QQGVSTAEKLLREFYPHSDSSQTQLR--LLQGLCRLATREKANMEAALGSFIQIAQAEKDSVPALLALAQAYVFLKQIPKARMQLKRLAKTPWVLSEAEDLEKSWLLLADIYCQGSKFDLALELLRRCVQYNKSCYKAYEYMGFIMEKEQSYKDAVTNYKLAWKYSHHANPAIGFKLAFNYLKDKKFVEAIEICNDVLREHPDYPKIREEILEKA 1266          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Human
Match: TTC21A (tetratricopeptide repeat domain 21A [Source:HGNC Symbol;Acc:HGNC:30761])

HSP 1 Score: 705.286 bits (1819), Expect = 0.000e+0
Identity = 407/1145 (35.55%), Postives = 665/1145 (58.08%), Query Frame = 1
Query:   73 MAFEDPELMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSNPLI---LKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVK-SGQSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNS 3495
            M+  D  LM  I+Y+ +EKY+H   +    GL+++ N+P LK   A  ++ E+ IQ++I +LE +   P+V++ + ++L+ A KR    D+  IQE E  ++++RK  S  + ++AG+ L+L  R+DKA+EY+ R LK++   +E   L GWVD+ S+K    KKA +  ++        +V  LMGK  Y  +Q N S+A+++V++I VT+  FLPAL+ KM+L L   DWE       R L  +   +DA +   +  L  +G+    +  +  L++ L+  EP+N   + +   + +R+CG ++ +L       ER     P  V     LG + +++N+ ++A+ ++  A+  D+  +  + G+I C + EG L+EA  +LEFL E+Q ++ K+           +L A++   K++ + E    L E++++HFS +    LG EY   L+P FL+ I KEY+ FCP+Q      ++   LK++  IL  VV+  P L    +L+A+  + SG+LE ++++L+ CLE D A ++ HLLM  +YL  GNF    H LE+G+SHNFQVR++PL+HL+K R   +   Y E+ K+L    +LP ++   G+  K    S+  S+R SI LEL  + RL GE HE+ K++QD   +F G+ EE RITI N DL + +G+++ AL +LR++ P  + ++EAR+ MA IYL+  +D++LY  C++EL E    P + +LLGDA M I +P+KA+ VY+EA +    D  LA+++G A VK H YTEAI+YY    K +GQ  L  DL  LL+ L+  + A+ VL + + E     +    +  V+  +LLA+VYKS  + E  I  L  AL++Q++ILKRV  E PE +  +K+LA  ICI+ A+ Y   ++ + +++ YK+  SY  +  + +LELA+L +  G ++ C+  C  LLQ            E+N E     +A+++MA+LM ++   + A+    ++L K PD+F  L  LID+LRR+G+LE++  +F+  ++ + +  L  G+N+C+G+  W+IG  +EALK  N AR DS W + A+Y+MV+ICLNPDN  VGG+  +      N   + E+            G+ TAE +L  
Sbjct:    1 MSSNDSSLMAGIIYYSQEKYFHHVQQAAAVGLEKFSNDPVLKFFKAYGVLKEEHIQDAISDLESIRHHPDVSLCSTMALIYAHKRCEIIDREAIQELEYSLKEIRKTVSGTALYYAGLFLWLIGRHDKAKEYIDRMLKISRGFREAYVLRGWVDLTSDKPHTAKKAIEYLEQGIQD--TKDVLGLMGKAMYFMMQQNYSEALEVVNQITVTSGSFLPALVLKMQLFLARQDWEQTVEMGHRILEKDESNIDACQILTVHELAREGNMTTATNHVRNLIKALETREPENPSLHLKKIIVVSRLCGSHQVILGLVCSFIERTFMATPSYVHVATELGYLFILKNQVKEALLWYSEAMKLDKDGMAGLTGIILCHILEGHLEEAEYRLEFLKEVQKSLGKSEV-------LIFLQALLMSRKHKGEEETTALLKEAVELHFSSMQGIPLGSEYFEKLDPYFLVCIAKEYLLFCPKQPRLPGQIVSPLLKQVAVILNPVVKAAPALIDPLYLMAQVRYYSGELENAQSILQRCLELDPASVDAHLLMCQIYLAQGNFGMCFHCLELGVSHNFQVRDHPLYHLIKARALNKAGDYPEAIKTLKMVIKLPALKKEEGR--KFLRPSVQPSQRASILLELVEALRLNGELHEATKVMQDTINEFGGTPEENRITIANVDLVLSKGNVDVALNMLRNILPKQSCYMEAREKMANIYLQTLRDRRLYIRCYRELCEHLPGPHTSLLLGDALMSILEPEKALEVYDEAYRQNPHDASLASRIGHAYVKAHQYTEAIEYYEAAQKINGQDFLCCDLGKLLLKLKKVNKAEKVLKQAL-EHDIVQDIPSMMNDVKCLLLLAKVYKSH-KKEAVIETLNKALDLQSRILKRVPLEQPEMIPSQKQLAASICIQFAEHYLAEKEYDKAVQSYKDVFSYLPTDNKVMLELAQLYLLQGHLDLCEQHCAILLQ-----------TEQNHE-----TASVLMADLMFRKQKHEAAINLYHQVLEKAPDNFLVLHKLIDLLRRSGKLEDIPAFFELAKKVSSRVPLEPGFNYCRGIYCWHIGQPNEALKFLNKARKDSTWGQSAIYHMVQICLNPDNEVVGGEAFENQGAESNYMEKKELE---------QQGVSTAEKLLQG 1107          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Celegans
Match: ift-139 (Tetratricopeptide repeat protein 21 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q20255])

HSP 1 Score: 472.241 bits (1214), Expect = 1.868e-143
Identity = 387/1363 (28.39%), Postives = 665/1363 (48.79%), Query Frame = 1
Query:   97 MTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKM--RDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTT--YAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKY-QILKV---LCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLA--PD----SVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSN---------IEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSNPLILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGN-FKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSGQSA-LRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSE--WERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSE----NILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            ++N+ Y+ RE Y+  A+  + DG      +P+L +L  VC+    +I ++IR LE  +   +V +GAL +L  A      PD   I E E ++  R   +     SY  A   L+    Y K+++ L  A K  T  +AK    L GW+++   K+  QK  ++LF++A    G    D  +G+ K LE   +  +     +++ ++   FLP  +EK +  ++  DW         C++       +  Y ++L+    +C  G    +   L  LL+ LD  E  N   Y R   L   I GR++ +L+       RAL+++  PD    S+    GLG    +   S++ +     AL+ ++S   A+   +   L    + +A  Q + L               I    AK   DK F        R   EN VE+++   +S    F F      G +YL + + D L   V++  +F P     +    +K   + L+ +    PGL      LA+  ++  +   ++  +E  L+ D +  + H+L A++ L  G     AD  L  GL+ NF++RE  L+HL+K + + ++N+  E+ K+L  A Q+P  +  S    +P ES+  ++ ++S+ LEL  + + +    E+   + DA  +++G  E+ ++ I  A L + +G +E AL IL+ + P  + F  +R  MAEIYL+ +KDK+++AAC++EL +   TP S  LLGDA+M++Q+P+ AI  YE+A +M+  D+ LA K+G A V  H Y++A+ +Y   +   +   +R  L+NLL+ L+ ++  + VL        +          ++  +LLAE ++      + +++   A ++ ++I  + +       A  KK    IC   A+   +R +   ++   K+AL+Y E+  +A L L+++  +          C T++Q+D  N                  A  ++A+    R +   A      LL  NP H+ AL+ ++++  RNGE    + +    +E N +    +GYN C+G  EWY G+ +EAL+ ++  + DS   W  +A+Y M++ICLNPDN  +    +D+  V     T  E ++   K+       K   ++L  L T++   L Q ++R    + +  K +I+ AL  FN +  N       N+ A++G A G+++LKQ  KAK  L  ++   W  + ++ +EK  L+LADIYI      QA+  L    KYN +  KA+E +G + EKEQ+Y  A   Y  A++   + +P  GYKLAF YLK ++    I+TC +VL   P+YPKIKKEI+DKA
Sbjct:   29 VSNVHYYAREGYFGTAI-LVCDGRLATIKDPALAILKGVCLTLLGKIPDAIRHLETFVTDNDVALGALHALKWAHASAFNPDNKSIVEIETEISTRARNEKTPYTSYATASEVLYFAGEYQKSKQMLDIARKRATEKHAKHYC-LLGWIELALGKK--QKSTQELFEKAG---GQEYPDGNIGRCKILEGHHSAPEMKVAANELAISTIHFLPGHIEKAKASIMMKDWRGVMD----CIMNADQPEGSNPYIEVLRTVHGICYAGEVSMLKRTLQLLLKSLDENEATNHVLYARITKLLVSISGRDEKILRHARDFLTRALKISRKPDYVALSMRIAFGLGGAKEVSTLSQELV-----ALDCEDSY--AVLSSVVSMLMISRVSDARAQFDILPSAHPKLLESPLYYLIASVLAKQSKDKSFENF-----RQHIENLVEMLRNQLQS----FPF------GLDYLSLFSSDLLYSAVEQCFDFYPLVPIKAPDDCMKLTAKTLQMIYDVAPGLAHCTLQLARNSYLCSNTNAAEKWIEKVLDKDDSLADAHILRAELILDRGGKITDADDALVTGLNFNFKLRETSLYHLIKSKTFKKRNENDEAIKTLKMALQIPR-KEPSKNLFQPKESA--DTHKISVQLELIDTLQHMKRIQEAETTMTDALAEWAGQPEQDQLVIAQAQLYLTKGHVERALGILKKIQPGQSNFHLSRIKMAEIYLEEKKDKRMFAACYRELLKVEATPGSYSLLGDAFMKVQEPEDAINFYEQALKMQSKDVQLAEKIGEAYVMAHLYSKAVNFYESSMNIYKDKNMRLKLANLLLKLRNFEKCEKVLRAPFERDPEPVGTETIQTYIQFLLLLAECHEMMDNVPEAMNDFEKAKSLHSRIQDKTLT------AALKKEGARICNLQAELLYRRREFSQAVDICKQALAYHETDLKANLLLSKIFKEENKWTLVLQPCQTVIQVDPHN----------------DEANSILADFYYIRSEAAHASTSYTTLLNTNPQHWHALSRVVELFCRNGEQNAAEKHLDRAKEVNPRCVTESGYNVCRGRFEWYTGDQNEALRYYSRTK-DSAAGWREKALYYMIDICLNPDNEII----IDENSVENPETTIVEEASEQQKL------AKYYLDLLGKLPTTDRFLLAQNFIR----MHTTDKSAIQAALDEFNRMAFNADRSQVTNVGAVFGVARGHVLLKQVQKAKTVLKMVNGRVWNFDDSDYLEKCWLMLADIYINQNKNDQAVTFLDLVFKYNCNCLKAFELYGYMREKEQKYVEAYKMYEKAFMATKERNPGFGYKLAFTYLKAKRLFACIETCQKVLDLNPQYPKIKKEIMDKA 1318          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Celegans
Match: ift-139 (Tetratricopeptide repeat protein 21 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q20255])

HSP 1 Score: 352.829 bits (904), Expect = 2.556e-102
Identity = 301/1117 (26.95%), Postives = 535/1117 (47.90%), Query Frame = 1
Query:   97 MTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKM--RDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTT--YAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKY-QILKV---LCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLA--PDSVEYNI----GLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSN---------IEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSNPLILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGN-FKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSGQSA-LRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSE--WERRAVYNMVEICLNPDNATV 3366
            ++N+ Y+ RE Y+  A+  + DG      +P+L +L  VC+    +I ++IR LE  +   +V +GAL +L  A      PD   I E E ++  R   +     SY  A   L+    Y K+++ L  A K  T  +AK    L GW+++   K+  QK  ++LF++A    G    D  +G+ K LE   +  +     +++ ++   FLP  +EK +  ++  DW         C++       +  Y ++L+    +C  G    +   L  LL+ LD  E  N   Y R   L   I GR++ +L+       RAL+++  PD V  ++    GLG    +   S++ +     AL+ ++S   A+   +   L    + +A  Q + L               I    AK   DK F        R   EN VE+++   +S    F F      G +YL + + D L   V++  +F P     +    +K   + L+ +    PGL      LA+  ++  +   ++  +E  L+ D +  + H+L A++ L  G     AD  L  GL+ NF++RE  L+HL+K + + ++N+  E+ K+L  A Q+P  +  S    +P ES+  ++ ++S+ LEL  + + +    E+   + DA  +++G  E+ ++ I  A L + +G +E AL IL+ + P  + F  +R  MAEIYL+ +KDK+++AAC++EL +   TP S  LLGDA+M++Q+P+ AI  YE+A +M+  D+ LA K+G A V  H Y++A+ +Y   +   +   +R  L+NLL+ L+ ++  + VL        +          ++  +LLAE ++      + +++   A ++ ++I  + +       A  KK    IC   A+   +R +   ++   K+AL+Y E+  +A L L+++  +          C T++Q+D  N                  A  ++A+    R +   A      LL  NP H+ AL+ ++++  RNGE    + +    +E N +    +GYN C+G  EWY G+ +EAL+ ++  + DS   W  +A+Y M++ICLNPDN  +
Sbjct:   29 VSNVHYYAREGYFGTAI-LVCDGRLATIKDPALAILKGVCLTLLGKIPDAIRHLETFVTDNDVALGALHALKWAHASAFNPDNKSIVEIETEISTRARNEKTPYTSYATASEVLYFAGEYQKSKQMLDIARKRATEKHAKHYC-LLGWIELALGKK--QKSTQELFEKAG---GQEYPDGNIGRCKILEGHHSAPEMKVAANELAISTIHFLPGHIEKAKASIMMKDWRGVMD----CIMNADQPEGSNPYIEVLRTVHGICYAGEVSMLKRTLQLLLKSLDENEATNHVLYARITKLLVSISGRDEKILRHARDFLTRALKISRKPDYVALSMRIAFGLGGAKEVSTLSQELV-----ALDCEDSY--AVLSSVVSMLMISRVSDARAQFDILPSAHPKLLESPLYYLIASVLAKQSKDKSFENF-----RQHIENLVEMLRNQLQS----FPF------GLDYLSLFSSDLLYSAVEQCFDFYPLVPIKAPDDCMKLTAKTLQMIYDVAPGLAHCTLQLARNSYLCSNTNAAEKWIEKVLDKDDSLADAHILRAELILDRGGKITDADDALVTGLNFNFKLRETSLYHLIKSKTFKKRNENDEAIKTLKMALQIPR-KEPSKNLFQPKESA--DTHKISVQLELIDTLQHMKRIQEAETTMTDALAEWAGQPEQDQLVIAQAQLYLTKGHVERALGILKKIQPGQSNFHLSRIKMAEIYLEEKKDKRMFAACYRELLKVEATPGSYSLLGDAFMKVQEPEDAINFYEQALKMQSKDVQLAEKIGEAYVMAHLYSKAVNFYESSMNIYKDKNMRLKLANLLLKLRNFEKCEKVLRAPFERDPEPVGTETIQTYIQFLLLLAECHEMMDNVPEAMNDFEKAKSLHSRIQDKTLT------AALKKEGARICNLQAELLYRRREFSQAVDICKQALAYHETDLKANLLLSKIFKEENKWTLVLQPCQTVIQVDPHN----------------DEANSILADFYYIRSEAAHASTSYTTLLNTNPQHWHALSRVVELFCRNGEQNAAEKHLDRAKEVNPRCVTESGYNVCRGRFEWYTGDQNEALRYYSRTK-DSAAGWREKALYYMIDICLNPDNEII 1086          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Zebrafish
Match: ttc21b (tetratricopeptide repeat domain 21B [Source:ZFIN;Acc:ZDB-GENE-031010-34])

HSP 1 Score: 984.941 bits (2545), Expect = 0.000e+0
Identity = 532/1336 (39.82%), Postives = 836/1336 (62.57%), Query Frame = 1
Query:  106 ILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQS---SNSNPLILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGV-RMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSGQ-SALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVS-GNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNE-KDLRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            ILY+ +EKY    +   ++  +++  +P    L+A  ++ +D++ ++I+ELE+L +R +V++ AL++LV A K+ P PD+ +IQ+ + ++++ RK  S  + ++AGM L+L  R DKAREY+ R +K+++ +KE + L GW+D+ SNK+A+ KK+ K FDEA  +   +++ +LMGKV Y E + N S A+D ++++IV+   FLPAL++KM+L L   DWE     A R L      ++A + Q L  LC DG   E   +L  L+  LD  EP N   ++R +  F R+CGR + +LQ    + ERA   A    E    +G  +++  + ++A+K++K A+  DES+++A+ G+I CQL EG +++A  QLEFL EIQ +I K+        E  YL A++   K     E+   L++++  HFS L    L  EY   LNPDFL+ I KEY+  CP +S   S  +   L+    +L+ V++ +PGL QA FL+A+  F SGD++ +++ L+ CL+ + A  + HLLMA ++L  GN+K +  +LE+ LSHNF++RE+PL+HL+K +   +  +  E+ ++L  A  L  V R  S   ++     L++++ +S++LELA +  L GE HE+AK++QDA  +F+G+ EE R+TI NADLA+ RGD E AL++LR++ P+  Y+++A++ MA+IYL +RK+K+LY +C++EL ++   P S +LLGDAYM IQ+P+ AI VYE+A +    D  LA+K+G ALVKTHNY +AI YY   +KSGQ + LR DL++LL+ L+ Y+  + VL + ++            +C    VLLA+V     + ++ +  L  A ++Q K+LKRV  E P+S+  +K+LA EIC +IA+  S +   E ++K+YKEAL Y E+  + +LELA+L + + DVE CQ  C  +L+ D  N                 SATLMMA+LM ++ D++ A+FH ++LL + PD++  L+ LID+LRR G+LE V  + +  E+ + ++    GYN+CKGL  WY G  ++ L+ FN AR D++W + AVYNM+EICLNPDN T+GG+V + LD   GNS  + E         S    ++TAE +L  L        ++   L     + +K K ++E+AL+ F E+   + +++ +L   A   M+LKQ+ +A+  L  I+K+NW    A+E EKS LLLADIYIQ      A D LK C+++NKS  KAYEY G + EKEQ ++ A+ +Y  AW + N+ +PTIGYKLAFNYLK ++++++ID C +VL + P YP+I+K+ILDKA
Sbjct:   15 ILYYCQEKYSSHVVDVSSEAQRKFSPDPIFTFLHAYGLLMQDQVLDAIQELEMLKERRDVSLCALMALVYAHKKRPNPDREIIQDLDGRVKEERKTASPKALYYAGMLLWLLGRNDKAREYVDRMIKISSGSKEGIVLKGWIDLRSNKDAYAKKSGKYFDEALKEK--SDIFALMGKVHYYEYRQNYSGALDTINQVIVSYPSFLPALVKKMKLLLTLQDWEQTVDAAQRLLQREKNNLEALRMQALHALCRDGDIAESVNQLSNLISNLDIQEPSNPELFYRMSLAFTRVCGRAEKILQHTHRMVERAFAQASSDSELATEMGYQLILMGRVKEAMKWYKTAMTLDESSVSALIGIIRCQLIEGHIEDAEQQLEFLTEIQQSIGKSG-------ELLYLRALLAVKKRRPPDEVTNLLNDTVDTHFSALQGLPLSVEYFEKLNPDFLLEIAKEYLALCPAKSPALSQPSSPQLQHAASVLDTVMKVVPGLLQAVFLMARVRFQSGDIDAAQSSLQHCLDQNPAHADAHLLMAQIHLIQGNYKLSSQSLELCLSHNFEIREHPLYHLIKAQAQRKMGQLQEAIQTLQMAMSLCAVKRTGSSAKRQSKRVELSSADCVSVFLELAEALWLNGEQHEAAKVMQDAINEFTGTPEELRVTIANADLALMRGDTELALSMLRNITPEQPYYIQAKEKMADIYLNHRKEKRLYVSCYRELVDKMPNPHSFLLLGDAYMNIQEPELAIEVYEQALKKNPKDGALASKIGKALVKTHNYVKAINYYEAALKSGQQNFLRYDLADLLMKLRQYERCEKVLQEALAHDPVIELPLLTEDC-RYLVLLAKVQSKVIKNDEALLSLQRARDVQAKVLKRVQLEQPDSVPAQKQLAAEICAEIAKHCSSQRGYERAVKFYKEALVYCENDSKVMLELAQLYLTLDDVEACQQQCSAILKNDPVN----------------ESATLMMADLMFRKQDYEQAVFHFQQLLERKPDNYPTLSRLIDLLRRAGKLEEVPRFLEMAEKHSSRAKFEPGYNYCKGLYLWYTGEPNDGLRHFNKARKDNDWGQNAVYNMIEICLNPDNETIGGEVFENLDGDMGNSTEKQE---------SEQLAVRTAEKLLKELKPQTPVGHVQLRILENYCCLATKQKANVERALNVFIEIANTEKDHVPSLLAMATAYMILKQTPRARNQLKRIAKMNWNIIDADEFEKSWLLLADIYIQSGKYDMAGDLLKRCLRHNKSCCKAYEYMGYIMEKEQSFRDAAMNYEMAWKYSNQTNPTIGYKLAFNYLKAKRHVDAIDVCHKVLDAHPNYPRIRKDILDKA 1315          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Zebrafish
Match: ttc21b (tetratricopeptide repeat domain 21B [Source:ZFIN;Acc:ZDB-GENE-031010-34])

HSP 1 Score: 94.3597 bits (233), Expect = 2.081e-21
Identity = 70/240 (29.17%), Postives = 117/240 (48.75%), Query Frame = 1
Query: 2440 VKSGQ-SALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENV 3156
            +KSGQ + LR DL++LL+ L+ Y+  + VL + ++            +C    VLLA+V     + ++ +  L  A ++Q K+LKRV  E P+S+  +K+LA EIC +IA+  S +   E ++K+YKEAL Y E+  + + +L                                                     M ++ D++ A+FH ++LL + PD++  L+ LID+LRR G+LE V
Sbjct:    3 LKSGQQNFLRYDLADLLMKLRQYERCEKVLQEALAHDPVIELPLLTEDC-RYLVLLAKVQSKVIKNDEALLSLQRARDVQAKVLKRVQLEQPDSVPAQKQLAAEICAEIAKHCSSQRGYERAVKFYKEALVYCENDSKMMADL-----------------------------------------------------MFRKQDYEQAVFHFQQLLERKPDNYPTLSRLIDLLRRAGKLEEV 188          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Zebrafish
Match: CU633479.6 (pep chromosome:GRCz11:24:40855741:40860603:-1 gene:ENSDARG00000116146.1 transcript:ENSDART00000188032.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CU633479.6)

HSP 1 Score: 50.8322 bits (120), Expect = 3.220e-7
Identity = 24/69 (34.78%), Postives = 40/69 (57.97%), Query Frame = 1
Query:  118 IREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMK 324
            +RE+YY  A+      LK Y N+P L+   A   + E   QE+++EL LL D P +++ + ++L+ A K
Sbjct:    1 MRERYYRHAINTAARSLKVYNNDPVLRFFKAFATLMEGHSQEALQELILLKDHPHLSLCSTVALIYAHK 69          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Xenopus
Match: TTC21B (tetratricopeptide repeat domain 21B [Source:NCBI gene;Acc:100490430])

HSP 1 Score: 1053.89 bits (2724), Expect = 0.000e+0
Identity = 564/1341 (42.06%), Postives = 862/1341 (64.28%), Query Frame = 1
Query:  106 ILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCP-QQSSNSNPL--ILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRM----VSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSG-QSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVS-GNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMIN---IESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            I Y+ +EKY+H      N+GLK YGN+P      A  M+ ED IQESIRELE + D+ +V++ +L++L+ A K++  PD+  IQE ++KM++LRK       +FAG+ L+   R+DKAREY+ R +K++  +KE + L  W+D+   +EA+ KKA K  +E      G +V +++GK  YLE++ N S+A++++++I+V    F+PAL++KM+LQL   DWE    TA R L  +S  ++A +   L  LC +G+  E S +LG+L++ LD++EP+N + Y+  +  F+R+C RN  +LQQ   L ERA+ +A +  E    LG   ++Q K R+A+K++K A++ DE++++A+ G+I CQL EG L++A  QLEFL EIQ +I K+        E  YL A++   K + Q E+I  L++ +  HFS L    LG +Y   LNPDFL+ IV+EY++FCP Q S+   P+  +L+    +LE +++  PGLQQA FL+AK  ++SGD++ ++  L+ CL+ + ++ + HLLM+ +YL   N K    +LE+ LS++F++R+ PL++L+K +   R  +  E+ K+L  A  LPG+R     V  K +KP    ++ S+R+SI+LEL  +HRL GE HE+ K+LQDA  +FSG+ EE R+ I NA+LA+  GD+E AL++LR+V P+  YFV+A++ MAEIYLK+RKDKKLY +C+++L ++  +  + +LLGDAYM IQ+P+KAI +YE+A +    D  LA+K+G AL+KTHNY++AI YY   +KSG QS LR DL+ LL+ L+ YD A+ VL + + + +  N     ++     VLLA++Y    + +  I  L  A  +Q ++LKR   E P+++  +K LA EIC +IA+  + + D E +IK+YKEAL Y E+  + +LELA L +   D E+CQ  C  LL++D  N                 +AT+MMA+LM ++ D++ A+FH ++LL + PD++  L+ LID+LRR G+LE +  + +  E+ + ++ L  G+++C GL  WY G+ ++AL+ FN AR DS+W + A+YNM+EICLNPDN TVGG+V D LD   GNS  + E         SV   ++TAE +L  L     +   Q  LR M N   + +K K ++E+AL+ F EV   + ++I AL G A   M+LKQ+ KA+  L  ISK+NW    AEE EK  LLLADIYIQ      A + LK C+++N+S  KAYEY G + EKEQ Y+ A+++Y  AW + N+  PT+GYKLAFNYLK ++Y+++ID C +VL+  P YPKI+K+ILDK+
Sbjct:   14 INYYCQEKYFHHVQMCANEGLKDYGNDPVFLFFRAFGMLMEDEIQESIRELEAIKDKTDVSLCSLMALIYAHKKSSHPDREAIQELDSKMKELRKTAGHTGLYFAGLFLWHVGRHDKAREYIDRMIKISNGSKEGLVLKAWLDLTCGREAYAKKALKYLEEG--LADGTDVFAMLGKAHYLEMRQNYSEALEVINRILVHCPGFIPALIKKMKLQLALQDWEQTVETALRLLQKDSHNLEALRMLALHYLCREGNVHEASTKLGDLIRALDQFEPQNAHLYYNMSLAFSRMCERNPLILQQTQTLVERAVNMAANDAEIATELGYQFILQGKVREALKWYKTAMSLDETSVSALTGIIRCQLIEGQLQDADQQLEFLMEIQQSIGKSG-------ELSYLRAVLAMKKQKKQEEVIHLLNDVLDTHFSSLHGLPLGIQYFEKLNPDFLLEIVREYLSFCPTQPSTPGQPVSPLLRHCASVLEAIMKTAPGLQQAAFLIAKVKYLSGDIDAAQNSLQHCLDQNPSYADAHLLMSQIYLFQDNLKLCSQSLELCLSYSFEIRDYPLYNLIKAQTQKRMGEVQEAIKTLQIAMSLPGMRRAGTSVKSKGKKPE---VSPSDRVSIFLELVDAHRLNGEQHEATKVLQDAIIEFSGTPEELRLMIANAELALVHGDVEEALSMLRNVSPEQPYFVQAKEKMAEIYLKHRKDKKLYVSCYRDLVDKLPSSHTYLLLGDAYMNIQEPEKAIEIYEQALKKNPKDGTLASKIGKALIKTHNYSKAISYYEAALKSGQQSFLRYDLAELLLRLKQYDKAEKVLQQAL-DHEAVNELSSLMDDSRYHVLLAKIYSKMEKIDDSIVSLQRARELQARVLKRTQMEQPDAVPAQKALAAEICAEIAKHSTVQRDYEKAIKFYKEALVYCETDNKVMLELAHLYLAQDDTESCQQQCALLLKIDQDN----------------EAATMMMADLMFRKQDYEQAVFHFQQLLERKPDNYATLSRLIDLLRRAGKLEEIPKFLELAEKNSPRAKLEPGFHYCNGLYLWYTGDPNDALRHFNKARKDSDWGQNAIYNMIEICLNPDNETVGGEVFDNLDGDVGNSTEKQE---------SVQLAVRTAEKLLKELKPQTLQGHIQ--LRIMENYCLMATKQKANVERALNTFTEVATAEKDHIPALLGMATAYMILKQTPKARNQLKRISKMNWNPIDAEEFEKGWLLLADIYIQSGKYDMAGELLKRCLRHNRSCCKAYEYTGYIMEKEQAYKDAASNYEMAWKYGNQTSPTVGYKLAFNYLKAKRYVDAIDVCHKVLELHPNYPKIRKDILDKS 1314          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Xenopus
Match: TTC21B (tetratricopeptide repeat domain 21B [Source:NCBI gene;Acc:100490430])

HSP 1 Score: 1053.51 bits (2723), Expect = 0.000e+0
Identity = 564/1341 (42.06%), Postives = 862/1341 (64.28%), Query Frame = 1
Query:  106 ILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQ-SSNSNPL--ILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRM----VSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSG-QSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVS-GNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMIN---IESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            I Y+ +EKY+H      N+GLK YGN+P      A  M+ ED IQESIRELE + D+ +V++ +L++L+ A K++  PD+  IQE ++KM++LRK       +FAG+ L+   R+DKAREY+ R +K++  +KE + L  W+D+   +EA+ KKA K  +E      G +V +++GK  YLE++ N S+A++++++I+V    F+PAL++KM+LQL   DWE    TA R L  +S  ++A +   L  LC +G+  E S +LG+L++ LD++EP+N + Y+  +  F+R+C RN  +LQQ   L ERA+ +A +  E    LG   ++Q K R+A+K++K A++ DE++++A+ G+I CQL EG L++A  QLEFL EIQ +I K+        E  YL A++   K + Q E+I  L++ +  HFS L    LG +Y   LNPDFL+ IV+EY++FCP Q S+   P+  +L+    +LE +++  PGLQQA FL+AK  ++SGD++ ++  L+ CL+ + ++ + HLLM+ +YL   N K    +LE+ LS++F++R+ PL++L+K +   R  +  E+ K+L  A  LPG+R     V  K +KP    ++ S+R+SI+LEL  +HRL GE HE+ K+LQDA  +FSG+ EE R+ I NA+LA+  GD+E AL++LR+V P+  YFV+A++ MAEIYLK+RKDKKLY +C+++L ++  +  + +LLGDAYM IQ+P+KAI +YE+A +    D  LA+K+G AL+KTHNY++AI YY   +KSG QS LR DL+ LL+ L+ YD A+ VL + + + +  N     ++     VLLA++Y    + +  I  L  A  +Q ++LKR   E P+++  +K LA EIC +IA+  + + D E +IK+YKEAL Y E+  + +LELA L +   D E+CQ  C  LL++D  N                 +AT+MMA+LM ++ D++ A+FH ++LL + PD++  L+ LID+LRR G+LE +  + +  E+ + ++ L  G+++C GL  WY G+ ++AL+ FN AR DS+W + A+YNM+EICLNPDN TVGG+V D LD   GNS  + E         SV   ++TAE +L  L     +   Q  LR M N   + +K K ++E+AL+ F EV   + ++I AL G A   M+LKQ+ KA+  L  ISK+NW    AEE EK  LLLADIYIQ      A + LK C+++N+S  KAYEY G + EKEQ Y+ A+++Y  AW + N+  PT+GYKLAFNYLK ++Y+++ID C +VL+  P YPKI+K+ILDK+
Sbjct:    9 INYYCQEKYFHHVQMCANEGLKDYGNDPVFLFFRAFGMLMEDEIQESIRELEAIKDKTDVSLCSLMALIYAHKKSSHPDREAIQELDSKMKELRKTAGHTGLYFAGLFLWHVGRHDKAREYIDRMIKISNGSKEGLVLKAWLDLTCGREAYAKKALKYLEEG--LADGTDVFAMLGKAHYLEMRQNYSEALEVINRILVHCPGFIPALIKKMKLQLALQDWEQTVETALRLLQKDSHNLEALRMLALHYLCREGNVHEASTKLGDLIRALDQFEPQNAHLYYNMSLAFSRMCERNPLILQQTQTLVERAVNMAANDAEIATELGYQFILQGKVREALKWYKTAMSLDETSVSALTGIIRCQLIEGQLQDADQQLEFLMEIQQSIGKSG-------ELSYLRAVLAMKKQKKQEEVIHLLNDVLDTHFSSLHGLPLGIQYFEKLNPDFLLEIVREYLSFCPTQPSTPGQPVSPLLRHCASVLEAIMKTAPGLQQAAFLIAKVKYLSGDIDAAQNSLQHCLDQNPSYADAHLLMSQIYLFQDNLKLCSQSLELCLSYSFEIRDYPLYNLIKAQTQKRMGEVQEAIKTLQIAMSLPGMRRAGTSVKSKGKKPE---VSPSDRVSIFLELVDAHRLNGEQHEATKVLQDAIIEFSGTPEELRLMIANAELALVHGDVEEALSMLRNVSPEQPYFVQAKEKMAEIYLKHRKDKKLYVSCYRDLVDKLPSSHTYLLLGDAYMNIQEPEKAIEIYEQALKKNPKDGTLASKIGKALIKTHNYSKAISYYEAALKSGQQSFLRYDLAELLLRLKQYDKAEKVLQQAL-DHEAVNELSSLMDDSRYHVLLAKIYSKMEKIDDSIVSLQRARELQARVLKRTQMEQPDAVPAQKALAAEICAEIAKHSTVQRDYEKAIKFYKEALVYCETDNKVMLELAHLYLAQDDTESCQQQCALLLKIDQDN----------------EAATMMMADLMFRKQDYEQAVFHFQQLLERKPDNYATLSRLIDLLRRAGKLEEIPKFLELAEKNSPRAKLEPGFHYCNGLYLWYTGDPNDALRHFNKARKDSDWGQNAIYNMIEICLNPDNETVGGEVFDNLDGDVGNSTEKQE---------SVQLAVRTAEKLLKELKPQTLQGHIQ--LRIMENYCLMATKQKANVERALNTFTEVATAEKDHIPALLGMATAYMILKQTPKARNQLKRISKMNWNPIDAEEFEKGWLLLADIYIQSGKYDMAGELLKRCLRHNRSCCKAYEYTGYIMEKEQAYKDAASNYEMAWKYGNQTSPTVGYKLAFNYLKAKRYVDAIDVCHKVLELHPNYPKIRKDILDKS 1309          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Xenopus
Match: TTC21B (tetratricopeptide repeat domain 21B [Source:NCBI gene;Acc:100490430])

HSP 1 Score: 1012.29 bits (2616), Expect = 0.000e+0
Identity = 557/1343 (41.47%), Postives = 847/1343 (63.07%), Query Frame = 1
Query:  106 ILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFE--DRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCP-QQSSNSNPL--ILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRM----VSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSGQ-SALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVS-GNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMIN---IESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            I Y+ +EKY+H      N+GLK YGN+P      A  M+ E  D IQESIRELE + D+ +V++ +L++L+ A K++  PD+  IQE ++KM++LRK       +FAG+ L+   R+DKAREY+ R +K++  +KE + L  W+D+   +EA+ KKA K  +E      G +V +++GK  YLE++ N S+A++++++I+V    F+PAL++KM+LQL   DWE    TA R L  +S  ++A +   L  LC +G+  E S +LG+L++ LD++EP+N + Y+  +  F+R+C RN  +LQQ   L ERA+ +A +  E    LG   ++Q K R+A+K++K A++ DE++++A+ G+I CQL EG L++A  QLEFL EIQ +I K+        E  YL A++   K + Q E+I  L++ +  HFS L    LG +Y   LNPDFL+ IV+EY++FCP Q S+   P+  +L+    +LE +++  PGLQQA FL+AK  ++SGD++ ++  L+ CL+ + ++ + HLLM+ +YL   N K    +LE+ LS++F+VR  PL++L+K +   R  +  E+ K+L  A  LPG+R     V  K +KP  S    S+R+SI+LEL  +HRL GE HE+ K+LQDA  +FSG+ EE R+ I NA+LA+  GD+E AL++LR+V P+  YFV+A++ MAEIYLK+RKDKKLY +C+++L ++  +  + +LLGDAYM IQ+P+KAI +YE+A +    D  LA+K+G AL+KTHNY++AI YY   +KSGQ S LR DL+ LL+ L+ YD A+ VL + + + +  N     ++     VLLA++Y    + +  I  L  A  +Q ++LKR   E P+++  +K LA EIC +IA+  + + D E +IK+YKEAL Y E+  + ++                +    L     T P  L  N K        S   MMA+LM ++ D++ A+FH ++LL + PD++  L+ LID+LRR G+LE +  + +  E+ + ++ L  G+++C GL  WY G+ ++AL+ FN AR DS+W + A+YNM+EICLNPDN TVGG+V D LD   GNS  + E         SV   ++TAE +L  L     +   Q  LR M N   + +K K ++E+AL+ F EV   + ++I AL G A   M+LKQ+ KA+  L  ISK+NW    AEE EK  LLLADIYIQ      A + LK C+++N+S  KAYEY G + EKEQ Y+ A+++Y  AW + N+  PT+GYKLAFNYLK ++Y+++ID C +VL+  P YPKI+K+ILDK+
Sbjct:   13 INYYCQEKYFHHVQMCANEGLKDYGNDPVFLFFRAFGMLMEGKDEIQESIRELEAIKDKTDVSLCSLMALIYAHKKSSHPDREAIQELDSKMKELRKTAGHTGLYFAGLFLWHVGRHDKAREYIDRMIKISNGSKEGLVLKAWLDLTCGREAYAKKALKYLEEG--LADGTDVFAMLGKAHYLEMRQNYSEALEVINRILVHCPGFIPALIKKMKLQLALQDWEQTVETALRLLQKDSHNLEALRMLALHYLCREGNVHEASTKLGDLIRALDQFEPQNAHLYYNMSLAFSRMCERNPLILQQTQTLVERAVNMAANDAEIATELGYQFILQGKVREALKWYKTAMSLDETSVSALTGIIRCQLIEGQLQDADQQLEFLMEIQQSIGKSG-------ELSYLRAVLAMKKQKKQEEVIHLLNDVLDTHFSSLHGLPLGIQYFEKLNPDFLLEIVREYLSFCPTQPSTPGQPVSPLLRHCASVLEAIMKTAPGLQQAAFLIAKVKYLSGDIDAAQNSLQHCLDQNPSYADAHLLMSQIYLFQDNLKLCSQSLELCLSYSFEVRYYPLYNLIKAQTQKRMGEVQEAIKTLQIAMSLPGMRRAGTSVKSKGKKPEVSP---SDRVSIFLELVDAHRLNGEQHEATKVLQDAIIEFSGTPEELRLMIANAELALVHGDVEEALSMLRNVSPEQPYFVQAKEKMAEIYLKHRKDKKLYVSCYRDLVDKLPSSHTYLLLGDAYMNIQEPEKAIEIYEQALKKNPKDGTLASKIGKALIKTHNYSKAISYYEAALKSGQQSFLRYDLAELLLRLKQYDKAEKVLQQAL-DHEAVNELSSLMDDSRYHVLLAKIYSKMEKIDDSIVSLQRARELQARVLKRTQMEQPDAVPAQKALAAEICAEIAKHSTVQRDYEKAIKFYKEALVYCETDNKVVVRF--------------YFIFNLY----TKPTLLLRNVK--------SPRNMMADLMFRKQDYEQAVFHFQQLLERKPDNYATLSRLIDLLRRAGKLEEIPKFLELAEKNSPRAKLEPGFHYCNGLYLWYTGDPNDALRHFNKARKDSDWGQNAIYNMIEICLNPDNETVGGEVFDNLDGDVGNSTEKQE---------SVQLAVRTAEKLLKELKPQTLQGHIQ--LRIMENYCLMATKQKANVERALNTFTEVATAEKDHIPALLGMATAYMILKQTPKARNQLKRISKMNWNPIDAEEFEKGWLLLADIYIQSGKYDMAGELLKRCLRHNRSCCKAYEYTGYIMEKEQAYKDAASNYEMAWKYGNQTSPTVGYKLAFNYLKAKRYVDAIDVCHKVLELHPNYPKIRKDILDKS 1305          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Xenopus
Match: TTC21B (tetratricopeptide repeat domain 21B [Source:NCBI gene;Acc:100490430])

HSP 1 Score: 1004.97 bits (2597), Expect = 0.000e+0
Identity = 558/1341 (41.61%), Postives = 845/1341 (63.01%), Query Frame = 1
Query:  106 ILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQ-SSNSNPL--ILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRM----VSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSGQ-SALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVS-GNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMIN---IESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            I Y+ +EKY+H      N+GLK YGN+P      A  M+ E +  ESIRELE + D+ +V++ +L++L+ A K++  PD+  IQE ++KM++LRK       +FAG+ L+   R+DKAREY+ R +K++  +KE + L  W+D+   +EA+ KKA K  +E      G +V +++GK  YLE++ N S+A++++++I+V    F+PAL++KM+LQL   DWE    TA R L  +S  ++A +   L  LC +G+  E++ RL      L+    KN   Y    + F   C RN  +LQQ   L ERA+ +A +  E    LG   ++Q K R+A+K++K A++ DE++++A+ G+I CQL EG L++A  QLEFL EIQ +I K+        E  YL A++   K + Q E+I  L++ +  HFS L    LG +Y   LNPDFL+ IV+EY++FCP Q S+   P+  +L+    +LE +++  PGLQQA FL+AK  ++SGD++ ++  L+ CL+ + ++ + HLLM+ +YL   N K    +LE+ LS++F+VR  PL++L+K +   R  +  E+ K+L  A  LPG+R     V  K +KP  S    S+R+SI+LEL  +HRL GE HE+ K+LQDA  +FSG+ EE R+ I NA+LA+  GD+E AL++LR+V P+  YFV+A++ MAEIYLK+RKDKKLY +C+++L ++  +  + +LLGDAYM IQ+P+KAI +YE+A +    D  LA+K+G AL+KTHNY++AI YY   +KSGQ S LR DL+ LL+ L+ YD A+ VL + + + +  N     ++     VLLA++Y    + +  I  L  A  +Q ++LKR   E P+++  +K LA EIC +IA+  + + D E +IK+YKEAL Y E+  + +LELA L +   D E+CQ  C  LL++D  N                 +AT+MMA+LM ++ D++ A+FH ++LL + PD++  L+ LID+LRR G+LE +  + +  E+ + ++ L  G+++C GL  WY G+ ++AL+ FN AR DS+W + A+YNM+EICLNPDN TVGG+V D LD   GNS  + E         SV   ++TAE +L  L     +   Q  LR M N   + +K K ++E+AL+ F EV   + ++I AL G A   M+LKQ+ KA+  L  ISK+NW    AEE EK  LLLADIYIQ      A + LK C+++N+S  KAYEY G + EKEQ Y+ A+++Y  AW + N+  PT+GYKLAFNYLK ++Y+++ID C +VL+  P YPKI+K+ILDK+
Sbjct:   13 INYYCQEKYFHHVQMCANEGLKDYGNDPVFLFFRAFGMLMEGK--ESIRELEAIKDKTDVSLCSLMALIYAHKKSSHPDREAIQELDSKMKELRKTAGHTGLYFAGLFLWHVGRHDKAREYIDRMIKISNGSKEGLVLKAWLDLTCGREAYAKKALKYLEEG--LADGTDVFAMLGKAHYLEMRQNYSEALEVINRILVHCPGFIPALIKKMKLQLALQDWEQTVETALRLLQKDSHNLEALRMLALHYLCREGNVHEVAFRL------LEGNLQKNNSLY---TSFFQ--CERNPLILQQTQTLVERAVNMAANDAEIATELGYQFILQGKVREALKWYKTAMSLDETSVSALTGIIRCQLIEGQLQDADQQLEFLMEIQQSIGKSG-------ELSYLRAVLAMKKQKKQEEVIHLLNDVLDTHFSSLHGLPLGIQYFEKLNPDFLLEIVREYLSFCPTQPSTPGQPVSPLLRHCASVLEAIMKTAPGLQQAAFLIAKVKYLSGDIDAAQNSLQHCLDQNPSYADAHLLMSQIYLFQDNLKLCSQSLELCLSYSFEVRYYPLYNLIKAQTQKRMGEVQEAIKTLQIAMSLPGMRRAGTSVKSKGKKPEVSP---SDRVSIFLELVDAHRLNGEQHEATKVLQDAIIEFSGTPEELRLMIANAELALVHGDVEEALSMLRNVSPEQPYFVQAKEKMAEIYLKHRKDKKLYVSCYRDLVDKLPSSHTYLLLGDAYMNIQEPEKAIEIYEQALKKNPKDGTLASKIGKALIKTHNYSKAISYYEAALKSGQQSFLRYDLAELLLRLKQYDKAEKVLQQAL-DHEAVNELSSLMDDSRYHVLLAKIYSKMEKIDDSIVSLQRARELQARVLKRTQMEQPDAVPAQKALAAEICAEIAKHSTVQRDYEKAIKFYKEALVYCETDNKVMLELAHLYLAQDDTESCQQQCALLLKIDQDN----------------EAATMMMADLMFRKQDYEQAVFHFQQLLERKPDNYATLSRLIDLLRRAGKLEEIPKFLELAEKNSPRAKLEPGFHYCNGLYLWYTGDPNDALRHFNKARKDSDWGQNAIYNMIEICLNPDNETVGGEVFDNLDGDVGNSTEKQE---------SVQLAVRTAEKLLKELKPQTLQGHIQ--LRIMENYCLMATKQKANVERALNTFTEVATAEKDHIPALLGMATAYMILKQTPKARNQLKRISKMNWNPIDAEEFEKGWLLLADIYIQSGKYDMAGELLKRCLRHNRSCCKAYEYTGYIMEKEQAYKDAASNYEMAWKYGNQTSPTVGYKLAFNYLKAKRYVDAIDVCHKVLELHPNYPKIRKDILDKS 1300          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Xenopus
Match: TTC21B (tetratricopeptide repeat domain 21B [Source:NCBI gene;Acc:100490430])

HSP 1 Score: 996.882 bits (2576), Expect = 0.000e+0
Identity = 548/1341 (40.87%), Postives = 839/1341 (62.57%), Query Frame = 1
Query:  106 ILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSE-RLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNS--NPLILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRM----VSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSG-QSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVS-GNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMIN---IESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            I Y+ +EKY+H      N+GLK YGN+P      A  M+ ED IQESIRELE + D+ +V++ +L++L+ A K++  PD+  IQE ++KM++LRK       +FAG+ L+   R+DKAREY+ R +K++  +KE + L  W+D+   +EA+ KKA K  +E      G +V +++GK  YLE++ N S+A++++++I+V    F+PAL++KM+LQL   DWE    TA R L  +S  ++A +   L  LC +G+  E+    L  L++ LD++EP+N + Y+  +  F+R+C RN  +LQQ   L ERA+ +A +  E    LG   ++Q K R+A+K++K A++ DE++++A+ G+I CQL EG L++A  QLEFL EIQ +I K+        E  YL A++   K + Q E+I  L++ +  HFS L    LG +Y   LNPDFL+ IV+EY++FCP Q      +PL L+    +LE +++  PGLQQA FL+AK  ++SGD++ ++  L+ CL+ + ++ + HLLM+ +YL   N K    +LE+ LS++F++R+ PL++L+K +   R  +  E+ K+L  A  LPG+R     V  K +KP  S    S+R+SI+LEL  +HRL GE HE+ K+LQDA  +FSG+ EE R+ I NA+LA+  GD+E AL++LR+V P+  YFV+A++ MAEIYLK+RKDKKLY +C+++L ++  +  + +LLGDAYM IQ+P+KAI +YE+A +    D  LA+K+G AL+KTHNY++AI YY   +KSG QS LR DL+ LL+ L+ YD A+ VL + + + +  N     ++     VLLA++Y    + +  I  L  A  +Q ++LKR   E P+++  +K LA EIC +IA+  + + D E +IK+YKEAL Y E+  + ++                + C+    +                         MMA+LM ++ D++ A+FH ++LL + PD++  L+ LID+LRR G+LE +  + +  E+ + ++ L  G+++C GL  WY G+ ++AL+ FN AR DS+W + A+YNM+EICLNPDN TVGG+V D LD   GNS  + E         SV   ++TAE +L  L     +   Q  LR M N   + +K K ++E+AL+ F EV   + ++I AL G A   M+LKQ+ KA+  L  ISK+NW    AEE EK  LLLADIYIQ      A + LK C+++N+S  KAYEY G + EKEQ Y+ A+++Y  AW + N+  PT+GYKLAFNYLK ++Y+++ID C +VL+  P YPKI+K+ILDK+
Sbjct:   15 INYYCQEKYFHHVQMCANEGLKDYGNDPVFLFFRAFGMLMEDEIQESIRELEAIKDKTDVSLCSLMALIYAHKKSSHPDREAIQELDSKMKELRKTAGHTGLYFAGLFLWHVGRHDKAREYIDRMIKISNGSKEGLVLKAWLDLTCGREAYAKKALKYLEEG--LADGTDVFAMLGKAHYLEMRQNYSEALEVINRILVHCPGFIPALIKKMKLQLALQDWEQTVETALRLLQKDSHNLEALRMLALHYLCREGNVHEVGVIVLKNLIRALDQFEPQNAHLYYNMSLAFSRMCERNPLILQQTQTLVERAVNMAANDAEIATELGYQFILQGKVREALKWYKTAMSLDETSVSALTGIIRCQLIEGQLQDADQQLEFLMEIQQSIGKSG-------ELSYLRAVLAMKKQKKQEEVIHLLNDVLDTHFSSLHGLPLGIQYFEKLNPDFLLEIVREYLSFCPTQVRGQPVSPL-LRHCASVLEAIMKTAPGLQQAAFLIAKVKYLSGDIDAAQNSLQHCLDQNPSYADAHLLMSQIYLFQDNLKLCSQSLELCLSYSFEIRDYPLYNLIKAQTQKRMGEVQEAIKTLQIAMSLPGMRRAGTSVKSKGKKPEVSP---SDRVSIFLELVDAHRLNGEQHEATKVLQDAIIEFSGTPEELRLMIANAELALVHGDVEEALSMLRNVSPEQPYFVQAKEKMAEIYLKHRKDKKLYVSCYRDLVDKLPSSHTYLLLGDAYMNIQEPEKAIEIYEQALKKNPKDGTLASKIGKALIKTHNYSKAISYYEAALKSGQQSFLRYDLAELLLRLKQYDKAEKVLQQAL-DHEAVNELSSLMDDSRYHVLLAKIYSKMEKIDDSIVSLQRARELQARVLKRTQMEQPDAVPAQKALAAEICAEIAKHSTVQRDYEKAIKFYKEALVYCETDNKVVVH--------------NYECIVYFVI-----------------------LQMMADLMFRKQDYEQAVFHFQQLLERKPDNYATLSRLIDLLRRAGKLEEIPKFLELAEKNSPRAKLEPGFHYCNGLYLWYTGDPNDALRHFNKARKDSDWGQNAIYNMIEICLNPDNETVGGEVFDNLDGDVGNSTEKQE---------SVQLAVRTAEKLLKELKPQTLQGHIQ--LRIMENYCLMATKQKANVERALNTFTEVATAEKDHIPALLGMATAYMILKQTPKARNQLKRISKMNWNPIDAEEFEKGWLLLADIYIQSGKYDMAGELLKRCLRHNRSCCKAYEYTGYIMEKEQAYKDAASNYEMAWKYGNQTSPTVGYKLAFNYLKAKRYVDAIDVCHKVLELHPNYPKIRKDILDKS 1293          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Mouse
Match: Ttc21b (tetratricopeptide repeat domain 21B [Source:MGI Symbol;Acc:MGI:1920918])

HSP 1 Score: 991.875 bits (2563), Expect = 0.000e+0
Identity = 552/1340 (41.19%), Postives = 826/1340 (61.64%), Query Frame = 1
Query:   94 LMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCP-QQSSNSNPL--ILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSG-QSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMIN---IESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            L T I Y+ +E+YYH  +   ++G+K+Y ++P  +  +A   + E + QE++RE E + ++ +V++ +L++L+   K +P PD+  I E + KM++ RK     + + AG+ L+   R+DKAREY+ R  KM   + E   L  W+D+   KE + KKA + F+E      GN++ +L+GKV  LEI+ N S A++ VS+IIV    FLPA  +KM+LQL   DW+    TA R L+ ++  V+A +   L  LC +G  E+ + +L  L   LD  EP+N   +++    F+R CGRN+ +LQ+     E+A  L P   E    LG  M++Q K ++A K+++ A+  +ESN++A+ G+I CQL EG L++A  QLEF  E Q ++ K++       E  YL A++   KN  Q E+I  L++ +  HFS L +  LG +Y   LNPDFL+ +V EY+N CP Q +    PL  +L++ + +LE ++R +PGL QA FL+AK  ++SGD E +   L+ CLE   ++ E HLLMA VYL     K    +LE+ LS+NF VRE PL+HL+K +   +  +  E+ K+L  A  LPG+R     S+  + + +  S RLSI+LEL   HRL GE HE+AK+LQDA  +FSG+ EE R+TI NADLA+ +GD + AL++LR+V  +  YF+EA++ MA+IYLK+RK+K LY  C++E+AER  +P S +LLGDAYM IQ+P++AI  YE+A      D  LA K+G ALVKTHNY++AI YY   +KSG Q+ L  DL+ LL+ L+LY+ A+ VL   ++ +  S      ++     VLLA+VY         I+ L  A  +Q +ILKRV  E P+++  +K  A EIC +IA+  + + D E +I +Y+EAL + E+  + +LELA+L +   D++     C  LLQ D  N                  AT++MA+LM ++ D++ A++HL++LL + PD+F  L+ LID+LRR G+LE+V  +F   E+ N ++ L  G+ +CKGL  WY G  ++AL+ FN AR DS+W + A+YNM+EICLNPDN T+GG+V + L+  G+  T  E      K  SV   ++TAE +L  L     +   Q  LR M N   + +K K S+E+AL+ F E+  ++ ++I AL G A   M+LKQ+ KA+  L  I+K+ W    AE++EKS LLLADIYIQ      A + LK C+ +N+S  KAYEY G + EKEQ Y  A+ +Y  AW   N+ +P +GYKLAFNYLK ++Y+++ID C QVL++ P YPKI+K+ILDKA
Sbjct:    6 LKTLINYYCQERYYHHVLLVASEGMKKYSSDPVFRFYHAYGTLMEGKAQEALREFEAIKNKQDVSLCSLMALMYVHKMSPNPDREAILELDTKMKEQRKEAGRKALYHAGLFLWHIGRHDKAREYIDRMSKMPHDSNEGPILKAWLDITRGKEPYAKKALRYFEEG--LQDGNDIFALLGKVLCLEIRQNYSGALETVSQIIVNFPSFLPAFEKKMKLQLALQDWDQTVETAQRLLLQDNHNVEALRMLALYYLCREGDVEKAATKLENLGNALDVMEPQNAQLFYKITLAFSRTCGRNQLILQKVQSFLEKAFSLTPQQAEIATELGYQMILQGKVKEAWKWYRTAMTLNESNISAVTGLIRCQLIEGQLQDADQQLEFFSEFQQSMGKSA-------ELMYLHAVLATKKNNRQDEVINLLNDVVNTHFSHLEDLPLGIQYFEKLNPDFLLEVVTEYLNLCPIQPAGPGQPLSPVLRRCSSVLETIIRSVPGLPQAVFLMAKVKYLSGDTEAAYNNLQHCLEHSPSYAEAHLLMAQVYLSQDKVKLCSQSLELCLSYNFNVREYPLYHLIKAQSQKKMGEVAEAIKTLHMAMNLPGMRRSRASSKSKHRTEVDASHRLSIFLELVEVHRLNGEQHEAAKVLQDAIHEFSGTCEELRVTIANADLALAQGDTDRALSMLRNVTTEQPYFIEAKEKMADIYLKHRKEKMLYITCYREIAERMPSPRSFLLLGDAYMNIQEPEEAIVAYEQALNQNPKDGTLARKIGKALVKTHNYSKAITYYEAALKSGQQNCLCYDLAELLLRLKLYEKAEKVLQHSLAHEPVSELSALMVDGRSQ-VLLAKVYSKMERPSDAIAALQQARELQARILKRVQMEQPDAVPSQKHFAAEICAEIAKHSAAQRDYEKAITFYREALVHCETDSKIMLELAQLYLAQEDLDASLRHCALLLQRDQDN----------------EPATMLMADLMFRKQDYEQAVYHLQQLLDRKPDNFMTLSRLIDLLRRCGKLEDVPRFFLMAEKHNSRTKLEPGFQYCKGLHFWYTGEPNDALRHFNKARKDSDWGQNALYNMIEICLNPDNETIGGEVFENLN--GDLGTSPE------KQESVQLAVRTAEKLLKELKPQTVQGRLQ--LRIMENCCLMATKQKSSVEQALNTFTEIAASEKDHIPALLGMATAYMILKQTPKARNQLKRIAKMPWNPIEAEDLEKSWLLLADIYIQSAKYDMAEELLKRCLCHNRSCCKAYEYMGYIMEKEQAYTDAAFNYEMAWKHSNQTNPAVGYKLAFNYLKAKRYVDAIDVCHQVLEAHPTYPKIRKDILDKA 1309          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Mouse
Match: Ttc21b (tetratricopeptide repeat domain 21B [Source:MGI Symbol;Acc:MGI:1920918])

HSP 1 Score: 929.858 bits (2402), Expect = 0.000e+0
Identity = 522/1299 (40.18%), Postives = 790/1299 (60.82%), Query Frame = 1
Query:   94 LMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCP-QQSSNSNPL--ILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSG-QSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMIN---IESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIG 3969
            L T I Y+ +E+YYH  +   ++G+K+Y ++P  +  +A   + E + QE++RE E + ++ +V++ +L++L+   K +P PD+  I E + KM++ RK     + + AG+ L+   R+DKAREY+ R  KM   + E   L  W+D+   KE + KKA + F+E      GN++ +L+GKV  LEI+ N S A++ VS+IIV    FLPA  +KM+LQL   DW+    TA R L+ ++  V+A +   L  LC +G  E+ + +L  L   LD  EP+N   +++    F+R CGRN+ +LQ+     E+A  L P   E    LG  M++Q K ++A K+++ A+  +ESN++A+ G+I CQL EG L++A  QLEF  E Q ++ K++       E  YL A++   KN  Q E+I  L++ +  HFS L +  LG +Y   LNPDFL+ +V EY+N CP Q +    PL  +L++ + +LE ++R +PGL QA FL+AK  ++SGD E +   L+ CLE   ++ E HLLMA VYL     K    +LE+ LS+NF VRE PL+HL+K +   +  +  E+ K+L  A  LPG+R     S+  + + +  S RLSI+LEL   HRL GE HE+AK+LQDA  +FSG+ EE R+TI NADLA+ +GD + AL++LR+V  +  YF+EA++ MA+IYLK+RK+K LY  C++E+AER  +P S +LLGDAYM IQ+P++AI  YE+A      D  LA K+G ALVKTHNY++AI YY   +KSG Q+ L  DL+ LL+ L+LY+ A+ VL   ++ +  S      ++     VLLA+VY         I+ L  A  +Q +ILKRV  E P+++  +K  A EIC +IA+  + + D E +I +Y+EAL + E+  + +LELA+L +   D++     C  LLQ D  N                  AT++MA+LM ++ D++ A++HL++LL + PD+F  L+ LID+LRR G+LE+V  +F   E+ N ++ L  G+ +CKGL  WY G  ++AL+ FN AR DS+W + A+YNM+EICLNPDN T+GG+V + L+         ++  + +K  SV   ++TAE +L  L     +   Q  LR M N   + +K K S+E+AL+ F E+  ++ ++I AL G A   M+LKQ+ KA+  L  I+K+ W    AE++EKS LLLADIYIQ      A + LK C+ +N+S  KAYEY G + EKEQ Y  A+ +Y  AW   N+ +P +G
Sbjct:    6 LKTLINYYCQERYYHHVLLVASEGMKKYSSDPVFRFYHAYGTLMEGKAQEALREFEAIKNKQDVSLCSLMALMYVHKMSPNPDREAILELDTKMKEQRKEAGRKALYHAGLFLWHIGRHDKAREYIDRMSKMPHDSNEGPILKAWLDITRGKEPYAKKALRYFEEG--LQDGNDIFALLGKVLCLEIRQNYSGALETVSQIIVNFPSFLPAFEKKMKLQLALQDWDQTVETAQRLLLQDNHNVEALRMLALYYLCREGDVEKAATKLENLGNALDVMEPQNAQLFYKITLAFSRTCGRNQLILQKVQSFLEKAFSLTPQQAEIATELGYQMILQGKVKEAWKWYRTAMTLNESNISAVTGLIRCQLIEGQLQDADQQLEFFSEFQQSMGKSA-------ELMYLHAVLATKKNNRQDEVINLLNDVVNTHFSHLEDLPLGIQYFEKLNPDFLLEVVTEYLNLCPIQPAGPGQPLSPVLRRCSSVLETIIRSVPGLPQAVFLMAKVKYLSGDTEAAYNNLQHCLEHSPSYAEAHLLMAQVYLSQDKVKLCSQSLELCLSYNFNVREYPLYHLIKAQSQKKMGEVAEAIKTLHMAMNLPGMRRSRASSKSKHRTEVDASHRLSIFLELVEVHRLNGEQHEAAKVLQDAIHEFSGTCEELRVTIANADLALAQGDTDRALSMLRNVTTEQPYFIEAKEKMADIYLKHRKEKMLYITCYREIAERMPSPRSFLLLGDAYMNIQEPEEAIVAYEQALNQNPKDGTLARKIGKALVKTHNYSKAITYYEAALKSGQQNCLCYDLAELLLRLKLYEKAEKVLQHSLAHEPVSELSALMVDGRSQ-VLLAKVYSKMERPSDAIAALQQARELQARILKRVQMEQPDAVPSQKHFAAEICAEIAKHSAAQRDYEKAITFYREALVHCETDSKIMLELAQLYLAQEDLDASLRHCALLLQRDQDN----------------EPATMLMADLMFRKQDYEQAVYHLQQLLDRKPDNFMTLSRLIDLLRRCGKLEDVPRFFLMAEKHNSRTKLEPGFQYCKGLHFWYTGEPNDALRHFNKARKDSDWGQNALYNMIEICLNPDNETIGGEVFENLN--------GDLGTSPEKQESVQLAVRTAEKLLKELKPQTVQGRLQ--LRIMENCCLMATKQKSSVEQALNTFTEIAASEKDHIPALLGMATAYMILKQTPKARNQLKRIAKMPWNPIEAEDLEKSWLLLADIYIQSAKYDMAEELLKRCLCHNRSCCKAYEYMGYIMEKEQAYTDAAFNYEMAWKHSNQTNPAVG 1268          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Mouse
Match: Ttc21a (tetratricopeptide repeat domain 21A [Source:MGI Symbol;Acc:MGI:1921302])

HSP 1 Score: 860.522 bits (2222), Expect = 0.000e+0
Identity = 494/1346 (36.70%), Postives = 798/1346 (59.29%), Query Frame = 1
Query:   73 MAFEDPELMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSNPLI---LKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSG-KSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVK-SGQSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMINIE-SKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            M+ +D  LM +I+Y+ +EKY+H  ++  N GL+RY ++P+L+   A  ++ ED I ++I ELE +   P+ ++ A+++L++A K     D   +QE E+ ++++R+  S  + ++A + L+    +DKAREY+   LK+++ +KE   L GWVD+ S+K    KK+ K  ++        +V  LMGK  Y   Q N S A+++ +++ +  + FLPAL+ KM+L L   DW+    T  R L  +   +DA++   +  L  +G+ +  ++R+  L++ L+  EP N   + +   + +R+CGR++ V +      ER     P        LG + ++  + ++A  ++K A+  +E+ L A+ G I CQ+ +G L+EA+ QLEFL E+Q ++ K+           +L A++   K   + E    L E++++HFS +    L  EY   L+P FL+ I KEY++FCP+Q  +   L+   LK++  IL  VV+  P + +  ++ A+  F+SG+LE +++ L+ CLE D  F++ HLLM+ +YL  GNF    H LE+G+SHNFQVR++PL+H +K R   +   Y E+ K+L    ++P  +   G KSQ P   S+  SER SI LEL  + RL GE HE+ KI+QDA  +FSG+ EE RIT+ N DLA+ +G+++ AL +LR + P    + EA++ MA IYL  RKD +LY  C+ EL E    P S +LLGDA+M IQ+P+KA+ VY+EA +    D  L +++G A VKTH Y +AI YY    K SGQ  L  +L+ LL+ L+ Y  A+ VL + +       +    +  V+  +LLA+VYKS  + E+ +  L  AL++Q++ILKRV  E  E +  + +LA  ICI+I + +   +D +S++K YK+AL+Y  +  + +LELA L + +G ++ C+  C  LL+++ T+                  A +M+A+LM +R +++TA+    ++L K PD+F  L  L+D+LRR+G+LE    +F+  ++ + +  L  G+N+C+G+  W+IG  +EAL+  N AR DS W + A   MV+ICLNPDN  VGG+  + L    NSA++ E         S   G++TAE +L      +E    Q  L Q + +  ++ K ++E AL  F E+ + + ++I AL   A   ++LKQ  KA+  L  ++K+ W  + AE++EKS LLLADIY Q      AL+ L+ C++YNKS  +AYEY G + EKEQ Y+ A+T+Y  AW + ++ +P IG+KLAFNYLK +K++++I+ C  VL   PKYPKI++EIL+KA
Sbjct:    1 MSSDDSSLMASIIYYSQEKYFHHVLQAANVGLERYSSDPALQFFRAYGILGEDHIHDAISELEGIQSHPDTSLCAVIALLSAHKSCDTIDIEAVQELESSLKEIRRSASSTALYYASLFLWFMGHHDKAREYVDHMLKVSSGSKEGYVLKGWVDLTSSKPHVVKKSIKYLEQGT--QDTKDVLGLMGKATYFMTQQNFSGALEVANQVTLACSNFLPALVLKMKLFLARQDWDQTIETGQRILEKDENNIDAWQILAVHELVKEGNTDRAADRVRNLIKALETGEPHNPNLHLKKILVISRLCGRHQVVHRLVSGFLERIFMATPSCALVATELGYLFILHQQVKEACLWYKEAMKLEENRLAALAGSIWCQILQGQLEEAAHQLEFLKEVQQSLGKSEL-------LVFLQALVAAKKQRLEQEATALLKEAVEVHFSSMQGLALSPEYFEKLDPLFLVCIAKEYLHFCPKQPRSPGQLVSPLLKQVAMILSPVVKVAPAMMEPLYVTAQVKFLSGELENAQSTLQRCLELDPTFVDAHLLMSQIYLAQGNFAMCSHCLELGVSHNFQVRDHPLYHFIKARALNKTGDYAEAIKTLKMIIKVPTSKAEEGRKSQSP---SVRPSERASILLELVEALRLNGELHEATKIMQDAINEFSGTPEEMRITVANVDLALSKGNVDLALNMLRGITPKQPCYTEAKEKMASIYLHTRKDVRLYIGCYVELCEHLPGPHSSLLLGDAFMNIQEPEKALEVYDEAYRKNPHDASLVSRIGQAYVKTHQYAKAINYYEAAQKISGQDFLCCELAELLLKLKKYHKAEKVLKQALERDSGVKDIPSMINEVKCLLLLAKVYKSHKK-EEVMETLNLALDLQSRILKRVPLEQSEMIPFQNQLAASICIQIGEHHLAEKDYDSALKSYKDALAYSPTDSKVVLELAHLYLLLGQLDLCEQRCAPLLEMEQTH----------------ERAAVMLADLMFRRQNYETAINLYHQVLEKAPDNFLVLNKLVDLLRRSGKLEEAPAFFELAKKVSSRVPLEPGFNYCQGIYFWHIGQPNEALRFLNKARKDSTWGQLATCYMVQICLNPDNEIVGGEAFESLVGDSNSASRKE---------SQQHGVRTAEKLLREFYPHSESGQTQLRLLQNLCLLATREKANVEVALGAFIEMAQAEKDSIPALLAMAQAYILLKQVPKARTQLKRLAKVPWTVDEAEDLEKSWLLLADIYCQGGKFDLALELLRRCLQYNKSCCRAYEYMGFIMEKEQSYKDAATNYELAWKYSHQANPAIGFKLAFNYLKDKKFVDAIEVCHSVLTEHPKYPKIREEILEKA 1308          
BLAST of Tetratricopeptide repeat protein 21B vs. UniProt/SwissProt
Match: sp|Q7Z4L5|TT21B_HUMAN (Tetratricopeptide repeat protein 21B OS=Homo sapiens OX=9606 GN=TTC21B PE=1 SV=2)

HSP 1 Score: 1030.78 bits (2664), Expect = 0.000e+0
Identity = 564/1343 (42.00%), Postives = 846/1343 (62.99%), Query Frame = 1
Query:   91 ELMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQ-SSNSNPL--ILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQ-KPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSGQ-SALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVS-GNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMIN---IESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            EL T I Y+ +E+Y+H  +   ++G+KRYG++P  +  +A   + E + QE++RE E + ++ +V++ +LL+L+ A K +P PD+  I E + ++++ RKG  + + + AG+ L+   R+DKAREY+ R +K++  +K+   L  W+D+   KE + KKA K F+E      GN+  +L+GK + LE++ N S A++ V++IIV    FLPA ++KM+LQL   DW+    TA R L+ +S  V+A + Q L  +C +G  E+ S +L  L   LD  EP+N   ++     F+R CGR++ +LQ+   L ERA  L P   E+   LG  M++Q + ++A+K++K A+  DE++++A+ G I CQL EG L++A  QLEFL+EIQ +I K++       E  YL A++   KN+ Q E+I  L++ +  HFS L    LG +Y   LNPDFL+ IV EY++FCP Q +S   PL  +L++   +LE VVR +PGL Q  FL+AK  ++SGD+E +   L+ CLE + ++ + HLL+A VYL     K    +LE+ LS++F+VR+ PL+HL+K +   +  +  ++ K+L  A  LPG++ +   ++ K  ++ +  S RLSI+LEL   HRL GE HE+ K+LQDA  +FSG+ EE R+TI NADLA+ +GDIE AL+IL++V  +  YF+EAR+ MA+IYLK+RKDK LY  CF+E+AER   P S +LLGDAYM I +P++AI  YE+A      D  LA+K+G AL+KTHNY+ AI YY   +K+GQ + L  DL+ LL+ L+ YD A+ VL   ++  +  N     +E     VLLA+VY    +    I+ L  A  +Q ++LKRV  E P+++  +K LA EIC +IA+    + D E +IK+Y+EAL + E+  + +LELARL +   D ++C   C  LLQ D  N                 +AT+MMA+LM ++ D++ A+FHL++LL + PD++  L+ LID+LRR G+LE+V  +F   E+ N ++ L  G+ +CKGL  WY G  ++AL+ FN AR D +W + A+YNM+EICLNPDN TVGG+V + LD   GNS  + E         SV   ++TAE +L  L     +   Q  LR M N   + +K K ++E+AL+ F E+  ++ E+I AL G A   M+LKQ+ +A+  L  I+K+NW    AEE EKS LLLADIYIQ      A D LK C+++N+S  KAYEY G + EKEQ Y  A+ +Y  AW + N+ +P +GYKLAFNYLK ++Y++SID C QVL++ P YPKI+K+ILDKA
Sbjct:    5 ELKTLINYYCQERYFHHVLLVASEGIKRYGSDPVFRFYHAYGTLMEGKTQEALREFEAIKNKQDVSLCSLLALIYAHKMSPNPDREAILESDARVKEQRKGAGEKALYHAGLFLWHIGRHDKAREYIDRMIKISDGSKQGHVLKAWLDITRGKEPYTKKALKYFEEG--LQDGNDTFALLGKAQCLEMRQNYSGALETVNQIIVNFPSFLPAFVKKMKLQLALQDWDQTVETAQRLLLQDSQNVEALRMQALYYVCREGDIEKASTKLENLGNTLDAMEPQNAQLFYNITLAFSRTCGRSQLILQKIQTLLERAFSLNPQQSEFATELGYQMILQGRVKEALKWYKTAMTLDETSVSALVGFIQCQLIEGQLQDADQQLEFLNEIQQSIGKSA-------ELIYLHAVLAMKKNKRQEEVINLLNDVLDTHFSQLEGLPLGIQYFEKLNPDFLLEIVMEYLSFCPMQPASPGQPLCPLLRRCISVLETVVRTVPGLLQTVFLIAKVKYLSGDIEAAFNNLQHCLEHNPSYADAHLLLAQVYLSQEKVKLCSQSLELCLSYDFKVRDYPLYHLIKAQSQKKMGEIADAIKTLHMAMSLPGMKRIGASTKSKDRKTEVDTSHRLSIFLELIDVHRLNGEQHEATKVLQDAIHEFSGTSEEVRVTIANADLALAQGDIERALSILQNVTAEQPYFIEAREKMADIYLKHRKDKMLYITCFREIAERMANPRSFLLLGDAYMNILEPEEAIVAYEQALNQNPKDGTLASKMGKALIKTHNYSMAITYYEAALKTGQKNYLCYDLAELLLKLKWYDKAEKVLQHALAH-EPVNELSALMEDGRCQVLLAKVYSKMEKLGDAITALQQARELQARVLKRVQMEQPDAVPAQKHLAAEICAEIAKHSVAQRDYEKAIKFYREALVHCETDNKIMLELARLYLAQDDPDSCLRQCALLLQSDQDN----------------EAATMMMADLMFRKQDYEQAVFHLQQLLERKPDNYMTLSRLIDLLRRCGKLEDVPRFFSMAEKRNSRAKLEPGFQYCKGLYLWYTGEPNDALRHFNKARKDRDWGQNALYNMIEICLNPDNETVGGEVFENLDGDLGNSTEKQE---------SVQLAVRTAEKLLKELKPQTVQGHVQ--LRIMENYCLMATKQKSNVEQALNTFTEIAASEKEHIPALLGMATAYMILKQTPRARNQLKRIAKMNWNAIDAEEFEKSWLLLADIYIQSAKYDMAEDLLKRCLRHNRSCCKAYEYMGYIMEKEQAYTDAALNYEMAWKYSNRTNPAVGYKLAFNYLKAKRYVDSIDICHQVLEAHPTYPKIRKDILDKA 1310          
BLAST of Tetratricopeptide repeat protein 21B vs. UniProt/SwissProt
Match: sp|Q0HA38|TT21B_MOUSE (Tetratricopeptide repeat protein 21B OS=Mus musculus OX=10090 GN=Ttc21b PE=1 SV=1)

HSP 1 Score: 991.875 bits (2563), Expect = 0.000e+0
Identity = 552/1340 (41.19%), Postives = 826/1340 (61.64%), Query Frame = 1
Query:   94 LMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCP-QQSSNSNPL--ILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSG-QSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMIN---IESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            L T I Y+ +E+YYH  +   ++G+K+Y ++P  +  +A   + E + QE++RE E + ++ +V++ +L++L+   K +P PD+  I E + KM++ RK     + + AG+ L+   R+DKAREY+ R  KM   + E   L  W+D+   KE + KKA + F+E      GN++ +L+GKV  LEI+ N S A++ VS+IIV    FLPA  +KM+LQL   DW+    TA R L+ ++  V+A +   L  LC +G  E+ + +L  L   LD  EP+N   +++    F+R CGRN+ +LQ+     E+A  L P   E    LG  M++Q K ++A K+++ A+  +ESN++A+ G+I CQL EG L++A  QLEF  E Q ++ K++       E  YL A++   KN  Q E+I  L++ +  HFS L +  LG +Y   LNPDFL+ +V EY+N CP Q +    PL  +L++ + +LE ++R +PGL QA FL+AK  ++SGD E +   L+ CLE   ++ E HLLMA VYL     K    +LE+ LS+NF VRE PL+HL+K +   +  +  E+ K+L  A  LPG+R     S+  + + +  S RLSI+LEL   HRL GE HE+AK+LQDA  +FSG+ EE R+TI NADLA+ +GD + AL++LR+V  +  YF+EA++ MA+IYLK+RK+K LY  C++E+AER  +P S +LLGDAYM IQ+P++AI  YE+A      D  LA K+G ALVKTHNY++AI YY   +KSG Q+ L  DL+ LL+ L+LY+ A+ VL   ++ +  S      ++     VLLA+VY         I+ L  A  +Q +ILKRV  E P+++  +K  A EIC +IA+  + + D E +I +Y+EAL + E+  + +LELA+L +   D++     C  LLQ D  N                  AT++MA+LM ++ D++ A++HL++LL + PD+F  L+ LID+LRR G+LE+V  +F   E+ N ++ L  G+ +CKGL  WY G  ++AL+ FN AR DS+W + A+YNM+EICLNPDN T+GG+V + L+  G+  T  E      K  SV   ++TAE +L  L     +   Q  LR M N   + +K K S+E+AL+ F E+  ++ ++I AL G A   M+LKQ+ KA+  L  I+K+ W    AE++EKS LLLADIYIQ      A + LK C+ +N+S  KAYEY G + EKEQ Y  A+ +Y  AW   N+ +P +GYKLAFNYLK ++Y+++ID C QVL++ P YPKI+K+ILDKA
Sbjct:    6 LKTLINYYCQERYYHHVLLVASEGMKKYSSDPVFRFYHAYGTLMEGKAQEALREFEAIKNKQDVSLCSLMALMYVHKMSPNPDREAILELDTKMKEQRKEAGRKALYHAGLFLWHIGRHDKAREYIDRMSKMPHDSNEGPILKAWLDITRGKEPYAKKALRYFEEG--LQDGNDIFALLGKVLCLEIRQNYSGALETVSQIIVNFPSFLPAFEKKMKLQLALQDWDQTVETAQRLLLQDNHNVEALRMLALYYLCREGDVEKAATKLENLGNALDVMEPQNAQLFYKITLAFSRTCGRNQLILQKVQSFLEKAFSLTPQQAEIATELGYQMILQGKVKEAWKWYRTAMTLNESNISAVTGLIRCQLIEGQLQDADQQLEFFSEFQQSMGKSA-------ELMYLHAVLATKKNNRQDEVINLLNDVVNTHFSHLEDLPLGIQYFEKLNPDFLLEVVTEYLNLCPIQPAGPGQPLSPVLRRCSSVLETIIRSVPGLPQAVFLMAKVKYLSGDTEAAYNNLQHCLEHSPSYAEAHLLMAQVYLSQDKVKLCSQSLELCLSYNFNVREYPLYHLIKAQSQKKMGEVAEAIKTLHMAMNLPGMRRSRASSKSKHRTEVDASHRLSIFLELVEVHRLNGEQHEAAKVLQDAIHEFSGTCEELRVTIANADLALAQGDTDRALSMLRNVTTEQPYFIEAKEKMADIYLKHRKEKMLYITCYREIAERMPSPRSFLLLGDAYMNIQEPEEAIVAYEQALNQNPKDGTLARKIGKALVKTHNYSKAITYYEAALKSGQQNCLCYDLAELLLRLKLYEKAEKVLQHSLAHEPVSELSALMVDGRSQ-VLLAKVYSKMERPSDAIAALQQARELQARILKRVQMEQPDAVPSQKHFAAEICAEIAKHSAAQRDYEKAITFYREALVHCETDSKIMLELAQLYLAQEDLDASLRHCALLLQRDQDN----------------EPATMLMADLMFRKQDYEQAVYHLQQLLDRKPDNFMTLSRLIDLLRRCGKLEDVPRFFLMAEKHNSRTKLEPGFQYCKGLHFWYTGEPNDALRHFNKARKDSDWGQNALYNMIEICLNPDNETIGGEVFENLN--GDLGTSPE------KQESVQLAVRTAEKLLKELKPQTVQGRLQ--LRIMENCCLMATKQKSSVEQALNTFTEIAASEKDHIPALLGMATAYMILKQTPKARNQLKRIAKMPWNPIEAEDLEKSWLLLADIYIQSAKYDMAEELLKRCLCHNRSCCKAYEYMGYIMEKEQAYTDAAFNYEMAWKHSNQTNPAVGYKLAFNYLKAKRYVDAIDVCHQVLEAHPTYPKIRKDILDKA 1309          
BLAST of Tetratricopeptide repeat protein 21B vs. UniProt/SwissProt
Match: sp|Q6INC1|TT21B_XENLA (Tetratricopeptide repeat protein 21B OS=Xenopus laevis OX=8355 GN=ttc21b PE=2 SV=1)

HSP 1 Score: 908.672 bits (2347), Expect = 0.000e+0
Identity = 508/1351 (37.60%), Postives = 795/1351 (58.85%), Query Frame = 1
Query:   73 MAFEDPELMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQS-SNSNPL--ILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVK-SGQSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSN--NYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENIL-----NSLSTSNEKDLRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            MA  D  +   I+Y+ +EKY+        +GLK+Y N+P L+      M+ EDR+Q++IR LE + D P V + + ++L+ A KR+ + D+  + + ENK+++ RK     + ++AGM L+L  R DKAREY+ R LK++  ++E + L GW+D+ S KE+   K+ + F+E        ++ +L+GK +Y     N S A+D++++IIV    FLPAL  KMRL L   DW+    TA R L+ +   +DAF+   +  +  +G  E+    L EL+  LD  EP+N   +       + +CGRN+ +L+Q   +  R  Q AP + E    L    ++Q    +A  ++  A+  D ++L  + GVI CQ+ +G L+EA  QL+FLHEIQ +I  T       KE  Y+ A++   + + +  I + L +++++H++ +    LG EY   LNP FLI+IV+EY+  CP+Q  +   PL  +LK+   IL  VV   P L +  +  A+  +++G+LE ++  L+ C+E D A  + HLLMA ++   G F     +LE G+SHNF+VRE PL+HL++ R+  +  +  E+ K+L     L    M  G  +K    SL +S+++SIYLELA   RL GE HE+ KI+QDA  +F G+ EE RI + NAD+AV +GD+E AL +LR + P+  Y+ E ++ MA+IYL  RKDKKLY  C++EL E+   P + +LLGDA M IQ+P+KA+ VY EA      D  LA ++G AL+KTH Y +A+ YY    K SGQ  L  DL+ LLI L+ Y  A++VL + ++ +  S+  +   + +C+ L     + YK     E+    L  AL +Q +ILKRV  E PE    +K+  +EIC+++A+ Y  + + E +  YYKEA+ Y +   +  L+L+RL + +GD+++C++ C  LL+                  S+   A +MMA++M ++ D+  ++    ++L +NPD+F  L+ LID+LRR+G L    M+F+     + ++TL  GYN+CKGL  WY+G  ++ LK FN AR DSEW + A+ NMV+ICLNPDN  VGG+V +  D +             +K  S   G++TAE +L      +L+  N+  L Q +      + +K K ++E ALS F E+  ++ +N+ A+   A   M+L+Q+ +A+  L  +SK+ W    AE++EKS LLLAD+YI+      A + LK C+ YNKS YKAYEY G + E EQ Y+ A+ +Y  AW + N+++P +G++LAFNYLK +KY+++ID C +VLK+ P YPKI++EIL KA
Sbjct:    1 MADTDHYITAGIIYYCQEKYHQHVQNLAREGLKKYSNDPVLQFFKIYGMLMEDRVQDAIRRLEPIKDDPTVVLCSTMALIYAHKRSERVDREAVADLENKLKETRKSAGPKALYYAGMFLWLMGRTDKAREYIDRMLKISNRSREGLVLRGWLDLSSEKESTVNKSIRYFEEG--IQDNKDIFALIGKAQYFMAHQNYSGALDVINQIIVNYPPFLPALTLKMRLFLAQQDWDQTLETAQRILLKDGANIDAFQILTIHSVTREGSTEKALNYLRELINALDAAEPRNPMLHLHKILPISSLCGRNQPILKQVSVVIGRIFQTAPHA-EVATALANNFILQGNVTEAAGWYATAMKLDGNHLEGLTGVIQCQILQGQLEEAEQQLDFLHEIQESIGGT-------KELCYIQALLASRQGKEEQIITELLKKAVELHYAAVRGLPLGVEYFEKLNPTFLINIVQEYLVLCPKQPKAPGEPLSPLLKQALSILTPVVSVAPALTEPLYYTAQIKYLAGNLEGAQGSLQRCIEVDTACADFHLLMAQIHYAQGKFAECSVSLETGVSHNFKVRERPLYHLIRARVLRKTGELQEAIKTLKMTMSLQ--EMKRGALKKSTWGSLNSSDKVSIYLELAELLRLNGEQHEATKIIQDAINEFGGTPEEIRIVVANADMAVAKGDVEMALNVLRDIAPNQPYYTEVKQKMAQIYLNNRKDKKLYIGCYRELCEQQPGPHTSVLLGDALMNIQEPEKALEVYNEALHKNPQDASLANRIGQALIKTHQYKKAVNYYEAAQKISGQDFLCCDLAELLIKLKQYSKAEAVLKQALAHEPVSDLTSMVTDAKCLGLLGTTYQNYKK----EESADILNKALELQQRILKRVPMEQPEMAPAQKQATSEICVQLAEHYVDQRNYEQAANYYKEAMVYSQDS-KVKLQLSRLYLMMGDLDSCENHCSALLE----------------NHSFKEEAAMMMADVMFRKQDYTKSIELFDQILEENPDNFAVLSKLIDLLRRSGNLSKAPMFFEKALANSSRTTLEPGYNYCKGLYCWYLGQPNDGLKYFNKARKDSEWGQNAISNMVQICLNPDNEIVGGEVFEAPDEAD--------GLLGEKRESEMLGVRTAEKLLKEFHPRTLNGRNQLALLQNHCL----MATKDKANVETALSAFTEMATSEKDNVCAILAVAQAYMILRQTPRARNQLKRLSKVPWSLADAEDLEKSWLLLADVYIKLGKYDIATELLKRCLLYNKSCYKAYEYLGFIMENEQSYKDAAANYRLAWDYSNQSNPAVGFRLAFNYLKDKKYVDAIDICHKVLKAHPTYPKIEREILAKA 1306          
BLAST of Tetratricopeptide repeat protein 21B vs. UniProt/SwissProt
Match: sp|Q8C0S4|TT21A_MOUSE (Tetratricopeptide repeat protein 21A OS=Mus musculus OX=10090 GN=Ttc21a PE=1 SV=2)

HSP 1 Score: 860.522 bits (2222), Expect = 0.000e+0
Identity = 494/1346 (36.70%), Postives = 798/1346 (59.29%), Query Frame = 1
Query:   73 MAFEDPELMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSNPLI---LKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSG-KSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVK-SGQSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMINIE-SKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            M+ +D  LM +I+Y+ +EKY+H  ++  N GL+RY ++P+L+   A  ++ ED I ++I ELE +   P+ ++ A+++L++A K     D   +QE E+ ++++R+  S  + ++A + L+    +DKAREY+   LK+++ +KE   L GWVD+ S+K    KK+ K  ++        +V  LMGK  Y   Q N S A+++ +++ +  + FLPAL+ KM+L L   DW+    T  R L  +   +DA++   +  L  +G+ +  ++R+  L++ L+  EP N   + +   + +R+CGR++ V +      ER     P        LG + ++  + ++A  ++K A+  +E+ L A+ G I CQ+ +G L+EA+ QLEFL E+Q ++ K+           +L A++   K   + E    L E++++HFS +    L  EY   L+P FL+ I KEY++FCP+Q  +   L+   LK++  IL  VV+  P + +  ++ A+  F+SG+LE +++ L+ CLE D  F++ HLLM+ +YL  GNF    H LE+G+SHNFQVR++PL+H +K R   +   Y E+ K+L    ++P  +   G KSQ P   S+  SER SI LEL  + RL GE HE+ KI+QDA  +FSG+ EE RIT+ N DLA+ +G+++ AL +LR + P    + EA++ MA IYL  RKD +LY  C+ EL E    P S +LLGDA+M IQ+P+KA+ VY+EA +    D  L +++G A VKTH Y +AI YY    K SGQ  L  +L+ LL+ L+ Y  A+ VL + +       +    +  V+  +LLA+VYKS  + E+ +  L  AL++Q++ILKRV  E  E +  + +LA  ICI+I + +   +D +S++K YK+AL+Y  +  + +LELA L + +G ++ C+  C  LL+++ T+                  A +M+A+LM +R +++TA+    ++L K PD+F  L  L+D+LRR+G+LE    +F+  ++ + +  L  G+N+C+G+  W+IG  +EAL+  N AR DS W + A   MV+ICLNPDN  VGG+  + L    NSA++ E         S   G++TAE +L      +E    Q  L Q + +  ++ K ++E AL  F E+ + + ++I AL   A   ++LKQ  KA+  L  ++K+ W  + AE++EKS LLLADIY Q      AL+ L+ C++YNKS  +AYEY G + EKEQ Y+ A+T+Y  AW + ++ +P IG+KLAFNYLK +K++++I+ C  VL   PKYPKI++EIL+KA
Sbjct:    1 MSSDDSSLMASIIYYSQEKYFHHVLQAANVGLERYSSDPALQFFRAYGILGEDHIHDAISELEGIQSHPDTSLCAVIALLSAHKSCDTIDIEAVQELESSLKEIRRSASSTALYYASLFLWFMGHHDKAREYVDHMLKVSSGSKEGYVLKGWVDLTSSKPHVVKKSIKYLEQGT--QDTKDVLGLMGKATYFMTQQNFSGALEVANQVTLACSNFLPALVLKMKLFLARQDWDQTIETGQRILEKDENNIDAWQILAVHELVKEGNTDRAADRVRNLIKALETGEPHNPNLHLKKILVISRLCGRHQVVHRLVSGFLERIFMATPSCALVATELGYLFILHQQVKEACLWYKEAMKLEENRLAALAGSIWCQILQGQLEEAAHQLEFLKEVQQSLGKSEL-------LVFLQALVAAKKQRLEQEATALLKEAVEVHFSSMQGLALSPEYFEKLDPLFLVCIAKEYLHFCPKQPRSPGQLVSPLLKQVAMILSPVVKVAPAMMEPLYVTAQVKFLSGELENAQSTLQRCLELDPTFVDAHLLMSQIYLAQGNFAMCSHCLELGVSHNFQVRDHPLYHFIKARALNKTGDYAEAIKTLKMIIKVPTSKAEEGRKSQSP---SVRPSERASILLELVEALRLNGELHEATKIMQDAINEFSGTPEEMRITVANVDLALSKGNVDLALNMLRGITPKQPCYTEAKEKMASIYLHTRKDVRLYIGCYVELCEHLPGPHSSLLLGDAFMNIQEPEKALEVYDEAYRKNPHDASLVSRIGQAYVKTHQYAKAINYYEAAQKISGQDFLCCELAELLLKLKKYHKAEKVLKQALERDSGVKDIPSMINEVKCLLLLAKVYKSHKK-EEVMETLNLALDLQSRILKRVPLEQSEMIPFQNQLAASICIQIGEHHLAEKDYDSALKSYKDALAYSPTDSKVVLELAHLYLLLGQLDLCEQRCAPLLEMEQTH----------------ERAAVMLADLMFRRQNYETAINLYHQVLEKAPDNFLVLNKLVDLLRRSGKLEEAPAFFELAKKVSSRVPLEPGFNYCQGIYFWHIGQPNEALRFLNKARKDSTWGQLATCYMVQICLNPDNEIVGGEAFESLVGDSNSASRKE---------SQQHGVRTAEKLLREFYPHSESGQTQLRLLQNLCLLATREKANVEVALGAFIEMAQAEKDSIPALLAMAQAYILLKQVPKARTQLKRLAKVPWTVDEAEDLEKSWLLLADIYCQGGKFDLALELLRRCLQYNKSCCRAYEYMGFIMEKEQSYKDAATNYELAWKYSHQANPAIGFKLAFNYLKDKKFVDAIEVCHSVLTEHPKYPKIREEILEKA 1308          
BLAST of Tetratricopeptide repeat protein 21B vs. UniProt/SwissProt
Match: sp|Q8NDW8|TT21A_HUMAN (Tetratricopeptide repeat protein 21A OS=Homo sapiens OX=9606 GN=TTC21A PE=1 SV=3)

HSP 1 Score: 848.966 bits (2192), Expect = 0.000e+0
Identity = 493/1355 (36.38%), Postives = 794/1355 (58.60%), Query Frame = 1
Query:   73 MAFEDPELMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSE--------RLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSNPLI---LKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVK-SGQSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSL---STSNEKDLRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            M+  D  LM  I+Y+ +EKY+H   +    GL+++ N+P LK   A  ++ E+ IQ++I +LE +   P+V++ + ++L+ A KR    D+  IQE E  ++++RK  S  + ++AG+ L+L  R+DKA+EY+ R LK++   +E   L GWVD+ S+K    KKA +  ++        +V  LMGK  Y  +Q N S+A+++V++I VT+  FLPAL+ KM+L L   DWE       R L  +   +DA +   +  L  +G+   +S          +  L++ L+  EP+N   + +   + +R+CG ++ +L       ER     P  V     LG + +++N+ ++A+ ++  A+  D+  +  + G+I C + EG L+EA  +LEFL E+Q ++ K+           +L A++   K++ + E    L E++++HFS +    LG EY   L+P FL+ I KEY+ FCP+Q      ++   LK++  IL  VV+  P L    +L+A+  + S +LE ++++L+ CLE D A ++ HLLM  +YL  GNF    H LE+G+SHNFQVR++PL+HL+K R   +   Y E+ K+L    +LP ++   G+  K    S+  S+R SI LEL  + RL GE HE+ K++QD   +F G+ EE RITI N DL + +G+++ AL +LR++ P  + ++EAR+ MA IYL+  +D++LY  C++EL E    P + +LLGDA M I +P+KA+ VY+EA +    D  LA+++G A VK H YTEAI+YY    K +GQ  L  DL  LL+ L+  + A+ VL + + E     +    +  V+  +LLA+VYKS  + E  I  L  AL++Q++ILKRV  E PE +  +K+LA  ICI+ A+ Y   ++ + +++ YK+  SY  +  + +LELA+L +  G ++ C+  C  LLQ            E+N E     +A+++MA+LM ++   + A+    ++L K PD+F  L  LID+LRR+G+LE++  +F+  ++ + +  L  G+N+C+G+  W+IG  +EALK  N AR DS W + A+Y+MV+ICLNPDN  VGG+  +      N   + E+            G+ TAE +L      S S++  LR   L+ +  + ++ K ++E AL  F ++ + + +++ AL   A   + LKQ  KA+  L  ++K  W+   AE++EKS LLLADIY Q      AL+ L+ C++YNKS YKAYEY G + EKEQ Y+ A T+Y  AW + +  +P IG+KLAFNYLK +K++E+I+ C  VL+  P YPKI++EIL+KA
Sbjct:    1 MSSNDSSLMAGIIYYSQEKYFHHVQQAAAVGLEKFSNDPVLKFFKAYGVLKEEHIQDAISDLESIRHHPDVSLCSTMALIYAHKRCEIIDREAIQELEYSLKEIRKTVSGTALYYAGLFLWLIGRHDKAKEYIDRMLKISRGFREAYVLRGWVDLTSDKPHTAKKAIEYLEQG--IQDTKDVLGLMGKAMYFMMQQNYSEALEVVNQITVTSGSFLPALVLKMQLFLARQDWEQTVEMGHRILEKDESNIDACQILTVHELAREGNMTTVSSLKTQKATNHVRNLIKALETREPENPSLHLKKIIVVSRLCGSHQVILGLVCSFIERTFMATPSYVHVATELGYLFILKNQVKEALLWYSEAMKLDKDGMAGLTGIILCHILEGHLEEAEYRLEFLKEVQKSLGKSEV-------LIFLQALLMSRKHKGEEETTALLKEAVELHFSSMQGIPLGSEYFEKLDPYFLVCIAKEYLLFCPKQPRLPGQIVSPLLKQVAVILNPVVKAAPALIDPLYLMAQVRYYS-ELENAQSILQRCLELDPASVDAHLLMCQIYLAQGNFGMCFHCLELGVSHNFQVRDHPLYHLIKARALNKAGDYPEAIKTLKMVIKLPALKKEEGR--KFLRPSVQPSQRASILLELVEALRLNGELHEATKVMQDTINEFGGTPEENRITIANVDLVLSKGNVDVALNMLRNILPKQSCYMEAREKMANIYLQTLRDRRLYIRCYRELCEHLPGPHTSLLLGDALMSILEPEKALEVYDEAYRQNPHDASLASRIGHAYVKAHQYTEAIEYYEAAQKINGQDFLCCDLGKLLLKLKKVNKAEKVLKQAL-EHDIVQDIPSMMNDVKCLLLLAKVYKSHKK-EAVIETLNKALDLQSRILKRVPLEQPEMIPSQKQLAASICIQFAEHYLAEKEYDKAVQSYKDVFSYLPTDNKVMLELAQLYLLQGHLDLCEQHCAILLQ-----------TEQNHE-----TASVLMADLMFRKQKHEAAINLYHQVLEKAPDNFLVLHKLIDLLRRSGKLEDIPAFFELAKKVSSRVPLEPGFNYCRGIYCWHIGQPNEALKFLNKARKDSTWGQSAIYHMVQICLNPDNEVVGGEAFENQGAESNYMEKKELE---------QQGVSTAEKLLREFYPHSDSSQTQLR--LLQGLCRLATREKANMEAALGSFIQIAQAEKDSVPALLALAQAYVFLKQIPKARMQLKRLAKTPWVLSEAEDLEKSWLLLADIYCQGSKFDLALELLRRCVQYNKSCYKAYEYMGFIMEKEQSYKDAVTNYKLAWKYSHHANPAIGFKLAFNYLKDKKFVEAIEICNDVLREHPDYPKIREEILEKA 1314          
BLAST of Tetratricopeptide repeat protein 21B vs. TrEMBL
Match: A0A1S3IUI9 (tetratricopeptide repeat protein 21B-like OS=Lingula unguis OX=7574 GN=LOC106167371 PE=4 SV=1)

HSP 1 Score: 1117.84 bits (2890), Expect = 0.000e+0
Identity = 579/1345 (43.05%), Postives = 878/1345 (65.28%), Query Frame = 1
Query:   73 MAFEDPELMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQ-SSNSNPL--ILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNE-SSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSG-QSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            MA  D   +  I Y+ REK Y        +G+K+YGN+P LK  +A  M+ EDR+QE +RELE+L D+ ++N+   ++L+   KR    D+  +QE + K++  RK   +M  +FAG+ LF  E+YDKAREY+ R LK+   +KE + L GW+D++  ++++ KKA K FD+  ++ G   VD+L GK K   ++ N + +++L+++ IV+   ++PAL+EKM++QL   DWE    TA R L  ++  ++A +Y +L  LC +G+ +E + ++G+L+ ++DR+EPKN + Y+  A  F R+CGRN  VLQQ   L ERA+ L   S EY   LG  +LMQ + RDA+K +KNA+  DE+++ A+ G+I CQL E  L++A+ QLEFL EIQ +I K++       E  YL+A++ R + +   ++++ L+E+++ HFS L +  LG +Y Y +NPDFLI ++ E++ + PQQ S+   P+  +LK+   +LE V R +PGL +A FL+AK  F+SGD++ ++  L+ CL+ D  F + H+LMA + L  GNFK A  +LEVGLS+NF+VRE+PL+HL+K RI  +Q  + ++ K+L  A  LPGV+    KS    + + +  ++R+S++LELA +HR+  E HE+AK++ DA  +F G+ EE RI I NADL++ RGD+E AL +LR+V  +  YFV+AR+ MAEIYL +RKDK+LYA+C+KEL ++H +  + +LLGDAYM IQ+P+KAI VY+ A ++   D  LA+K+G ALVKTHNY +AI YY   +KSG Q++LR DL+ LL+ L+ YD A+ VLM+ + +        + +E  +  VLLA+V+  + E E+ +  L  A ++Q ++LKRV  E P+++  +K+LA  IC ++A+  S + D E +IKYYKEAL Y E+  +  +ELARL M   D+  CQH  + LL+           NEK        +AT+MMA+LM ++ D+D A+FH ++LL + PDHF+ALA L+D++RR G+L+ V ++ +  E F+ K+    GYN+CKGL EW+ GN + ALK FN AR D++W + A+Y M+EICLNPDN  +GG+V +         T D   +A ++ +S    +KTAE ++  L      D+R   L  M+ I +K+K +IEKAL+ F E+   + +++ ALYG A   MVLKQ+ +A+  L  I+K NW  + AE++EK  LLLADIYIQ      A + L+ C+  NKS  KAYEY G + E+EQ Y+ A+ +Y NAW + NKN P IGYKLAFNY+K ++++++ID C  VLK+ P YPKI+K+ILDKA
Sbjct:    1 MAETDSVTLAKINYYCREKLYRHMQNAALEGMKKYGNDPVLKFFHAYSMLLEDRVQEGMRELEILKDKRDLNLCTYMALMFGHKRCKTVDREAMQELDTKLKTERKQAGEMGLYFAGLFLFHSEKYDKAREYIDRMLKINANSKEGLILKGWIDLLCGRDSYVKKAVKYFDDVLNQ-GNKEVDALFGKAKCFSLKNNFTGSLELMNQAIVSFPGYMPALIEKMKIQLALQDWEQTVETAHRALSQDNHSLEAHRYIVLHQLCREGNAQEAATKIGDLIGLVDRFEPKNPHLYNDIAQTFCRLCGRNLLVLQQTYTLAERAVSLDNTSAEYVTELGYELLMQGRVRDAMKCYKNAMKLDETSVAALTGIIRCQLAENQLEDAAQQLEFLSEIQQSIGKSA-------EVSYLSAVLARKRQKGPEKVLELLNEAVENHFSGLESLPLGVQYFYQMNPDFLIQVIHEFLIYAPQQPSTTGQPVHPVLKRCQMVLEPVTRTVPGLLEALFLMAKVKFLSGDVDAAQGTLQHCLDQDSTFSDAHILMAQIQLHQGNFKQASQSLEVGLSYNFEVREHPLYHLIKARIQKKQGDFQDAVKTLQMAMSLPGVKKSDSKSGSKKKVAQIGINDRVSVFLELAEAHRMCAETHEAAKVMTDATMEFEGTPEEIRIMIANADLSLNRGDVEGALVMLRNVKENEPYFVQAREKMAEIYLHHRKDKRLYASCYKELVDKHPSAHTCLLLGDAYMSIQEPEKAIEVYQAALKLNPKDGALASKIGQALVKTHNYGKAINYYEAALKSGSQTSLRYDLAELLLKLRQYDKAQKVLMQALDQAGAVTKLEEMIEQTKYLVLLAKVHTHREEFEQSVEALNKARDMQARVLKRVHMEQPDAVPAQKQLAASICSQMAKHSSDQRDYEKAIKYYKEALVYNENDEKVAIELARLYMLTDDLNACQHQLMALLK-----------NEKQ-----NDAATVMMADLMFRKNDYDAAMFHFQQLLQRAPDHFEALARLVDLMRRGGKLDEVPVFLEKAETFSPKTATEPGYNYCKGLYEWHTGNPNNALKYFNKARKDTDWGQEAIYCMIEICLNPDNDIIGGEVFE---------TMDNADSAAERADSEQLAVKTAEKLIKELR-QRPGDIRPRLLENMLLIATKNKQNIEKALAAFMEIASAERDHVGALYGMAAAYMVLKQTPRARNQLRRIAKNNWNMQDAEDLEKCWLLLADIYIQNGKYDMATELLRKCLAANKSCCKAYEYMGFIMEREQSYRDAAKNYENAWKYGNKNSPVIGYKLAFNYMKARRFVDAIDICHHVLKTHPDYPKIRKDILDKA 1311          
BLAST of Tetratricopeptide repeat protein 21B vs. TrEMBL
Match: A0A1S3HYF2 (tetratricopeptide repeat protein 21B OS=Lingula unguis OX=7574 GN=LOC106159338 PE=4 SV=1)

HSP 1 Score: 1114.37 bits (2881), Expect = 0.000e+0
Identity = 578/1345 (42.97%), Postives = 877/1345 (65.20%), Query Frame = 1
Query:   73 MAFEDPELMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQ-SSNSNPL--ILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNE-SSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSG-QSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            MA  D   +  I Y+ REK Y        +G+K+YGN+P LK  +A  M+ EDR+QE +RELE+L D+ ++N+   ++L+   KR    D+  +QE + K++  RK   +M  +FAG+ LF  E+YDKAREY+ R LK+   +KE + L GW+D++  ++++ KKA K FD+  ++ G   VD+L GK K   ++ N + +++L+++ IV+   ++PAL+EKM++QL   DWE    TA R L  ++  ++A +Y +L  LC +G+ +E + ++G+L+ ++DR+EPKN + Y+  A  F R+CGRN  VLQQ   L ERA+ L   S EY   LG  +LMQ + RDA+K +KNA+  DE+++ A+ G+I CQL E  L++A+ QLEFL EIQ +I K++       E  YL+A++ R + +   ++++ L+E+++ HFS L +  LG +Y Y +NPDFLI ++ E++ + PQQ S+   P+  +LK+   +LE V R +PGL +A FL+AK  F+SGD++ ++  L+ CL+ D  F + H+LMA + L  GNFK A  +LEVGLS+NF+VRE+PL+HL+K RI  +Q  + ++ K+L  A  LPGV+    KS    + + +  ++R+S++LELA +HR+  E HE+AK++ DA  +F G+ EE RI I NADL++ RGD+E AL +LR+V  +  YFV+AR+ MAEIYL +RKDK+LYA+C+KEL ++H +  + +LLGDAYM IQ+P+KAI VY+ A ++   D  LA+K+G ALVKTHNY +AI YY   +KSG Q +LR DL+ LL+ L+ YD A+ VL++ + +        + +E  +  VLLA+V+  + E E+ +  L  A ++Q ++LKRV  E P+++  +K+LA  IC ++A+  S + D E +IKYYKEAL Y E+  +  +ELARL M   D+  CQH  + LL+           NEK        +AT+MMA+LM ++ D+D A+FH ++LL + PDHF+ALA L+D++RR G+L+ V ++ +  E F+ K+    GYN+CKGL EW+ GN + ALK FN AR D++W + A+Y M+EICLNPDN  +GG+V +         T D   +A ++ +S    +KTAE ++  L      D+R   L  M+ I +K+K +IEKAL+ F E+   + +++ ALYG A   MVLKQ+ +A+  L  I+K NW  + AE++EK  LLLADIYIQ      A + L+ C+  NKS  KAYEY G + E+EQ Y+ A+ +Y NAW + NKN P IGYKLAFNY+K ++++++ID C  VLK+ P YPKI+K+ILDKA
Sbjct:    1 MAETDSVTLAKINYYCREKLYRHMQNAALEGMKKYGNDPVLKFFHAYSMLLEDRVQEGMRELEILKDKRDLNLCTYMALMFGHKRCKTVDREAMQELDTKLKTERKQAGEMGLYFAGLFLFHSEKYDKAREYIDRMLKINANSKEGLILKGWIDLLCGRDSYVKKAVKYFDDVLNQ-GNKEVDALFGKAKCFSLKNNFTGSLELMNQAIVSFPGYMPALIEKMKIQLALQDWEQTVETAHRALSQDNHSLEAHRYIVLHQLCREGNAQEAATKIGDLIGLVDRFEPKNPHLYNDIAQTFCRLCGRNLLVLQQTYTLAERAVSLDNTSAEYVTELGYELLMQGRVRDAMKCYKNAMKLDETSVAALTGIIRCQLAENQLEDAAQQLEFLSEIQQSIGKSA-------EVSYLSAVLARKRQKGPEKVLELLNEAVENHFSGLESLPLGVQYFYQMNPDFLIQVIHEFLIYAPQQPSTTGQPVHPVLKRCQMVLEPVTRTVPGLLEALFLMAKVKFLSGDVDAAQGTLQHCLDQDSTFSDAHILMAQIQLHQGNFKQASQSLEVGLSYNFEVREHPLYHLIKARIQKKQGDFQDAVKTLQMAMSLPGVKKSDSKSGSKKKVAQIGINDRVSVFLELAEAHRMCAETHEAAKVMTDATMEFEGTPEEIRIMIANADLSLNRGDVEGALVMLRNVKENEPYFVQAREKMAEIYLHHRKDKRLYASCYKELVDKHPSAHTCLLLGDAYMSIQEPEKAIEVYQAALKLNPKDGALASKIGQALVKTHNYGKAINYYEAALKSGSQMSLRYDLAELLLKLRQYDKAQKVLLQALDQAGAVTKLEEMIEQTKYLVLLAKVHTHREEFEQSVEALNKARDMQARVLKRVHMEQPDAVPAQKQLAASICSQMAKHSSDQRDYEKAIKYYKEALVYNENDEKVAIELARLYMLTDDLNACQHQLMALLK-----------NEKQ-----NDAATVMMADLMFRKNDYDAAMFHFQQLLQRAPDHFEALARLVDLMRRGGKLDEVPVFLEKAETFSPKTATEPGYNYCKGLYEWHTGNPNNALKYFNKARKDTDWGQEAIYCMIEICLNPDNDIIGGEVFE---------TMDNADSAAERADSEQLAVKTAEKLIKELR-QRPGDIRPRLLENMLLIATKNKQNIEKALAAFMEIASAERDHVGALYGMAAAYMVLKQTPRARNQLRRIAKNNWNMQDAEDLEKCWLLLADIYIQNGKYDMATELLRKCLAANKSCCKAYEYMGFIMEREQSYRDAAKNYENAWKYGNKNSPVIGYKLAFNYMKARRFVDAIDICHHVLKTHPDYPKIRKDILDKA 1311          
BLAST of Tetratricopeptide repeat protein 21B vs. TrEMBL
Match: V3ZQE9 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_189817 PE=4 SV=1)

HSP 1 Score: 1111.67 bits (2874), Expect = 0.000e+0
Identity = 573/1316 (43.54%), Postives = 871/1316 (66.19%), Query Frame = 1
Query:  157 NDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSNPL--ILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSG-QSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVS-GNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            ++ L++YGN+P LK   A   I + R QE IREL++L D+ +VNI +L++L+ A K     D+  +QE E +++D RK   ++  +FAG+ +F   + DKAREY+ R LK     K  + L GW+++MS +EA  KK+ K F++A    G  ++D+L GK K++E + N S A+++V++I+V+   F PAL+EKMRLQL   DWE    TA R +  +  C++A KYQ L  +C +G +E+ S ++G+L+  +DR+E  N + Y   A +F+R+CGRN  +LQQ   L ERA+ +  D+ ++   LG  +L+Q K RDA++ ++NA+  DES++ ++ G+I CQL E  L +AS QLEFL+EIQ  I +++       E  YLTA++ + KN++  +II+ L++ I++HF+ L    LG +Y  ++NPDFL+ ++K Y+ + PQ      P   +LK+  Q+L+ + R +PGL +A +LLAK  F+SGD+E ++T L+ CLE D  F + H+LMA ++    NFK A+ +LEVGLS+NF+VR++PL+HL+K RI  +Q    E+ ++L  A  LPG++     + K  +    N +R+S++LELA +HRL+GE HE+AKI+QDA  +F+G+ EE RI+I N+DLA+ R DIE AL +LR++ PD  YFV+AR+ MA+IYL +RKDK+LYA C++EL +++ +P + +LLGDAYM IQ+P+KAI VYE A +    D  LA+K+G ALVKTHNY +AI YY   +K+G Q+ LR DL+ LL+ L+ YD A+ VL + + E +        +E  +   LLA+VY  Q + E+ +  L +A + Q ++LKRV  E P++   +K+LA++IC ++AQ  S + D E +I+YYK+AL Y ++  + +L+LA L +   D++ CQH C+TLL+ D  N                 +AT+M+A+LM ++ + D+A++H ++LL   PD++ ALA L+D+LRR G+LE V  + +  ++ + +ST+ AGY++CKGL EWY GN +EALKLFN AR DS+W  +AVYNM+EICLNPDN T+GG+V + +D    NSAT+ E      K++S    ++TAE +L         D+R + L  M  I +K KP++EKAL+ F E+   + +++ ALYG A   MVLKQ+ +A+  L  ++K NW  + AE++EKS LLLADIYIQ      A + LK C+ +NK+S KAYEY G + EKEQ Y+ A+  Y NAW + NKN+P IGYKLAFNY+K ++++++ID C  VL+S P YPKI+K+ILDKA
Sbjct:    6 SESLQKYGNDPVLKFFIAYSKILQGRYQEGIRELDVLKDKRDVNICSLMALIYAHKVQQTVDREAVQELEGRLKDERKQAGEVGLYFAGLFMFHAGKPDKAREYIDRTLKQNAEFKMALVLKGWIELMSGREA--KKSIKYFEDAMSLDGSKDIDALFGKSKFMENRRNYSGALEIVNQIVVSFPNFTPALVEKMRLQLALQDWEQTIETAQRAIDQDFHCIEAIKYQALSYMCREGQFEKASTKIGDLITSIDRFESHNAHLYCHMAQIFSRLCGRNGLILQQTYTLIERAVSIDGDNSQFVNELGYQLLLQGKVRDALRCYRNAMKMDESSVPSLTGIIQCQLIENQLDDASQQLEFLNEIQQTIGRSA-------ELSYLTAMMAQKKNKSPEKIIEYLNDCIEVHFAGLKGLPLGVQYFCLMNPDFLLQVMKTYLQYAPQPVPAGQPPNPVLKRCQQVLDPLTRAVPGLMEAVYLLAKVRFLSGDIENAQTTLQHCLEQDATFSDAHILMAQIHSSQNNFKLANQSLEVGLSYNFEVRDHPLYHLIKARILKKQGSLTEAVQTLQMAMALPGIKKTGSATMKKGKEIGVN-DRVSVFLELAEAHRLVGEQHEAAKIMQDAINEFNGTPEEVRISIANSDLALARNDIEMALGMLRNITPDQPYFVQAREKMADIYLNHRKDKRLYAGCYRELVDKYPSPHTSLLLGDAYMSIQEPEKAIEVYEAALRKNPKDAGLASKIGQALVKTHNYGKAISYYEAALKAGGQAFLRFDLAELLLRLRQYDKAEKVLKQAL-ESEGQGEIETLMENTKYLTLLAKVYHKQEKMEEALESLNNARDTQARVLKRVQMEQPDAYNNQKQLASDICRQLAQYSSNQRDYEKAIRYYKDALVYNDNDSKVMLDLAGLYLITEDLDACQHQCMTLLKSDKDN----------------DAATIMLADLMFRKNELDSAMYHFQQLLQIRPDNYDALARLVDLLRRAGKLEQVPEFLEAAQKASSRSTMDAGYSYCKGLFEWYTGNPTEALKLFNKARRDSDWGNQAVYNMIEICLNPDNNTIGGEVFESVDTEYSNSATERE------KLDSEQMAVRTAEKLLKE-CKPKPGDIRHKLLDNMAKIATKQKPAVEKALNAFMEIASAERDHVGALYGMAAAYMVLKQTPRARNQLKRVAKNNWTMQDAEDLEKSWLLLADIYIQSGKFDMATELLKKCLYHNKASCKAYEYLGFIMEKEQSYKDAANSYENAWKYGNKNNPVIGYKLAFNYMKAKRHVDAIDICHHVLESHPNYPKIRKDILDKA 1287          
BLAST of Tetratricopeptide repeat protein 21B vs. TrEMBL
Match: A0A210QRV3 (Tetratricopeptide repeat protein 21B OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT04242 PE=4 SV=1)

HSP 1 Score: 1108.59 bits (2866), Expect = 0.000e+0
Identity = 576/1350 (42.67%), Postives = 887/1350 (65.70%), Query Frame = 1
Query:   73 MAFEDPELMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQ---QSSNSNPLILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNES---SLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKS-GQSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGD---NLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            MA  DP ++  I Y+ RE Y+        +GL++Y N+  LK   A   I + R QE +REL+LL D+ +VN+ ++++L+   K++   D+  +Q+ + K+++ RK   ++  ++A   LF   ++DKAREY+ R LKM T  K+ + + GWV++ S ++   KKA K FD+A    G  ++D+L GK KY E++ N + A++LV+++IV    F+PAL+EKM+LQL   DW+    TA R L  +  C++A +YQ L +LC +G+Y E S +LG+++  LDR EP++   YH  A  F RICGRN+ VLQQ   L ER +Q +PD+ +Y   LG  +L+Q K +DA++ ++NA+  DE+++ A+ G+I CQL E  L EA+ QLEFL+EIQ +I K++       E  YL+ ++   + +   + I+ L+ +I++HF  L    LG  Y  +LNPDFL+ I+K+Y+ F PQ   Q+  +   +LK+ NQ+L+ + R +PGL +A + L +  F+ GD++ ++  L  CLE D  F + H+LMA ++L   NFK A+ +LEVGLS+NF+VR++PL+HL+K RI  +Q  + E+ K+L  A  LPGV+ + G+   P +    S++ ++R+S++LELA +HRLLGE HE+AK++QDA  +F+ + EE RITI NADL++ RGD+E AL +LR+V  D  Y+V+AR+ MA+IYL +RKDK+LYA+C++EL ++H +P++ +LLGDAYM IQ+P+KAI VYE A +    D  LA+K+G ALVKTHNY +AI YY   +KS GQ+ LR DL+ LL+ L+ YD A+ VL   + +    +  GD    +E  +  VLLA VY+     E+ +  L  A ++Q ++LKR   E P+ +  +K+LA++IC+++A+  +++ D + +IK+YKEAL Y ++  + +L++A L +   D+++CQH  +TLL+           NEK        +AT+M+A+LM ++ ++D+A++H ++LLT  PDH++AL+  ID++RRNG+L+ V  + +  E  + ++TL AGYN+CKGL EWY GN + ALK FN +R DS+W   ++YNM+EICLNPDN TVGG+V +   V G+SA       A+DK +S    ++TAE +L  L      D+R + L  M  I +K K ++EKAL+ F E+  N+ +++ ALYG A   MVLKQ+ +A+  L  I+K NW  + AE++EKS LLLADIYIQ      A D LK CI +NKS  KA+EY G + EKEQ Y+ AS++Y +AW + NKN+P IG+KLAFNY+K +++++++D C  VL+  P YPKI+KEIL+KA
Sbjct:    1 MADIDPVIIGKINYYCREGYFCHMENAATEGLQKYSNDVVLKFFRAYSYILQGRTQEGMRELDLLKDKRDVNLCSVMALMLGHKQSQNVDREALQDLDAKLKEERKQAGELGLYYAAWFLFHSRKFDKAREYIDRMLKMNT-TKDGLVMKGWVELNSGRDP--KKAIKYFDDAIANEGARDIDALFGKAKYFEVRHNYTGALELVNQVIVGYPAFIPALVEKMKLQLALQDWDQTVETAQRALGQDMHCLEALRYQTLYLLCREGNYSEASTKLGDIITTLDRTEPRSASLYHSMAQSFCRICGRNQLVLQQTYTLMERCVQQSPDTADYVNELGFQLLLQGKVKDAMRCYRNAMKMDETSVAALTGIIRCQLLEDQLDEAAQQLEFLNEIQQSIGKSA-------ELSYLSGLLAIKRRQGPEKAIELLNSAIEVHFQGLKGFPLGNRYYLLLNPDFLLQIIKDYLQFAPQTPPQNGQAVSPVLKRCNQVLDPLARAVPGLLEALYYLGRIKFLQGDIDGAQGTLNHCLEVDTTFSDAHILMAQIHLHQSNFKLANQSLEVGLSYNFEVRDSPLYHLIKARILKKQGDHAEAVKTLQMAMTLPGVKTI-GRGNDPKKGKGVSISVNDRVSVFLELAEAHRLLGEQHEAAKVMQDAINEFNNTPEEVRITIANADLSLARGDVEMALGMLRNVTSDQPYYVQAREKMADIYLVHRKDKRLYASCYRELVDKHPSPQTCLLLGDAYMSIQEPEKAIDVYESALKKNPRDAQLASKIGEALVKTHNYGKAINYYEAALKSGGQAFLRHDLAELLLKLRQYDKAEKVLTTALQQ----DTGGDIDLMMEHTKYMVLLARVYQKVDRLEEAMDSLTKARDMQARVLKRAQVEQPDMVQAQKQLASDICVQMAEQTTQQRDYDKAIKFYKEALVYNDNDSKVMLDVAGLYLTTEDLDSCQHQLMTLLK-----------NEKE-----NDAATIMLADLMFRKNEYDSAMYHFQQLLTIKPDHYEALSRQIDLMRRNGKLDEVPKFLEQAENASPRATLDAGYNYCKGLYEWYTGNPTAALKYFNKSRKDSDWGNLSMYNMIEICLNPDNDTVGGEVFET--VEGDSA------GANDKADSEQMAVRTAEKLLKELK-PKPGDIRPKLLENMTLIATKQKANVEKALNAFLEISTNERDHVGALYGMAAAYMVLKQTPRARNQLKRITKNNWTMQDAEDLEKSWLLLADIYIQSAKYDMATDLLKRCITHNKSCCKAHEYMGYIMEKEQSYKDASSNYESAWKYGNKNNPVIGFKLAFNYMKAKRFVDAVDICHYVLEGHPNYPKIRKEILEKA 1310          
BLAST of Tetratricopeptide repeat protein 21B vs. TrEMBL
Match: A0A2T7PR73 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_02893 PE=4 SV=1)

HSP 1 Score: 1102.43 bits (2850), Expect = 0.000e+0
Identity = 578/1342 (43.07%), Postives = 875/1342 (65.20%), Query Frame = 1
Query:  106 ILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCP----QQSSNSNPLILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVR--MVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKS-GQSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECV----ELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDS--ENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            I Y+ RE YY        DGL RYGN+P LK   A   I +DR+QE IREL++L D+ +VN+ ++++L+ A K++P  D+  IQ  + K+++ RK   ++  +FAG+ LFL  ++DKAREY+ R LK+   + E + + GWV++MS +EA  KKA + F++A  K G  N+D+L GK K+ E++ N S A++LV++++V    FLPA +EKM+LQL   DW++    A R L IN  CV+A  YQIL++LC +G++ E+S R+G+LL  LDRYEPK+G  Y     +F+R+ GRN  VLQ    L ERA+ +  ++ ++   LG  ++M  K++DA+K F++A+  DE+++ A+ G+I CQL +  L EA+ QLEFL+EIQ ++ + +       E  YLTA++   K +   ++++ LDE+I+ HF  L    LG +YL +LNPDFL+ IVK  + F P    Q+    NP +LKK   +L+ + R +PGL +  FL+ K  ++SGD+E +++ L+ CL+ D  F + H+LMA ++L   NFK A+ +LEVGLS+NF+VR++PL++L+  RI  +Q    E+ + L  A  LPG++  + S   +    S ++ ++R+S++LELA +HR+L E HE+AK++QDA  +F G+ EE RI I NADL++ RGD+E AL +LR++ PD  YFVEAR+ MAEIYL +RKDKKLYA+C++EL +++ +P + +LLGDAYM IQ+P+KAI VYE A +    D  LA K+G ALVKTHNY +AI YY   +KS GQ +LR DL+ LL+ L+ YD A+ VL      KQ     G +LE +    +  +LLA VY+     ++    L  A ++Q ++LKRV  + P+ L  +K+LA +IC ++A+    + + E +I++YK+AL Y E+  + +L LA L +   D++ CQH  +TLL+ D  N                 SAT+M+A+L+ +R ++DTA++H ++LL K  D+++ALA L+D++RR G+LE V  + +  +  + ++ + AG+++CKGL EWY GN + ALKLFN AR DS+W   ++YNM+EICLNPDN T+GG+V + ++ SG+           DK +S    ++TAE +L  +      D+R   L  M  I +K K ++E+ALS F E+  ++   E+I ALYG A   MVLKQ+ +A+  L  ++K +W  + AE++EKS LLLADIYIQ      A + LK C++YNKSS KAYEY G + EKEQ Y+ A+++Y NAW + NKN+P IGYKLAFNY+K ++Y+++ID C  VL + P YPKIKK+IL+KA
Sbjct:    6 INYYCREGYYGHMETAATDGLHRYGNDPVLKFFAAFAKIMQDRVQEGIRELDILKDKRDVNLCSIMALMFAHKKSPNVDREAIQVLDAKLKEERKQAGELGLYFAGLFLFLNGKHDKAREYIDRMLKIAPSSVEGLTVKGWVELMSGREA--KKAIRFFEDAL-KDGSRNIDALFGKAKFFELKHNYSGALELVNQVVVNYQNFLPAFVEKMKLQLALQDWDNTLEAAQRALDINMHCVEAMVYQILQMLCREGNFAEISSRIGDLLTALDRYEPKSGSLYCHMGQVFSRLSGRNSLVLQLTRTLVERAVSIDSNNADFVNELGVQLVMAGKTKDAMKCFRSAMKLDETSVLALTGIIRCQLLDDQLDEAAQQLEFLNEIQQSLGRPA-------ELAYLTAVLASKKGKGPEKVMEFLDEAIEHHFMGLKGLPLGIQYLVLLNPDFLLQIVKTLLQFAPQVPIQKGQPVNP-VLKKCYMVLDPLTRSVPGLMEGLFLITKVKYLSGDIESAQSTLQHCLDQDATFSDAHILMAQIHLHQNNFKQANQSLEVGLSYNFEVRDHPLYYLISARILKKQGDIKEAAQMLKQAMALPGIKSSVKSAGKKGGKVSDISVNDRVSVFLELAEAHRMLDEQHEAAKVMQDAINEFQGTPEEVRILIANADLSLARGDVEMALGMLRNIQPDQPYFVEAREKMAEIYLHHRKDKKLYASCYRELVDKYPSPHTCLLLGDAYMSIQEPEKAIEVYETALKRNPKDAALATKIGQALVKTHNYGKAINYYEASLKSGGQVSLRHDLAELLLRLRQYDKAEKVL------KQALEAEGQDLETLMEHTKYLLLLARVYQRVDRMDEAHEMLTKARDMQARVLKRVQVDQPDVLPAQKQLAADICSQLAEHSINKRNFEQAIRFYKDALVYNENDSKVMLSLAGLYLSTEDLDACQHQLMTLLKGDKEN----------------DSATIMLADLLFRRNEYDTAMYHFQQLLQKKSDNYEALARLVDLMRRAGKLEEVPRFLEMAQAASPRAQMEAGFSYCKGLYEWYTGNPTAALKLFNKARKDSDWGHLSIYNMIEICLNPDNETIGGEVFESVEGSGSQPVD------KDKTDSDMMAVRTAEKLLKEVK-PKPGDIRPRLLENMALIATKQKQNVERALSAFMEICSSEGQREHIGALYGMAAAYMVLKQTPRARNQLKRVAKSSWTIQDAEDLEKSWLLLADIYIQSGKYDMATELLKRCLQYNKSSCKAYEYLGFIMEKEQSYKDAASNYENAWKYGNKNNPVIGYKLAFNYMKAKRYVDAIDICHHVLTAHPNYPKIKKDILEKA 1307          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Cavefish
Match: ttc21b (tetratricopeptide repeat domain 21B [Source:NCBI gene;Acc:103044557])

HSP 1 Score: 984.941 bits (2545), Expect = 0.000e+0
Identity = 542/1345 (40.30%), Postives = 833/1345 (61.93%), Query Frame = 1
Query:   82 EDPEL-MTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQ----QSSNSNPLILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGV-RMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSGQ-SALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQ-EYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            ED EL +  I+Y+ REKY    +   ++  +R+ N+P     +A  ++ +DR+QE+I+ELE + D+ +V++ AL++LV A K+ P PD+  IQE + K+++ RK  S  + + AGM L+L  R DKAREY+ R +K+++ + E + L GW+D+ S K+A+ KK+ K F+E+  +    N+ +LMGKV+Y E + N S A++ V+++IV    F+PAL +KM+L L   DWE     A R L  +   ++A +   L  LC +G   E  ++L  L+  +D  EP N    +R +  F R+CGR + VLQ    + ERA   A    +    LG  +++Q K+++AIK+++ A++ DES+++A+ G+I CQL+EG L++A  QLEFL EIQ +I K++       E  YL A++   K + Q E+   L++++  HFS L    L  EY   LNPDFL+ I KEY+  CP     Q     P  L+    +L+ VV+ +PGL  A FL+AK  F+SGD E +++ L+ CL+   +F + HLLMA ++L  G+FK +  +LE+ LSHNF+VRE+PL+HL+K +   +  +  E+ ++L  A  LPGV R  S    K     L+ ++ +S+YLELA +  L GE HE+AK++QDA  DF+G+ EE R+TI NADLA+ RGD E AL++LR++  D  Y+V+A++ MA IYL +R++K+LY +C+++L E+  +  + +LLGDAYM IQ+P+ AI VYE+A +    D  +A+K+G ALVKTHNY +AI YY   +KSGQ + LR DL+ LL+ L+  +  + VL + ++     N      E     VLLA++     + ++ +  L  A ++Q K+LKRV  E P+++  +K+LA EIC +IA+  S +   E ++K+YKEAL Y ES  + +LELA+L + + DVE CQ  C  +L+ D  N                 +ATLMMA+LM ++ D++ A+FH ++LL + PD++  L+ LID+LRR G+LE V  + +  E+ + ++    GYN+CKGL  WY G  ++ L+ FN AR D++W + AVYNM+EICLNPDN T+GG+V + LD         +I  + +K  S    ++TAE +L  L     +   Q   L     + +K K ++EKAL  F E+   + + + AL   A   M+LKQ+ +A+  L  I+K+NW    A+E EKS LLLADIYIQ      A + LK C+++NKS  KAYEY G + EKEQ ++ A+ +Y  AW + N+ +PTIGYKLAFNYLK ++++++ID C +VL + P YP+I+K+ILDKA
Sbjct:    5 EDEELTLALIIYYCREKYSTHVLNVSSEAQRRFTNDPVFIFFHAYGLLMQDRVQEAIQELEQVKDKRDVSLCALMALVYAQKKRPHPDKDTIQELDAKVKEDRKSASPKALYHAGMFLWLLGRNDKAREYVDRMIKISSGSTEGIILKGWIDLTSGKDAYAKKSGKYFEESLKEQ--INIFALMGKVQYYEFRQNYSGALETVNQVIVRYPSFMPALEKKMKLLLSLQDWEQTVDAAQRLLQRDKDNLEALRMLTLHSLCREGDIGESVKQLVNLISNIDIQEPNNSELLYRTSLAFTRVCGRAEKVLQHTHTMVERAFSQASGDADLATELGYQLVLQGKTKEAIKWYQTAMSLDESSVSALTGIIRCQLSEGHLEDAEHQLEFLTEIQQSIGKSA-------ELLYLRAVLAIKKRKAQDEVTNLLNDTVDTHFSTLQGLPLSVEYYEKLNPDFLLEIAKEYLALCPAKPPAQGQAPAPQ-LQHCASVLDTVVKIVPGLLHAVFLMAKVRFLSGDTEAAQSSLQHCLDQKPSFADAHLLMAQIHLLQGHFKLSSQSLELCLSHNFEVREHPLYHLIKAQAQRKMGELQEAIQTLQLAMSLPGVKRAGSAAKSKARRVELSAADCVSVYLELAEALWLNGEQHEAAKVMQDAINDFTGTPEELRVTIANADLALLRGDTELALSMLRNITQDQPYYVQAKEKMAGIYLNHRREKRLYVSCYRDLVEKMPSSHTFLLLGDAYMNIQEPELAIEVYEQALKRNPKDGAVASKIGKALVKTHNYAKAINYYEAALKSGQQNFLRYDLAELLMKLKQNERCERVLHEALTH-DPVNELPLLTEDCRYLVLLAKIQSKVNKNDEALLSLHRARDVQAKVLKRVQLEQPDAVPMQKQLAAEICAEIAKHCSNQRGYERAVKFYKEALVYCESDSKVMLELAQLYLTLDDVEACQQQCSVILKNDQVN----------------EAATLMMADLMFRKQDYEQAVFHFQQLLERKPDNYPTLSRLIDLLRRAGKLEEVPRFLEMAEKHSPRAKFEPGYNYCKGLYLWYTGEPNDGLRHFNKARKDNDWGQNAVYNMIEICLNPDNETMGGEVFENLD--------GDIGNSTEKQESEQLAVRTAEKLLKELKPQTPQGHVQLRILEHYCYLATKQKANVEKALGVFTEIANTEKDYVPALLAMATAYMILKQTPRARNQLKRIAKMNWNIIDADEFEKSWLLLADIYIQSGKYDMAGELLKRCLRHNKSCCKAYEYMGYIMEKEQSFRDAAMNYEMAWKYGNQTNPTIGYKLAFNYLKAKRHVDAIDVCHKVLDAHPNYPRIRKDILDKA 1314          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Cavefish
Match: ttc21b (tetratricopeptide repeat domain 21B [Source:NCBI gene;Acc:103044557])

HSP 1 Score: 984.941 bits (2545), Expect = 0.000e+0
Identity = 542/1345 (40.30%), Postives = 833/1345 (61.93%), Query Frame = 1
Query:   82 EDPEL-MTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQ----QSSNSNPLILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGV-RMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSGQ-SALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQ-EYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            ED EL +  I+Y+ REKY    +   ++  +R+ N+P     +A  ++ +DR+QE+I+ELE + D+ +V++ AL++LV A K+ P PD+  IQE + K+++ RK  S  + + AGM L+L  R DKAREY+ R +K+++ + E + L GW+D+ S K+A+ KK+ K F+E+  +    N+ +LMGKV+Y E + N S A++ V+++IV    F+PAL +KM+L L   DWE     A R L  +   ++A +   L  LC +G   E  ++L  L+  +D  EP N    +R +  F R+CGR + VLQ    + ERA   A    +    LG  +++Q K+++AIK+++ A++ DES+++A+ G+I CQL+EG L++A  QLEFL EIQ +I K++       E  YL A++   K + Q E+   L++++  HFS L    L  EY   LNPDFL+ I KEY+  CP     Q     P  L+    +L+ VV+ +PGL  A FL+AK  F+SGD E +++ L+ CL+   +F + HLLMA ++L  G+FK +  +LE+ LSHNF+VRE+PL+HL+K +   +  +  E+ ++L  A  LPGV R  S    K     L+ ++ +S+YLELA +  L GE HE+AK++QDA  DF+G+ EE R+TI NADLA+ RGD E AL++LR++  D  Y+V+A++ MA IYL +R++K+LY +C+++L E+  +  + +LLGDAYM IQ+P+ AI VYE+A +    D  +A+K+G ALVKTHNY +AI YY   +KSGQ + LR DL+ LL+ L+  +  + VL + ++     N      E     VLLA++     + ++ +  L  A ++Q K+LKRV  E P+++  +K+LA EIC +IA+  S +   E ++K+YKEAL Y ES  + +LELA+L + + DVE CQ  C  +L+ D  N                 +ATLMMA+LM ++ D++ A+FH ++LL + PD++  L+ LID+LRR G+LE V  + +  E+ + ++    GYN+CKGL  WY G  ++ L+ FN AR D++W + AVYNM+EICLNPDN T+GG+V + LD         +I  + +K  S    ++TAE +L  L     +   Q   L     + +K K ++EKAL  F E+   + + + AL   A   M+LKQ+ +A+  L  I+K+NW    A+E EKS LLLADIYIQ      A + LK C+++NKS  KAYEY G + EKEQ ++ A+ +Y  AW + N+ +PTIGYKLAFNYLK ++++++ID C +VL + P YP+I+K+ILDKA
Sbjct:    5 EDEELTLALIIYYCREKYSTHVLNVSSEAQRRFTNDPVFIFFHAYGLLMQDRVQEAIQELEQVKDKRDVSLCALMALVYAQKKRPHPDKDTIQELDAKVKEDRKSASPKALYHAGMFLWLLGRNDKAREYVDRMIKISSGSTEGIILKGWIDLTSGKDAYAKKSGKYFEESLKEQ--INIFALMGKVQYYEFRQNYSGALETVNQVIVRYPSFMPALEKKMKLLLSLQDWEQTVDAAQRLLQRDKDNLEALRMLTLHSLCREGDIGESVKQLVNLISNIDIQEPNNSELLYRTSLAFTRVCGRAEKVLQHTHTMVERAFSQASGDADLATELGYQLVLQGKTKEAIKWYQTAMSLDESSVSALTGIIRCQLSEGHLEDAEHQLEFLTEIQQSIGKSA-------ELLYLRAVLAIKKRKAQDEVTNLLNDTVDTHFSTLQGLPLSVEYYEKLNPDFLLEIAKEYLALCPAKPPAQGQAPAPQ-LQHCASVLDTVVKIVPGLLHAVFLMAKVRFLSGDTEAAQSSLQHCLDQKPSFADAHLLMAQIHLLQGHFKLSSQSLELCLSHNFEVREHPLYHLIKAQAQRKMGELQEAIQTLQLAMSLPGVKRAGSAAKSKARRVELSAADCVSVYLELAEALWLNGEQHEAAKVMQDAINDFTGTPEELRVTIANADLALLRGDTELALSMLRNITQDQPYYVQAKEKMAGIYLNHRREKRLYVSCYRDLVEKMPSSHTFLLLGDAYMNIQEPELAIEVYEQALKRNPKDGAVASKIGKALVKTHNYAKAINYYEAALKSGQQNFLRYDLAELLMKLKQNERCERVLHEALTH-DPVNELPLLTEDCRYLVLLAKIQSKVNKNDEALLSLHRARDVQAKVLKRVQLEQPDAVPMQKQLAAEICAEIAKHCSNQRGYERAVKFYKEALVYCESDSKVMLELAQLYLTLDDVEACQQQCSVILKNDQVN----------------EAATLMMADLMFRKQDYEQAVFHFQQLLERKPDNYPTLSRLIDLLRRAGKLEEVPRFLEMAEKHSPRAKFEPGYNYCKGLYLWYTGEPNDGLRHFNKARKDNDWGQNAVYNMIEICLNPDNETMGGEVFENLD--------GDIGNSTEKQESEQLAVRTAEKLLKELKPQTPQGHVQLRILEHYCYLATKQKANVEKALGVFTEIANTEKDYVPALLAMATAYMILKQTPRARNQLKRIAKMNWNIIDADEFEKSWLLLADIYIQSGKYDMAGELLKRCLRHNKSCCKAYEYMGYIMEKEQSFRDAAMNYEMAWKYGNQTNPTIGYKLAFNYLKAKRHVDAIDVCHKVLDAHPNYPRIRKDILDKA 1314          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Cavefish
Match: ttc21b (tetratricopeptide repeat domain 21B [Source:NCBI gene;Acc:103044557])

HSP 1 Score: 984.941 bits (2545), Expect = 0.000e+0
Identity = 542/1345 (40.30%), Postives = 833/1345 (61.93%), Query Frame = 1
Query:   82 EDPEL-MTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQ----QSSNSNPLILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGV-RMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSGQ-SALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQ-EYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            ED EL +  I+Y+ REKY    +   ++  +R+ N+P     +A  ++ +DR+QE+I+ELE + D+ +V++ AL++LV A K+ P PD+  IQE + K+++ RK  S  + + AGM L+L  R DKAREY+ R +K+++ + E + L GW+D+ S K+A+ KK+ K F+E+  +    N+ +LMGKV+Y E + N S A++ V+++IV    F+PAL +KM+L L   DWE     A R L  +   ++A +   L  LC +G   E  ++L  L+  +D  EP N    +R +  F R+CGR + VLQ    + ERA   A    +    LG  +++Q K+++AIK+++ A++ DES+++A+ G+I CQL+EG L++A  QLEFL EIQ +I K++       E  YL A++   K + Q E+   L++++  HFS L    L  EY   LNPDFL+ I KEY+  CP     Q     P  L+    +L+ VV+ +PGL  A FL+AK  F+SGD E +++ L+ CL+   +F + HLLMA ++L  G+FK +  +LE+ LSHNF+VRE+PL+HL+K +   +  +  E+ ++L  A  LPGV R  S    K     L+ ++ +S+YLELA +  L GE HE+AK++QDA  DF+G+ EE R+TI NADLA+ RGD E AL++LR++  D  Y+V+A++ MA IYL +R++K+LY +C+++L E+  +  + +LLGDAYM IQ+P+ AI VYE+A +    D  +A+K+G ALVKTHNY +AI YY   +KSGQ + LR DL+ LL+ L+  +  + VL + ++     N      E     VLLA++     + ++ +  L  A ++Q K+LKRV  E P+++  +K+LA EIC +IA+  S +   E ++K+YKEAL Y ES  + +LELA+L + + DVE CQ  C  +L+ D  N                 +ATLMMA+LM ++ D++ A+FH ++LL + PD++  L+ LID+LRR G+LE V  + +  E+ + ++    GYN+CKGL  WY G  ++ L+ FN AR D++W + AVYNM+EICLNPDN T+GG+V + LD         +I  + +K  S    ++TAE +L  L     +   Q   L     + +K K ++EKAL  F E+   + + + AL   A   M+LKQ+ +A+  L  I+K+NW    A+E EKS LLLADIYIQ      A + LK C+++NKS  KAYEY G + EKEQ ++ A+ +Y  AW + N+ +PTIGYKLAFNYLK ++++++ID C +VL + P YP+I+K+ILDKA
Sbjct:    5 EDEELTLALIIYYCREKYSTHVLNVSSEAQRRFTNDPVFIFFHAYGLLMQDRVQEAIQELEQVKDKRDVSLCALMALVYAQKKRPHPDKDTIQELDAKVKEDRKSASPKALYHAGMFLWLLGRNDKAREYVDRMIKISSGSTEGIILKGWIDLTSGKDAYAKKSGKYFEESLKEQ--INIFALMGKVQYYEFRQNYSGALETVNQVIVRYPSFMPALEKKMKLLLSLQDWEQTVDAAQRLLQRDKDNLEALRMLTLHSLCREGDIGESVKQLVNLISNIDIQEPNNSELLYRTSLAFTRVCGRAEKVLQHTHTMVERAFSQASGDADLATELGYQLVLQGKTKEAIKWYQTAMSLDESSVSALTGIIRCQLSEGHLEDAEHQLEFLTEIQQSIGKSA-------ELLYLRAVLAIKKRKAQDEVTNLLNDTVDTHFSTLQGLPLSVEYYEKLNPDFLLEIAKEYLALCPAKPPAQGQAPAPQ-LQHCASVLDTVVKIVPGLLHAVFLMAKVRFLSGDTEAAQSSLQHCLDQKPSFADAHLLMAQIHLLQGHFKLSSQSLELCLSHNFEVREHPLYHLIKAQAQRKMGELQEAIQTLQLAMSLPGVKRAGSAAKSKARRVELSAADCVSVYLELAEALWLNGEQHEAAKVMQDAINDFTGTPEELRVTIANADLALLRGDTELALSMLRNITQDQPYYVQAKEKMAGIYLNHRREKRLYVSCYRDLVEKMPSSHTFLLLGDAYMNIQEPELAIEVYEQALKRNPKDGAVASKIGKALVKTHNYAKAINYYEAALKSGQQNFLRYDLAELLMKLKQNERCERVLHEALTH-DPVNELPLLTEDCRYLVLLAKIQSKVNKNDEALLSLHRARDVQAKVLKRVQLEQPDAVPMQKQLAAEICAEIAKHCSNQRGYERAVKFYKEALVYCESDSKVMLELAQLYLTLDDVEACQQQCSVILKNDQVN----------------EAATLMMADLMFRKQDYEQAVFHFQQLLERKPDNYPTLSRLIDLLRRAGKLEEVPRFLEMAEKHSPRAKFEPGYNYCKGLYLWYTGEPNDGLRHFNKARKDNDWGQNAVYNMIEICLNPDNETMGGEVFENLD--------GDIGNSTEKQESEQLAVRTAEKLLKELKPQTPQGHVQLRILEHYCYLATKQKANVEKALGVFTEIANTEKDYVPALLAMATAYMILKQTPRARNQLKRIAKMNWNIIDADEFEKSWLLLADIYIQSGKYDMAGELLKRCLRHNKSCCKAYEYMGYIMEKEQSFRDAAMNYEMAWKYGNQTNPTIGYKLAFNYLKAKRHVDAIDVCHKVLDAHPNYPRIRKDILDKA 1314          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Cavefish
Match: ttc21b (tetratricopeptide repeat domain 21B [Source:NCBI gene;Acc:103044557])

HSP 1 Score: 920.613 bits (2378), Expect = 0.000e+0
Identity = 522/1338 (39.01%), Postives = 810/1338 (60.54%), Query Frame = 1
Query:  106 ILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKF--VLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQ----QSSNSNPLILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGV-RMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSGQ-SALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQ-EYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            I+Y+ REKY    +   ++  +R+ N+P     +A  ++ +DR+QE+I+ELE + D+ +V++ AL++LV A K+ P PD+  IQE + K+++ RK  S  + + AGM L+L  R DKAREY+ R +K+++ + E + L GW+D+ S K+A+ KK+ K F+E+  +    N+ +LMGKV+Y E + N S A++ V+++IV    F+PAL +KM+L L   DWE     A R L  +   ++A +   L  LC +G        +GE+  +                 L +   G+N+   VLQ    + ERA   A    +    LG  +++Q K+++AIK+++ A++ DES+++A+ G+I CQL+EG L++A  QLEFL EIQ +I K++       E  YL A++   K + Q E+   L++++  HFS L    L  EY   LNPDFL+ I KEY+  CP     Q     P  L+    +L+ VV+ +PGL  A FL+AK  F+SGD E +++ L+ CL+   +F + HLLMA ++L  G+FK +  +LE+ LSHNF+VRE+PL+HL+K +   +  +  E+ ++L  A  LPGV R  S    K     L+ ++ +S+YLELA +  L GE HE+AK++QDA  DF+G+ EE R+TI NADLA+ RGD E AL++LR++  D  Y+V+A++ MA IYL +R++K+LY +C++ ++     P  + ++    M +Q P+ AI VYE+A +    D  +A+K+G ALVKTHNY +AI YY   +KSGQ + LR DL+ LL+ L+  +  + VL + ++     N      E     VLLA++     + ++ +  L  A ++Q K+LKRV  E P+++  +K+LA EIC +IA+  S +   E ++K+YKEAL Y ES  + +LELA+L + + DVE CQ  C  +L+ D  N                 +ATLMMA+LM ++ D++ A+FH ++LL + PD++  L+ LID+LRR G+LE V  + +  E+ + ++    GYN+CKGL  WY G  ++ L+ FN AR D++W + AVYNM+EICLNPDN T+GG+V + LD         +I  + +K  S    ++TAE +L  L     +   Q   L     + +K K ++EKAL  F E+   + + + AL   A   M+LKQ+ +A+  L  I+K+NW    A+E EKS LLLADIYIQ      A + LK C+++NKS  KAYEY G + EKEQ ++ A+ +Y  AW + N+ +PTIGYKLAFNYLK ++++++ID C +VL + P YP+I+K+ILDKA
Sbjct:   21 IIYYCREKYSTHVLNVSSEAQRRFTNDPVFIFFHAYGLLMQDRVQEAIQELEQVKDKRDVSLCALMALVYAQKKRPHPDKDTIQELDAKVKEDRKSASPKALYHAGMFLWLLGRNDKAREYVDRMIKISSGSTEGIILKGWIDLTSGKDAYAKKSGKYFEESLKEQ--INIFALMGKVQYYEFRQNYSGALETVNQVIVRYPSFMPALEKKMKLLLSLQDWEQTVDAAQRLLQRDKDNLEALRMLTLHSLCREGD-------IGEVCLLF----------------LMSMPNGQNEAEKVLQHTHTMVERAFSQASGDADLATELGYQLVLQGKTKEAIKWYQTAMSLDESSVSALTGIIRCQLSEGHLEDAEHQLEFLTEIQQSIGKSA-------ELLYLRAVLAIKKRKAQDEVTNLLNDTVDTHFSTLQGLPLSVEYYEKLNPDFLLEIAKEYLALCPAKPPAQGQAPAPQ-LQHCASVLDTVVKIVPGLLHAVFLMAKVRFLSGDTEAAQSSLQHCLDQKPSFADAHLLMAQIHLLQGHFKLSSQSLELCLSHNFEVREHPLYHLIKAQAQRKMGELQEAIQTLQLAMSLPGVKRAGSAAKSKARRVELSAADCVSVYLELAEALWLNGEQHEAAKVMQDAINDFTGTPEELRVTIANADLALLRGDTELALSMLRNITQDQPYYVQAKEKMAGIYLNHRREKRLYVSCYRNVSNSKPPPLCMNMIEYDCMYLQ-PELAIEVYEQALKRNPKDGAVASKIGKALVKTHNYAKAINYYEAALKSGQQNFLRYDLAELLMKLKQNERCERVLHEALTH-DPVNELPLLTEDCRYLVLLAKIQSKVNKNDEALLSLHRARDVQAKVLKRVQLEQPDAVPMQKQLAAEICAEIAKHCSNQRGYERAVKFYKEALVYCESDSKVMLELAQLYLTLDDVEACQQQCSVILKNDQVN----------------EAATLMMADLMFRKQDYEQAVFHFQQLLERKPDNYPTLSRLIDLLRRAGKLEEVPRFLEMAEKHSPRAKFEPGYNYCKGLYLWYTGEPNDGLRHFNKARKDNDWGQNAVYNMIEICLNPDNETMGGEVFENLD--------GDIGNSTEKQESEQLAVRTAEKLLKELKPQTPQGHVQLRILEHYCYLATKQKANVEKALGVFTEIANTEKDYVPALLAMATAYMILKQTPRARNQLKRIAKMNWNIIDADEFEKSWLLLADIYIQSGKYDMAGELLKRCLRHNKSCCKAYEYMGYIMEKEQSFRDAAMNYEMAWKYGNQTNPTIGYKLAFNYLKAKRHVDAIDVCHKVLDAHPNYPRIRKDILDKA 1299          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Cavefish
Match: ENSAMXT00000013488.2 (tetratricopeptide repeat domain 21A [Source:NCBI gene;Acc:103036805])

HSP 1 Score: 698.738 bits (1802), Expect = 0.000e+0
Identity = 423/1352 (31.29%), Postives = 742/1352 (54.88%), Query Frame = 1
Query:   73 MAFEDPELMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGG----NNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANL-FARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYM---NFCPQQSSNSNPLILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSGQS-ALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMIN---IESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            MA   P  + +I+YF++E++Y QA+      L+ Y N+  +    A   + E   QE+IREL  L D+P+ ++ ++++L+ A +++  PDQ  + E E  ++  R+   D   +FA +  ++  R +KAR+Y+ R LKM+T + + + L GW+ + S  EA + +A + FD      GG     +V  +MGK ++  ++ N S A+D++S++I ++  F+PAL+ KM + +   DWE     A R L   +  + A +   +     DG  ++++E L  LL+ ++  EP   +  H    L  +R+CG N  V+Q      +RA+  APD+   +  LG ++ +Q K ++A +++  ALN D+ ++ A  G+I CQL +G +++AS QL+F  E+Q ++ +++       E   L AI+ + K   +  ++  L E+ ++H   L     G +YL  LN +FL+ +V  ++      P ++    P  LK    ILE V++  PG+  + + +A+  F+ GD   ++  L  C++ +    E HLL A +++  G+++ +   LE G+SHNF++R+ P ++L+K R      +  ++ + L     +PGVR    ++ +  E+SL+ SER+S++LELA + RL GE HE+A ++QDA   F  + EE R+ + N DLA+ + D+++AL +LR++ P ++ +++ ++ MA IYL+  ++KKLY   ++E+ ++   P S ILL DA+M+IQ+P+KAI VY+EA +M   D     K+  ALV+T+ Y +A++YY   + +  + ++  +L+ LL  LQ ++ A+ +L K + E + + +    +  V+L  +L +V  +Q   E  +  L     +Q ++++R+  E PE    ++++   IC + A+ Y    D E + + Y EAL++     E   ++A+L  +   ++ C+  C  +LQ D  +                ++ ++++ +++ ++   + A+     +L +NP +F ALA LI +L R G L +V  +F   E  +  +    GY++CKGL  W+     EALK  + AR D EW   AV  MV ICLNPD  T GG+V  + +   +S++        D   S   G+  A+ +L +    ++    Q+  R + N   + SK    +EKA+   +E+   +     +L   A G + LKQ  +A+ +L  ISK+ W    AE+ EKS LLLAD+YI       A   L  CI++N S  KAYEY G + E +Q+Y+ A+  Y  AW + +  DP +GY+LAFNYL+++ Y  +ID C QVL   P YP+I+ EILD+A
Sbjct:    1 MAETHPTCLASIIYFLQERFYRQAINSTVSFLRTYPNDSVILFFKAFGALNEGHTQEAIRELTQLRDKPQTSLCSVMALLCAHRQSETPDQEAVSELEACLKTSRRTAEDRDLYFAALLYWILGRNEKARDYVERMLKMSTTSSQGLILKGWIFLTSENEAHRSQAIRYFD------GGLRDSKDVFGMMGKAEFFMLRQNQSCALDMISQVIASHPNFIPALVLKMNMFMSFHDWEQTAEVAERILETETHNLKALQMMTIISEAKDGDMKKVTEYLQLLLRAIEVLEPST-FSLHVDFTLPISRLCGHNSVVVQMLTAFVQRAVSRAPDNSAMDCELGYLLTLQGKYKEAHRWYTKALNIDQGSMAASIGMIKCQLMDGQVEKASQQLDFFQEVQQSLGRSA-------EVSLLQAILAQKKGAAEERVVALLKEATELHLQTLRGLPHGVDYLQRLNLNFLLQVVSMHLANSQDIPLEAGQLPPFGLKHSTMILEAVIKAAPGVLISCYYMARVKFLIGDQAAAQHFLNLCMDKEPTMPEIHLLQAKLHVHTGDYRKSLSCLESGVSHNFELRQMPQYNLIKARALKGIGELTKAIQCLRMLTAMPGVR----RATEGRETSLSLSERVSVFLELADALRLNGEQHEAANVMQDAIWLFKETPEEMRVMVANVDLALAKDDVDTALNVLRTITPGNSCYIQGKEKMANIYLERMRNKKLYIESYREICQQLPGPHSKILLADAFMKIQEPEKAIEVYQEAVKMAPKDATFVKKICQALVRTYQYDKAVEYYMTALSTSMNDSVYLELAELLFKLQHFEKAQHILEKAL-EHENNTSLTTMMNDVKLLRILVKVLHAQ--NEPCLETLQKIYELQQRVVRRLPFEQPEKSDEQRRVTAAICCEQAKEYHYSNDLEKAEQCYSEALNHCPDDTEINFQIAQLYYEHHKLDYCKDQCFKILQHDKKH----------------TATSMLLGDVLFRKNQKEEAISLYTDILHQNPGNFHALARLIHMLHRVGRL-DVLPFFVKCESHSPTAVKEPGYHYCKGLYYWHAYRVKEALKHLSQARGDPEWGEEAVELMVRICLNPDRETFGGEVFKRPEQDQSSSS----PVPSDIDRSELIGVNMAQELLKTFRPRSKAS--QDKARILYNLCLVHSKEPEQVEKAVLMMSEMAGKNVFLEASLLVAAQGLLQLKQFPRARNFLKRISKVQWTHAIAEDFEKSCLLLADMYITMGRNTNAEKLLNDCIQHNMSCSKAYEYKGYMMENDQRYKDAAELYELAWKYSHCVDPAVGYRLAFNYLRSKNYTLAIDVCHQVLLENPDYPQIRDEILDRA 1308          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008071.1 (pep scaffold:Pmarinus_7.0:GL476358:488627:501555:1 gene:ENSPMAG00000007253.1 transcript:ENSPMAT00000008071.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1025.39 bits (2650), Expect = 0.000e+0
Identity = 533/1333 (39.98%), Postives = 836/1333 (62.72%), Query Frame = 1
Query:  112 YFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSN---PLILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQ-KPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSG-QSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKD-LRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            ++ RE+          + +K+YG +P      A+ M+ E+RI E+IRELE    + +V++ ++++L+ A K++   D+  +QE E K+++ RK   + S +F  + L+L  R++KAREY+ R +K+++ AK+ + L GW+D+   K+ F KK+ K  DE   +  G +  +LMGK KY E++ N S A++++++ IV    FLPAL+EKMRLQL   DWE    T  R L  +S  ++A + QIL  LC +G     + R+G+L+  LDR+EP N    HR A +F+R+ GRNK VLQQ   L ERA  + P   E  I LG  ++MQ   ++A+K++++ ++ DE+++ A+ G+I CQL EG L +A  QLE L EIQ +I K+        E  YL A++   + +   E +  LD+++  HF  L+   LG  Y   LNPDF++ IVKEY+ FCP Q        P +LK+   +LE +V+  PG+ +  +L+A+T ++SGD++ ++  L+ CLE   ++ + HLLMA +YL   N+K    +LE+ LSH+F++R++PL+HL+K R+        E+ ++L  A  LPG++  SG ++ K     +  ++R+S++LELA + RL GE HE+AK++QDA  +FSG+ EE R+ I NA+LA+ RGD+ES L++LR + P+  Y+++A++ MA +YL +RKDK LYAAC++EL E+   P + ILLGDAYM IQ+P+KAI VYE+A +    D  LA+K+G ALV+THNY +AI YY   +KSG Q+ LR DL+ LL+ L+ YD A+ VL + + +    N+    +E  +  V LA+V+   G+ +  +  L  A  +Q +ILKRV  E P+ +  +K+LA +IC ++A+    + +++ + K+Y+EAL Y E+  + +LELAR+ M   +++ CQ  C T+L+ D  N                  AT+MMA+L+ ++ D++ A+FH ++L+ + P++F ALA +I++LRR G L     +    E+   +  L  GYN+CKGL  WY G  ++ALK FN AR DS+W ++A+YNM+EICLNPDN  VGG+V + LD  GN +     S+  ++  S    ++TAE +L  L   + +D LR   L     + ++ K S+EKAL+ F ++   + E++ AL G A   M+LKQ+ +A+ +L  + K+ W  E AEE E+S LLLADIYIQ      A + L+ C+++NKS  KAYEY G + EKEQ Y+ A+ +Y  AW + ++++PTIGYKLAFNYLK ++Y+++ID C +VL + P YPK++K+ILDKA
Sbjct:   14 HYCRERLARHVQTAAGEAIKKYGADPVFAFFRALGMLMEERIPEAIRELEASKTKQDVSLCSIIALIYAHKKSSTVDREAVQELEAKLKEDRKTAGEKSLYFGALFLWLIGRHEKAREYIDRMIKISSDAKKGLILKGWIDLTCGKDVFMKKSIKYIDEGLQQ--GKDAFALMGKAKYFELKHNYSGALEVINQAIVAFPSFLPALVEKMRLQLALQDWEQTLETGQRILQKDSHSLEALQMQILHALCREGDSTVAAARIGDLINALDRFEPSNPGLCHRLALVFSRVSGRNKLVLQQTYALVERAFHITPHDAEIAIELGNQLVMQRNFQEAMKHYRHGMSLDETSITALMGIIKCQLFEGRLDDAEQQLELLKEIQESIGKSG-------ELSYLRAVLAVRRQKGLDETLSLLDDAVDTHFVALTGIPLGMLYFEKLNPDFILEIVKEYLTFCPTQPGAPGQALPPVLKQCVTLLETIVKVAPGVMEGLYLMARTKYISGDIDAAQGSLQHCLEKSPSYSDAHLLMAQIYLSQKNYKQCSQSLELALSHSFEIRDHPLYHLIKARVLKETGDVPEALRTLKLAMSLPGMKQRSGATKSKGKVPDINTTDRVSVFLELADALRLNGEQHEAAKVMQDAINEFSGTPEEVRVVISNAELALGRGDVESTLSVLRGISPEQPYYIQAKEKMAHVYLHHRKDKNLYAACYRELVEKLPGPHTFILLGDAYMNIQEPEKAIDVYEQAMKKNPRDGILASKIGQALVRTHNYGKAISYYEAALKSGQQNLLRYDLAELLLMLRQYDKAEKVLRQAL-DHHPVNDLQTLMEDTKYLVQLAKVHSKTGKTDDAVLALTKAREVQARILKRVQVEQPDLVPAQKQLAAQICSQLAEQAIDQREHDKAAKFYREALVYCENDSKVILELARIYMAQDNLDVCQQQCATILRNDVDN----------------DDATMMMADLLFRKHDYEQAIFHFQQLIERKPENFGALARMIELLRRAGTLGEAPRFLMLAEKNGSQRPLDPGYNYCKGLYLWYTGEPNDALKHFNKARKDSDWGQKAIYNMIEICLNPDNDIVGGEVFENLD--GNVS-----SSQRERQESEQMAMRTAEKLLQELRPRSTQDALRVRILENHCLMATRQKASVEKALNAFTDIASTEKEHVPALLGMATAFMILKQTPRARNHLKRVGKMTWNPEEAEEFERSWLLLADIYIQASKYDIAGELLRRCLQHNKSCSKAYEYMGFIMEKEQSYKDAALNYELAWKYTSQSNPTIGYKLAFNYLKGKRYVDAIDICHKVLGAHPDYPKMRKDILDKA 1313          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Nematostella
Match: EDO49516 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGG0])

HSP 1 Score: 1034.63 bits (2674), Expect = 0.000e+0
Identity = 552/1333 (41.41%), Postives = 846/1333 (63.47%), Query Frame = 1
Query:  112 YFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQ---SSNSNPLILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDL-EKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEAR-ITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSG-QSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            Y+ REKYY Q      + L++YGN+  L    A  ++ E    E++RE E + D+PEV + + ++L+ A K+    D+  +QE E+K+R  R+   +M+ +F  M L    + DKAREY+ R +KM+   KE + L GW+D+   +EAF KK+ K FD++       N+D+L GK +YL+++ N S A+D V++ +V   + +PAL+EKMRLQL   DW+    TA R L IN  C++A +  IL +LC DG Y E SE++ EL+  LDR EPKN + Y   +  F+R+CGRN  VLQQ V L +RA  LAP   EY I LG   ++Q K RDA K F+ A+  DE+++ A+ G+I CQL EG L++A  QLEFL+EIQ +I K++       E  YLT+++ R K + Q E+I  L+ +I  HF  L    LG +Y   +NPDFLI +VK+Y+ + P +       +P +LK+   +L+ + + +PGL +  +L+ +  +++G++ + +  +L  CLE D  F + HLLMA + LQ  NFK A+ +LEVGLS+NF+VRE+PL+HL+K R+ M+     +S K+L  A  LPGVR      ++  + ++T S+R+S+YLEL  +HR  G  HE+AKI+QDA  +F  + EE R + I N DLA+ RGD E AL+ILR++ P+  Y+++A++ MAEIYL++RKDK+LYA+ ++EL +++ +P + +LLGDAYM IQ+P+KAI VYE A +    D  LA+K+G A VKTH+Y +AI YY   +KSG Q+ LR DL+ L + L+ YD ++ V++  + E++K+++    +   +L +LLA V+++    E+ ++ L  A  +Q +IL+RV  E P++   +K+LA +IC ++A+  +   + + +I +YKEAL Y ++H ++LL LA+L + + D++ CQ  C+ LL+ D  N                 +AT+MMA+LM ++ ++D+A +H ++LL + P H+ ALA LID+LRR G+LE    Y +  E    ++ + AG+N+CKGL +WY  N + ALK FNIAR D+ W   AVYNMVEICLNPDN T+GG+  + +++  + A          K +S    ++TAE +L  +       L+   L   + + +K+KP++E+AL+ F E+   + + + AL G A   M LKQ+ +A+  L  I+K+NW  E +EE E+S LLLADIYIQ      + D LK C++YNKS  KA+EY G + EKEQ Y+ A+ +Y NAW   N+N+PTIG++LAFNYLK ++++++ID C +VL   P YPKIKK+ILDKA
Sbjct:    3 YYCREKYYRQLQTTCLESLRKYGNDSVLLFWKAFGILMEGNPSEAMREFESIKDKPEVVLCSTMALIYAHKKAKLVDREAVQELESKLRQDRQSCGEMALYFGSMFLLHTGKVDKAREYVDRMIKMSQDTKEGLILRGWIDISCGREAFVKKSIKFFDDS--LKNAKNLDALFGKARYLQLKNNFSGALDTVNQAVVAYPECIPALIEKMRLQLALQDWDQTLETAQRALAINRNCIEAQRMVILFMLCRDGSYTEASEKIVELIHALDRCEPKNPHVYCNISQGFSRLCGRNSLVLQQTVTLIDRAQSLAPADAEYQIELGFQHVLQGKIRDATKAFRAAMKLDETSVPALTGIIRCQLIEGQLEDAEQQLEFLNEIQQSIGKSA-------ELSYLTSVLYRKKGKPQEEVITALNMAIDTHFVSLKGLPLGTQYFVQMNPDFLIQVVKDYLMYAPSEPQSPGQPSPPLLKRCAAVLDPLTKAIPGLLEGLYLMGRVKYLAGNIVDVANAMLAHCLEQDATFSDAHLLMAQIQLQKNNFKQAEQSLEVGLSYNFEVREHPLYHLIKARVQMKMGNAEDSIKTLNAAMNLPGVRKQDTTGKRTRKINITASDRVSVYLELVQAHRHAGHEHEAAKIMQDALNEFQATPEEVRYVLIANVDLALDRGDTEQALSILRAITPEQAYYIKAKEKMAEIYLQHRKDKRLYASVYRELVDKNPSPHTCLLLGDAYMSIQEPEKAIEVYESALKKNPRDGSLASKIGQAYVKTHHYGKAINYYEAALKSGQQNFLRYDLAELYLRLRNYDKSEKVIITAL-EQEKASDLMSLINEAKLLMLLARVHQNHNNTEQTMNTLTKAKEVQTRILRRVTTEQPDAALAQKQLAAKICSEMAEISTASREYDKAINFYKEALVYDDTHIQSLLALAKLYLTVDDLDACQQQCVQLLKADPDN----------------DAATVMMADLMFRKNEYDSATYHFQQLLERKPGHYTALARLIDLLRRAGKLEECPKYLEQAENALPRAAMDAGFNYCKGLYDWYTLNPTGALKHFNIARKDNHWGEHAVYNMVEICLNPDNETLGGETFEAVEIDSSPA---------QKQDSEMMAVRTAEKLLKEMR-PKLNPLKHRILENSVLMATKAKPNVERALAQFMEIATTERDYVPALLGMATAYMYLKQTPRARNQLKRIAKMNWTFEESEEFERSWLLLADIYIQSGKYDMSGDLLKKCLQYNKSCCKAWEYMGFVMEKEQAYKDAAQNYENAWKNGNRNNPTIGFRLAFNYLKAKRFVDAIDVCHKVLSQHPNYPKIKKDILDKA 1299          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Medaka
Match: ttc21b (tetratricopeptide repeat domain 21B [Source:NCBI gene;Acc:101156290])

HSP 1 Score: 937.947 bits (2423), Expect = 0.000e+0
Identity = 517/1342 (38.52%), Postives = 827/1342 (61.62%), Query Frame = 1
Query:   94 LMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNAL-NSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSNPLI---LKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQ-KPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSGQSA-LRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMIN---IESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            L+  ILY+  EKYY+ A+   +D  ++Y NEP     +A   + +D+IQE+  EL+ L D   V++  L++L+ A KR   PD+ +IQE + K+++ RK     S ++AG  L+L  R DKAREY+ R +K++  +KE + L  W+DV S K+++ +KA K FDE   +  G NV +LMGK +Y E + N S A+++V++IIV++  FLPAL++KM+L L   +W+    TA R L  +   ++A +   L  +C DG + E ++ L  L+  LD  EP N   ++R +  F R+CGRNK V++    + ERA  L P   +  I LG  M++  ++++A+K++K +  N + ++++A+ G++ C L EG + +A  QLEFL EIQ +I K+        E  YL A++   K   Q E+   L++++  HFS L    LG EYL  +NPDFL+ I++EY+  CP +           L+   ++L+ VV+ +PGL  A FL+AK  ++ GD++ +++ L  CL+   +  + HLLMA ++L  GN     H+LE+ LS +F++R +PL+HL+  +   +  +  E+ + L  A  LPGVR     S+ K  +  +++++ +SI+LELA +  L G+ HE+AK++QDA  +FSG+ EE RITI NADLA+ RGD+E AL +LR++ P+  Y+++A++ MA IYL ++++K+LY +C++E+ E+  +P + +LLGDAYM I +P+KAI  Y++A +    D  LA+K+G AL+KTHNY EAIKYY   +++ Q   LR DL+ LL+ ++ YD ++ VL   ++ +  +     + +C    VLLA++     + E+ +  L  A ++Q K++KRV  E P+++  +KK+A EIC +IA+ Y+ +   E ++++YKEAL Y E+  + ++ELARL + + + + C+  C  +L++D  N                   TLMMA++M ++ +++ A+FH ++LL + PD++ AL+ +ID+LRR G+LE V  +   +E+ + +S +  G+ +CKGL  WY G  ++AL+ FN AR D++W + AVYNM+EI LNPDN T+GG++ + LD         EI  + +K  S    ++TAE +L  +         Q  LR + N   + +K K +IEKAL+ F+E+  N+ ++  AL   A   M+LKQ+ +A+  L  I+K+NW    A+E EKS LLLADIYI       A D LK C+ +NKS  KAYEY G + EKE  ++ A+ +Y  AW + N+ +P IGYKLAFNYLK +K++E+ID C +VL   P YPKI+KEILDKA
Sbjct:   10 LLALILYYCHEKYYNHAVHATSDAQRKYNNEPKYIFFHAYGTLMQDQIQEATAELDTLRDDRHVSLCTLMALLYAEKRKANPDKEVIQELDAKIKEDRKSAPPKSLYYAGTFLWLLGRNDKAREYIERMIKLSNGSKEGIVLKAWIDVTSGKDSYARKAGKYFDEGLKE--GANVFALMGKAQYYEYRQNYSGALEIVNQIIVSSPGFLPALIKKMKLMLSLQNWDQTVDTADRLLQKDKNNLEALRMLALHSVCRDGDFTEAAKMLSNLMSSLDILEPNNPELFYRMSLAFTRVCGRNKKVIELTFKMVERAFSLVPGDPDLAIELGYQMVLMGRTKEALKWYKTSTSNKEAASISALTGIVRCHLMEGHVDDAEQQLEFLTEIQKSIGKSG-------ELLYLQAVLAAKKRRPQEEVTNLLNDAVDTHFSSLQGLPLGVEYLEKMNPDFLLEIIQEYLALCPAKPPAPGQPPAPQLQHCAKLLDTVVKIVPGLLNAVFLMAKVRYLCGDIDAAQSSLRHCLDQYPSHADAHLLMAQIHLLQGNITLCTHSLELCLSQDFEIRGHPLYHLIMAQAKKKTGELAEAIQILQMAVSLPGVRKAESHSKSKQKKMEMSSADCVSIFLELAEALWLNGQQHEAAKVMQDAITEFSGTSEELRITIANADLALLRGDVELALKMLRNITPEQPYYIQAKEKMANIYLMHKREKRLYVSCYREIVEKRSSPHTYLLLGDAYMNILEPEKAIEAYDQALKKNPKDSILASKMGKALIKTHNYFEAIKYYEAALQTEQHTFLRYDLAELLMKMKQYDRSEKVLHDALAHEPVNELPLLSDDC-RYLVLLAKIQNKVEKNEESLFSLKKARDVQAKVVKRVQLEQPDAVPEQKKIAAEICAEIAKHYTSQRGYERAVQFYKEALVYCETDLKVMVELARLYLTLDEADACKEQCRIILKIDPHN----------------EDTTLMMADIMFRKQEYEQAVFHFQQLLERKPDNYLALSRIIDLLRRAGKLEEVPRFLDMVEKHSFRSKVDPGFYYCKGLYLWYTGQPNDALRHFNKARKDNDWGQNAVYNMIEIYLNPDNDTLGGELFENLD--------GEIGNSTEKQESEQLAVRTAEKLLREIKPQTPGGHIQ--LRILENYCLLATKQKANIEKALNVFSEIASNEKDHAPALLAMATAYMMLKQTPRARNQLKLIAKMNWNLADADEFEKSWLLLADIYIHSGKFDLAGDLLKRCLNHNKSCCKAYEYQGYIMEKEMAFRDAALNYELAWKYGNQTNPNIGYKLAFNYLKAKKHVEAIDVCHKVLALHPHYPKIRKEILDKA 1315          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Medaka
Match: ttc21b (tetratricopeptide repeat domain 21B [Source:NCBI gene;Acc:101156290])

HSP 1 Score: 909.057 bits (2348), Expect = 0.000e+0
Identity = 503/1299 (38.72%), Postives = 803/1299 (61.82%), Query Frame = 1
Query:  223 FEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNAL-NSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSNPLI---LKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQ-KPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSGQSA-LRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMIN---IESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            F D+IQE+  EL+ L D   V++  L++L+ A KR   PD+ +IQE + K+++ RK     S ++AG  L+L  R DKAREY+ R +K++  +KE + L  W+DV S K+++ +KA K FDE   +  G NV +LMGK +Y E + N S A+++V++IIV++  FLPAL++KM+L L   +W+    TA R L  +   ++A +   L  +C DG + E ++ L  L+  LD  EP N   ++R +  F R+CGRNK V++    + ERA  L P   +  I LG  M++  ++++A+K++K +  N + ++++A+ G++ C L EG + +A  QLEFL EIQ +I K+        E  YL A++   K   Q E+   L++++  HFS L    LG EYL  +NPDFL+ I++EY+  CP +           L+   ++L+ VV+ +PGL  A FL+AK  ++ GD++ +++ L  CL+   +  + HLLMA ++L  GN     H+LE+ LS +F++R +PL+HL+  +   +  +  E+ + L  A  LPGVR     S+ K  +  +++++ +SI+LELA +  L G+ HE+AK++QDA  +FSG+ EE RITI NADLA+ RGD+E AL +LR++ P+  Y+++A++ MA IYL ++++K+LY +C++E+ E+  +P + +LLGDAYM I +P+KAI  Y++A +    D  LA+K+G AL+KTHNY EAIKYY   +++ Q   LR DL+ LL+ ++ YD ++ VL   ++ +  +     + +C    VLLA++     + E+ +  L  A ++Q K++KRV  E P+++  +KK+A EIC +IA+ Y+ +   E ++++YKEAL Y E+  + ++ELARL + + + + C+  C  +L++D  N                   TLMMA++M ++ +++ A+FH ++LL + PD++ AL+ +ID+LRR G+LE V  +   +E+ + +S +  G+ +CKGL  WY G  ++AL+ FN AR D++W + AVYNM+EI LNPDN T+GG++ + LD         EI  + +K  S    ++TAE +L  +         Q  LR + N   + +K K +IEKAL+ F+E+  N+ ++  AL   A   M+LKQ+ +A+  L  I+K+NW    A+E EKS LLLADIYI       A D LK C+ +NKS  KAYEY G + EKE  ++ A+ +Y  AW + N+ +P IGYKLAFNYLK +K++E+ID C +VL   P YPKI+KEILDKA
Sbjct:   18 FLDQIQEATAELDTLRDDRHVSLCTLMALLYAEKRKANPDKEVIQELDAKIKEDRKSAPPKSLYYAGTFLWLLGRNDKAREYIERMIKLSNGSKEGIVLKAWIDVTSGKDSYARKAGKYFDEGLKE--GANVFALMGKAQYYEYRQNYSGALEIVNQIIVSSPGFLPALIKKMKLMLSLQNWDQTVDTADRLLQKDKNNLEALRMLALHSVCRDGDFTEAAKMLSNLMSSLDILEPNNPELFYRMSLAFTRVCGRNKKVIELTFKMVERAFSLVPGDPDLAIELGYQMVLMGRTKEALKWYKTSTSNKEAASISALTGIVRCHLMEGHVDDAEQQLEFLTEIQKSIGKSG-------ELLYLQAVLAAKKRRPQEEVTNLLNDAVDTHFSSLQGLPLGVEYLEKMNPDFLLEIIQEYLALCPAKPPAPGQPPAPQLQHCAKLLDTVVKIVPGLLNAVFLMAKVRYLCGDIDAAQSSLRHCLDQYPSHADAHLLMAQIHLLQGNITLCTHSLELCLSQDFEIRGHPLYHLIMAQAKKKTGELAEAIQILQMAVSLPGVRKAESHSKSKQKKMEMSSADCVSIFLELAEALWLNGQQHEAAKVMQDAITEFSGTSEELRITIANADLALLRGDVELALKMLRNITPEQPYYIQAKEKMANIYLMHKREKRLYVSCYREIVEKRSSPHTYLLLGDAYMNILEPEKAIEAYDQALKKNPKDSILASKMGKALIKTHNYFEAIKYYEAALQTEQHTFLRYDLAELLMKMKQYDRSEKVLHDALAHEPVNELPLLSDDC-RYLVLLAKIQNKVEKNEESLFSLKKARDVQAKVVKRVQLEQPDAVPEQKKIAAEICAEIAKHYTSQRGYERAVQFYKEALVYCETDLKVMVELARLYLTLDEADACKEQCRIILKIDPHN----------------EDTTLMMADIMFRKQEYEQAVFHFQQLLERKPDNYLALSRIIDLLRRAGKLEEVPRFLDMVEKHSFRSKVDPGFYYCKGLYLWYTGQPNDALRHFNKARKDNDWGQNAVYNMIEIYLNPDNDTLGGELFENLD--------GEIGNSTEKQESEQLAVRTAEKLLREIKPQTPGGHIQ--LRILENYCLLATKQKANIEKALNVFSEIASNEKDHAPALLAMATAYMMLKQTPRARNQLKLIAKMNWNLADADEFEKSWLLLADIYIHSGKFDLAGDLLKRCLNHNKSCCKAYEYQGYIMEKEMAFRDAALNYELAWKYGNQTNPNIGYKLAFNYLKAKKHVEAIDVCHKVLALHPHYPKIRKEILDKA 1280          
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Medaka
Match: ttc21b (tetratricopeptide repeat domain 21B [Source:NCBI gene;Acc:101156290])

HSP 1 Score: 907.901 bits (2345), Expect = 0.000e+0
Identity = 502/1299 (38.65%), Postives = 803/1299 (61.82%), Query Frame = 1
Query:  223 FEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNAL-NSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSNPLI---LKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQ-KPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSGQSA-LRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMIN---IESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
             +D+IQE+  EL+ L D   V++  L++L+ A KR   PD+ +IQE + K+++ RK     S ++AG  L+L  R DKAREY+ R +K++  +KE + L  W+DV S K+++ +KA K FDE   +  G NV +LMGK +Y E + N S A+++V++IIV++  FLPAL++KM+L L   +W+    TA R L  +   ++A +   L  +C DG + E ++ L  L+  LD  EP N   ++R +  F R+CGRNK V++    + ERA  L P   +  I LG  M++  ++++A+K++K +  N + ++++A+ G++ C L EG + +A  QLEFL EIQ +I K+        E  YL A++   K   Q E+   L++++  HFS L    LG EYL  +NPDFL+ I++EY+  CP +           L+   ++L+ VV+ +PGL  A FL+AK  ++ GD++ +++ L  CL+   +  + HLLMA ++L  GN     H+LE+ LS +F++R +PL+HL+  +   +  +  E+ + L  A  LPGVR     S+ K  +  +++++ +SI+LELA +  L G+ HE+AK++QDA  +FSG+ EE RITI NADLA+ RGD+E AL +LR++ P+  Y+++A++ MA IYL ++++K+LY +C++E+ E+  +P + +LLGDAYM I +P+KAI  Y++A +    D  LA+K+G AL+KTHNY EAIKYY   +++ Q   LR DL+ LL+ ++ YD ++ VL   ++ +  +     + +C    VLLA++     + E+ +  L  A ++Q K++KRV  E P+++  +KK+A EIC +IA+ Y+ +   E ++++YKEAL Y E+  + ++ELARL + + + + C+  C  +L++D  N                   TLMMA++M ++ +++ A+FH ++LL + PD++ AL+ +ID+LRR G+LE V  +   +E+ + +S +  G+ +CKGL  WY G  ++AL+ FN AR D++W + AVYNM+EI LNPDN T+GG++ + LD         EI  + +K  S    ++TAE +L  +         Q  LR + N   + +K K +IEKAL+ F+E+  N+ ++  AL   A   M+LKQ+ +A+  L  I+K+NW    A+E EKS LLLADIYI       A D LK C+ +NKS  KAYEY G + EKE  ++ A+ +Y  AW + N+ +P IGYKLAFNYLK +K++E+ID C +VL   P YPKI+KEILDKA
Sbjct:    1 MQDQIQEATAELDTLRDDRHVSLCTLMALLYAEKRKANPDKEVIQELDAKIKEDRKSAPPKSLYYAGTFLWLLGRNDKAREYIERMIKLSNGSKEGIVLKAWIDVTSGKDSYARKAGKYFDEGLKE--GANVFALMGKAQYYEYRQNYSGALEIVNQIIVSSPGFLPALIKKMKLMLSLQNWDQTVDTADRLLQKDKNNLEALRMLALHSVCRDGDFTEAAKMLSNLMSSLDILEPNNPELFYRMSLAFTRVCGRNKKVIELTFKMVERAFSLVPGDPDLAIELGYQMVLMGRTKEALKWYKTSTSNKEAASISALTGIVRCHLMEGHVDDAEQQLEFLTEIQKSIGKSG-------ELLYLQAVLAAKKRRPQEEVTNLLNDAVDTHFSSLQGLPLGVEYLEKMNPDFLLEIIQEYLALCPAKPPAPGQPPAPQLQHCAKLLDTVVKIVPGLLNAVFLMAKVRYLCGDIDAAQSSLRHCLDQYPSHADAHLLMAQIHLLQGNITLCTHSLELCLSQDFEIRGHPLYHLIMAQAKKKTGELAEAIQILQMAVSLPGVRKAESHSKSKQKKMEMSSADCVSIFLELAEALWLNGQQHEAAKVMQDAITEFSGTSEELRITIANADLALLRGDVELALKMLRNITPEQPYYIQAKEKMANIYLMHKREKRLYVSCYREIVEKRSSPHTYLLLGDAYMNILEPEKAIEAYDQALKKNPKDSILASKMGKALIKTHNYFEAIKYYEAALQTEQHTFLRYDLAELLMKMKQYDRSEKVLHDALAHEPVNELPLLSDDC-RYLVLLAKIQNKVEKNEESLFSLKKARDVQAKVVKRVQLEQPDAVPEQKKIAAEICAEIAKHYTSQRGYERAVQFYKEALVYCETDLKVMVELARLYLTLDEADACKEQCRIILKIDPHN----------------EDTTLMMADIMFRKQEYEQAVFHFQQLLERKPDNYLALSRIIDLLRRAGKLEEVPRFLDMVEKHSFRSKVDPGFYYCKGLYLWYTGQPNDALRHFNKARKDNDWGQNAVYNMIEIYLNPDNDTLGGELFENLD--------GEIGNSTEKQESEQLAVRTAEKLLREIKPQTPGGHIQ--LRILENYCLLATKQKANIEKALNVFSEIASNEKDHAPALLAMATAYMMLKQTPRARNQLKLIAKMNWNLADADEFEKSWLLLADIYIHSGKFDLAGDLLKRCLNHNKSCCKAYEYQGYIMEKEMAFRDAALNYELAWKYGNQTNPNIGYKLAFNYLKAKKHVEAIDVCHKVLALHPHYPKIRKEILDKA 1263          
BLAST of Tetratricopeptide repeat protein 21B vs. Planmine SMEST
Match: SMESG000011579.1 (SMESG000011579.1)

HSP 1 Score: 2724.12 bits (7060), Expect = 0.000e+0
Identity = 1339/1340 (99.93%), Postives = 1339/1340 (99.93%), Query Frame = 1
Query:   73 MAFEDPELMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSNPLILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSGQSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            MAFEDPELMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSNPLILKKI QILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREGDLDLAAKLGLALVKTHNYTEAIKYYRKVVKSGQSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA
Sbjct:    1 MAFEDPELMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSNPLILKKITQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREGDLDLAAKLGLALVKTHNYTEAIKYYRKVVKSGQSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 1340          
BLAST of Tetratricopeptide repeat protein 21B vs. Planmine SMEST
Match: SMESG000011579.1 (SMESG000011579.1)

HSP 1 Score: 2706.01 bits (7013), Expect = 0.000e+0
Identity = 1331/1332 (99.92%), Postives = 1331/1332 (99.92%), Query Frame = 1
Query:   97 MTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSNPLILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSGQSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            MTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSNPLILKKI QILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREGDLDLAAKLGLALVKTHNYTEAIKYYRKVVKSGQSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA
Sbjct:    1 MTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSNPLILKKITQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREGDLDLAAKLGLALVKTHNYTEAIKYYRKVVKSGQSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 1332          
BLAST of Tetratricopeptide repeat protein 21B vs. Planmine SMEST
Match: SMESG000011579.1 (SMESG000011579.1)

HSP 1 Score: 2685.21 bits (6959), Expect = 0.000e+0
Identity = 1324/1332 (99.40%), Postives = 1324/1332 (99.40%), Query Frame = 1
Query:   97 MTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSAKTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSNPLILKKINQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREXXXXXXXXXXXXXVKTHNYTEAIKYYRKVVKSGQSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 4092
            MTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTS       EFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSNPLILKKI QILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREGDLDLAAKLGLALVKTHNYTEAIKYYRKVVKSGQSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA
Sbjct:    1 MTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMIFEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENKMRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLHGWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQAIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCVDAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFARICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKYFKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTS-------EFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEYLYILNPDFLIHIVKEYMNFCPQQSSNSNPLILKKITQILEQVVRFLPGLQQAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNFKSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQLPGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDAQGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKTMAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAITVYEEARQMREGDLDLAAKLGLALVKTHNYTEAIKYYRKVVKSGQSALRKDLSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKSQGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQCYSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLTLLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKKLLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNFCKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGGDVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDLRQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVLKQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCLKTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGYKLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKA 1325          
The following BLAST results are available for this feature:
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTC21B0.000e+042.00tetratricopeptide repeat domain 21B [Source:HGNC S... [more]
TTC21B0.000e+041.14tetratricopeptide repeat domain 21B [Source:HGNC S... [more]
TTC21A0.000e+036.38tetratricopeptide repeat domain 21A [Source:HGNC S... [more]
TTC21A0.000e+035.56tetratricopeptide repeat domain 21A [Source:HGNC S... [more]
TTC21A0.000e+035.55tetratricopeptide repeat domain 21A [Source:HGNC S... [more]
back to top
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ift-1391.868e-14328.39Tetratricopeptide repeat protein 21 homolog [Sour... [more]
ift-1392.556e-10226.95Tetratricopeptide repeat protein 21 homolog [Sour... [more]
back to top
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ttc21b0.000e+039.82tetratricopeptide repeat domain 21B [Source:ZFIN;A... [more]
ttc21b2.081e-2129.17tetratricopeptide repeat domain 21B [Source:ZFIN;A... [more]
CU633479.63.220e-734.78pep chromosome:GRCz11:24:40855741:40860603:-1 gene... [more]
back to top
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTC21B0.000e+042.06tetratricopeptide repeat domain 21B [Source:NCBI g... [more]
TTC21B0.000e+042.06tetratricopeptide repeat domain 21B [Source:NCBI g... [more]
TTC21B0.000e+041.47tetratricopeptide repeat domain 21B [Source:NCBI g... [more]
TTC21B0.000e+041.61tetratricopeptide repeat domain 21B [Source:NCBI g... [more]
TTC21B0.000e+040.87tetratricopeptide repeat domain 21B [Source:NCBI g... [more]
back to top
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ttc21b0.000e+041.19tetratricopeptide repeat domain 21B [Source:MGI Sy... [more]
Ttc21b0.000e+040.18tetratricopeptide repeat domain 21B [Source:MGI Sy... [more]
Ttc21a0.000e+036.70tetratricopeptide repeat domain 21A [Source:MGI Sy... [more]
back to top
BLAST of Tetratricopeptide repeat protein 21B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7Z4L5|TT21B_HUMAN0.000e+042.00Tetratricopeptide repeat protein 21B OS=Homo sapie... [more]
sp|Q0HA38|TT21B_MOUSE0.000e+041.19Tetratricopeptide repeat protein 21B OS=Mus muscul... [more]
sp|Q6INC1|TT21B_XENLA0.000e+037.60Tetratricopeptide repeat protein 21B OS=Xenopus la... [more]
sp|Q8C0S4|TT21A_MOUSE0.000e+036.70Tetratricopeptide repeat protein 21A OS=Mus muscul... [more]
sp|Q8NDW8|TT21A_HUMAN0.000e+036.38Tetratricopeptide repeat protein 21A OS=Homo sapie... [more]
back to top
BLAST of Tetratricopeptide repeat protein 21B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IUI90.000e+043.05tetratricopeptide repeat protein 21B-like OS=Lingu... [more]
A0A1S3HYF20.000e+042.97tetratricopeptide repeat protein 21B OS=Lingula un... [more]
V3ZQE90.000e+043.54Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A210QRV30.000e+042.67Tetratricopeptide repeat protein 21B OS=Mizuhopect... [more]
A0A2T7PR730.000e+043.07Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttc21b0.000e+040.30tetratricopeptide repeat domain 21B [Source:NCBI g... [more]
ttc21b0.000e+040.30tetratricopeptide repeat domain 21B [Source:NCBI g... [more]
ttc21b0.000e+040.30tetratricopeptide repeat domain 21B [Source:NCBI g... [more]
ttc21b0.000e+039.01tetratricopeptide repeat domain 21B [Source:NCBI g... [more]
ENSAMXT00000013488.20.000e+031.29tetratricopeptide repeat domain 21A [Source:NCBI g... [more]
back to top
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008071.10.000e+039.98pep scaffold:Pmarinus_7.0:GL476358:488627:501555:1... [more]
back to top
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO495160.000e+041.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tetratricopeptide repeat protein 21B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ttc21b0.000e+038.52tetratricopeptide repeat domain 21B [Source:NCBI g... [more]
ttc21b0.000e+038.72tetratricopeptide repeat domain 21B [Source:NCBI g... [more]
ttc21b0.000e+038.65tetratricopeptide repeat domain 21B [Source:NCBI g... [more]
back to top
BLAST of Tetratricopeptide repeat protein 21B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000011579.10.000e+099.93SMESG000011579.1[more]
SMESG000011579.10.000e+099.92SMESG000011579.1[more]
SMESG000011579.10.000e+099.40SMESG000011579.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003902 ID=SMED30003902|Name=Tetratricopeptide repeat protein 21B|organism=Schmidtea mediterranea sexual|type=transcript|length=4150bp
ATTTCCAATTTCTTAATATTAATAAGTTTTAATTCAATTTTTAAAATTAG
TGTTTTTATTCGCATTCCATAAATGGCATTTGAAGATCCAGAATTAATGA
CAAATATTCTTTATTTTATTCGCGAAAAATATTACCATCAAGCAATGAAA
TATATAAACGACGGTTTGAAAAGATATGGAAATGAGCCATCCTTAAAATT
ACTGAATGCAGTTTGCATGATCTTTGAAGATCGAATTCAAGAATCCATTA
GAGAATTAGAATTATTAATCGACCGACCAGAAGTCAACATTGGGGCTCTT
CTTTCATTGGTTACTGCAATGAAGCGGACTCCGAAACCAGACCAATCGTT
GATCCAGGAATACGAAAATAAAATGAGAGATTTGCGTAAAGGAGGATCTG
ATATGTCATATTTTTTCGCTGGAATGTGCTTGTTTCTATTTGAGCGCTAT
GACAAGGCCCGTGAATATTTATCCAGGGCCCTTAAAATGACCACCTATGC
GAAAGAGACGATGAATTTACATGGATGGGTCGACGTTATGTCTAACAAGG
AAGCATTTCAAAAGAAGGCAGAAAAACTGTTTGATGAAGCCAATGATAAA
CACGGAGGCAACAATGTTGATTCATTAATGGGAAAAGTTAAATATCTAGA
AATCCAAGGCAACATATCTCAAGCCATAGATTTGGTAAGTAAAATTATTG
TCACCAATAATAAATTCTTACCCGCTCTAATGGAAAAAATGAGGCTGCAA
TTAATAAATGGGGACTGGGAAGATGCCTATGGAACAGCATCAAGATGTTT
GATAATAAATTCCGGCTGCGTTGACGCTTTTAAATATCAAATCCTTAAAG
TTCTTTGTTTAGACGGACACTACGAAGAAATGTCTGAAAGATTAGGAGAA
TTATTACAAATGCTCGATCGGTATGAGCCTAAAAATGGTTACCAATATCA
CAGATGCGCGAATCTGTTTGCTAGAATATGTGGTAGAAATAAATTTGTCT
TGCAACAATGTGTATACCTAGAAGAAAGAGCTCTACAGTTGGCTCCAGAT
AGCGTTGAGTACAATATAGGGTTGGGTCGCATAATGTTAATGCAAAATAA
ATCGCGGGACGCCATCAAGTACTTCAAAAATGCTTTGAATTCAGATGAAT
CTAATTTAAATGCTATTCAAGGAGTCATAGCCTGCCAGTTGAATGAAGGA
ATGTTAAAGGAGGCATCGACTCAGTTGGAATTCCTGCATGAGATTCAATC
AAATATAGAAAAGACTTCAGCTAAAACTGACGATGATAAGGAATTTCGAT
ATCTAACCGCCATAATCAAACGCTTAAAAAATGAAAACCAAGTTGAAATC
ATAAAATGCTTGGATGAGTCCATTCAAATTCACTTTTCTTTTCTTTCGAA
TAAAAACCTTGGCTTTGAATATTTATATATCTTAAATCCGGATTTTTTAA
TCCACATTGTCAAAGAATATATGAACTTTTGTCCTCAGCAATCTTCAAAT
TCCAACCCGTTAATTTTGAAGAAAATAAATCAAATATTAGAACAAGTCGT
TCGATTTCTTCCGGGATTACAGCAAGCCGGTTTTCTTTTGGCAAAGACCT
ACTTTATGAGTGGTGATCTTGAAAAGAGTAAAACCTTACTCGAAACCTGC
CTTGAAGCCGATCAAGCATTTATCGAGGGGCATCTTTTAATGGCTGACGT
ATATTTACAATTGGGAAATTTCAAATCAGCAGATCACACTTTGGAAGTGG
GTCTGAGTCACAACTTCCAAGTTCGCGAGAATCCTCTGTTCCATTTGCTG
AAAGGCAGAATTTATATGCGACAAAATAAATATTTTGAATCTAAAAAGTC
ATTGTTGTACGCTTTTCAATTGCCAGGGGTTCGAATGGTGTCGGGAAAAA
GTCAGAAACCCAATGAAAGTTCCCTTACAAATTCAGAACGTCTTTCAATC
TATTTGGAATTAGCAGTCTCTCACAGACTGCTTGGAGAACATCATGAATC
GGCAAAAATTTTGCAAGACGCACAAGGTGATTTTTCAGGCTCCGACGAAG
AAGCTAGAATTACGATTTGCAATGCCGATCTGGCAGTACAACGTGGAGAC
ATAGAAAGTGCTCTTACAATTTTGAGATCTGTCGGGCCTGATCATAATTA
CTTTGTTGAAGCTCGTAAAACAATGGCTGAAATCTATTTAAAATACAGAA
AAGACAAAAAACTTTACGCAGCTTGTTTCAAAGAGCTTGCGGAACGACAC
AAAACACCAGAATCTTTAATTCTTCTTGGTGATGCTTATATGGAAATTCA
ACAACCTGATAAAGCAATAACTGTTTATGAGGAAGCTCGACAAATGCGGG
AGGGTGATCTAGATTTAGCTGCTAAATTGGGTTTAGCTTTGGTGAAGACT
CATAATTATACCGAAGCTATCAAGTATTATAGAAAAGTTGTTAAGTCCGG
TCAATCCGCCCTGAGAAAAGATCTTTCCAATTTGCTGATTAATCTCCAGC
TTTATGATGATGCCAAAAGTGTCCTCATGAAAGGCATTAGTGAAAAACAA
AAATCTAATAATTATGGCGATAACCTGGAATGTGTAGAGCTATTTGTCCT
TCTGGCCGAGGTTTATAAAAGCCAAGGCGAAGGAGAGAAACAGATTTCGG
AATTATTGTCTGCGCTGAACATCCAGAACAAAATATTAAAGCGAGTGATA
GCTGAGAATCCTGAAAGTTTAGCGGGTGAAAAGAAATTGGCCACAGAGAT
ATGCATAAAAATCGCTCAGTGCTACAGTAAACGGGAAGATAACGAATCAT
CTATAAAATATTACAAAGAAGCTTTGAGTTATCAAGAATCACATCCCGAA
GCATTATTAGAATTGGCAAGACTTCAAATGAAAATTGGAGACGTTGAAAA
TTGTCAACACGGGTGCTTGACTCTTCTTCAGTTGGATGACACAAATCCGC
TTTTTTTGAAATCTAATGAAAAGAATTTGGAAGAATCTTACACAAGCAGT
GCGACATTGATGATGGCCGAACTAATGCTTCAGCGTTTGGACTTCGATAC
TGCATTATTCCATTTGAAAAAGCTTTTGACTAAAAACCCTGATCATTTTA
AAGCTTTGGCGCTATTGATAGATGTTTTAAGACGAAATGGTGAATTAGAG
AATGTTAAAATGTATTTTAAAACCATTGAAGAATTCAATCAAAAGTCTAC
TCTGTCTGCTGGATATAACTTTTGTAAAGGCCTAAGTGAATGGTACATAG
GGAACACATCGGAAGCACTCAAGCTCTTTAACATTGCTCGCCTGGATAGT
GAGTGGGAACGTCGAGCTGTGTACAACATGGTGGAGATTTGTCTGAACCC
AGATAACGCTACAGTCGGAGGAGATGTTCTGGATCAGTTAGATGTCTCTG
GGAATTCCGCAACTCAAGACGAAATATCAGCTGCCGACGACAAAATTAAT
TCAGTGAATTCCGGTTTGAAAACAGCTGAAAATATCTTAAATAGCTTGAG
TACATCCAATGAAAAAGACCTTAGACAAGAATATTTGCGGCAGATGATAA
ATATTGAATCGAAATCAAAACCAAGCATTGAAAAGGCATTATCGTATTTT
AATGAAGTTTTAAAGAATGATAGTGAAAATATTTTGGCGCTCTATGGATG
CGCTGTTGGCAATATGGTCCTAAAGCAGTCAACAAAAGCAAAAGGATATT
TAGTGACCATTTCTAAGATCAATTGGTTAAGAGAATTTGCGGAGGAAATG
GAGAAAAGCATGCTGCTACTAGCTGACATTTACATCCAATTCAAGAACCA
GGCCCAGGCATTGGATTGCCTGAAAACTTGTATCAAATATAATAAAAGTT
CGTACAAAGCTTATGAATACTTTGGTTTACTTCACGAAAAAGAACAGCAA
TATCAAGCGGCTTCAACCGATTACTATAATGCTTGGGTTTTCTGTAATAA
AAATGATCCTACAATCGGTTACAAGTTGGCATTTAATTACTTGAAAACTC
AGAAGTATATTGAATCTATAGATACCTGTCTACAAGTTTTAAAATCTTTT
CCCAAATACCCAAAAATTAAAAAGGAGATCTTGGACAAAGCTCGATTATC
ACTACGTACTTAAAACTCTTTATAATTAACGCAATTTTGTTATCGTTGAA
back to top

protein sequence of SMED30003902-orf-1

>SMED30003902-orf-1 ID=SMED30003902-orf-1|Name=SMED30003902-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1347bp
MAFEDPELMTNILYFIREKYYHQAMKYINDGLKRYGNEPSLKLLNAVCMI
FEDRIQESIRELELLIDRPEVNIGALLSLVTAMKRTPKPDQSLIQEYENK
MRDLRKGGSDMSYFFAGMCLFLFERYDKAREYLSRALKMTTYAKETMNLH
GWVDVMSNKEAFQKKAEKLFDEANDKHGGNNVDSLMGKVKYLEIQGNISQ
AIDLVSKIIVTNNKFLPALMEKMRLQLINGDWEDAYGTASRCLIINSGCV
DAFKYQILKVLCLDGHYEEMSERLGELLQMLDRYEPKNGYQYHRCANLFA
RICGRNKFVLQQCVYLEERALQLAPDSVEYNIGLGRIMLMQNKSRDAIKY
FKNALNSDESNLNAIQGVIACQLNEGMLKEASTQLEFLHEIQSNIEKTSA
KTDDDKEFRYLTAIIKRLKNENQVEIIKCLDESIQIHFSFLSNKNLGFEY
LYILNPDFLIHIVKEYMNFCPQQSSNSNPLILKKINQILEQVVRFLPGLQ
QAGFLLAKTYFMSGDLEKSKTLLETCLEADQAFIEGHLLMADVYLQLGNF
KSADHTLEVGLSHNFQVRENPLFHLLKGRIYMRQNKYFESKKSLLYAFQL
PGVRMVSGKSQKPNESSLTNSERLSIYLELAVSHRLLGEHHESAKILQDA
QGDFSGSDEEARITICNADLAVQRGDIESALTILRSVGPDHNYFVEARKT
MAEIYLKYRKDKKLYAACFKELAERHKTPESLILLGDAYMEIQQPDKAIT
VYEEARQMREGDLDLAAKLGLALVKTHNYTEAIKYYRKVVKSGQSALRKD
LSNLLINLQLYDDAKSVLMKGISEKQKSNNYGDNLECVELFVLLAEVYKS
QGEGEKQISELLSALNIQNKILKRVIAENPESLAGEKKLATEICIKIAQC
YSKREDNESSIKYYKEALSYQESHPEALLELARLQMKIGDVENCQHGCLT
LLQLDDTNPLFLKSNEKNLEESYTSSATLMMAELMLQRLDFDTALFHLKK
LLTKNPDHFKALALLIDVLRRNGELENVKMYFKTIEEFNQKSTLSAGYNF
CKGLSEWYIGNTSEALKLFNIARLDSEWERRAVYNMVEICLNPDNATVGG
DVLDQLDVSGNSATQDEISAADDKINSVNSGLKTAENILNSLSTSNEKDL
RQEYLRQMINIESKSKPSIEKALSYFNEVLKNDSENILALYGCAVGNMVL
KQSTKAKGYLVTISKINWLREFAEEMEKSMLLLADIYIQFKNQAQALDCL
KTCIKYNKSSYKAYEYFGLLHEKEQQYQAASTDYYNAWVFCNKNDPTIGY
KLAFNYLKTQKYIESIDTCLQVLKSFPKYPKIKKEILDKARLSLRT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0042802identical protein binding
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR040364TTC21A/TTC21B
IPR019734TPR_repeat
IPR011990TPR-like_helical_dom_sf
IPR013026TPR-contain_dom
Vocabulary: cellular component
TermDefinition
GO:0000790nuclear chromatin
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005929cilium
GO:0030991intraciliary transport particle A
GO:0042995cell projection
GO:0097542ciliary tip
Vocabulary: biological process
TermDefinition
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0007224smoothened signaling pathway
GO:0008589regulation of smoothened signaling pathway
GO:0021591ventricular system development
GO:0021798forebrain dorsal/ventral pattern formation
GO:0035721intraciliary retrograde transport
GO:0035735intraciliary transport involved in cilium assembly
GO:0061512protein localization to cilium
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 328..361
e-value: 9.6
score: 15.1
coord: 571..604
e-value: 390.0
score: 1.0
coord: 1227..1260
e-value: 22.0
score: 12.0
coord: 1009..1042
e-value: 330.0
score: 1.6
coord: 925..958
e-value: 39.0
score: 9.8
coord: 110..143
e-value: 60.0
score: 8.2
coord: 500..533
e-value: 310.0
score: 1.9
coord: 1261..1294
e-value: 140.0
score: 4.8
coord: 891..924
e-value: 0.0094
score: 25.1
coord: 729..762
e-value: 0.13
score: 21.4
coord: 1296..1329
e-value: 120.0
score: 5.3
coord: 975..1008
e-value: 130.0
score: 5.2
coord: 763..796
e-value: 24.0
score: 11.6
IPR019734Tetratricopeptide repeatPFAMPF13181TPR_8coord: 892..923
e-value: 6.1E-4
score: 19.8
coord: 1228..1258
e-value: 0.046
score: 14.0
coord: 767..791
e-value: 0.081
score: 13.2
IPR019734Tetratricopeptide repeatPFAMPF13176TPR_7coord: 731..755
e-value: 0.037
score: 14.0
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 500..533
score: 5.428
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 763..796
score: 7.877
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 838..871
score: 5.546
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 110..143
score: 7.346
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 891..924
score: 8.054
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 328..361
score: 8.408
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 729..762
score: 8.909
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 1227..1260
score: 6.166
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 975..1008
score: 7.552
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 311..410
e-value: 9.2E-9
score: 37.0
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 1126..1342
e-value: 3.9E-15
score: 57.8
coord: 472..651
e-value: 3.3E-14
score: 54.7
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 652..970
e-value: 5.5E-34
score: 119.7
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 3..152
e-value: 1.1E-5
score: 27.2
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 972..1106
e-value: 6.4E-7
score: 31.0
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 155..307
e-value: 1.9E-5
score: 26.4
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 1169..1331
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 728..1041
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 111..364
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 15..140
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 320..589
IPR040364Tetratricopeptide repeat protein 21A/21BPANTHERPTHR14699STI2 PROTEIN-RELATEDcoord: 7..1345
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 110..143
score: 7.475
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 500..567
score: 8.284
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 318..361
score: 10.541
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 891..1042
score: 11.248
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 1227..1329
score: 10.642
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 729..796
score: 14.987