Potassium voltage-gated channel subfamily KQT member 1

Overview
NamePotassium voltage-gated channel subfamily KQT member 1
Smed IDSMED30003893
Length (bp)1604
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Potassium voltage-gated channel subfamily KQT member 1 (SMED30003893) t-SNE clustered cells

Violin plots show distribution of expression levels for Potassium voltage-gated channel subfamily KQT member 1 (SMED30003893) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Potassium voltage-gated channel subfamily KQT member 1 (SMED30003893) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Potassium voltage-gated channel subfamily KQT member 1 (SMED30003893) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003893

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30003893SMESG000040474.1 SmedASXL_016124SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30003893SMESG000040474.1 dd_Smed_v4_14126_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30003893SMESG000040474.1 dd_Smed_v4_14126_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30003893SMESG000040474.1 dd_Smed_v6_14126_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Human
Match: KCNQ1 (potassium voltage-gated channel subfamily Q member 1 [Source:HGNC Symbol;Acc:HGNC:6294])

HSP 1 Score: 461.84 bits (1187), Expect = 7.372e-156
Identity = 231/330 (70.00%), Postives = 270/330 (81.82%), Query Frame = 2
Query:  143 PKLFIRKRFSAFSVGSRILRPIGGKNPLPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENS--NEPSN-EFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVESSMS 1123
            P + +  R S +S      RP+  +  +  + ++YNFLERPTGWKCF+YHF VF++VLVCLIFSV+STI+ Y  +++  L+ ME +LV FFG EY++RLWS+GCRSKY+G  GRLRF RKPIS+IDLIVVVAS +VL  GSKG+VFATSAIRGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E    NE    EF SYADALWWGVVTVTTIGYGDKVP+TW+GK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA+LIQ  WR +A+    +S  TW+IY +    S +
Sbjct:   83 PPVSLDPRVSIYST----RRPVLARTHV--QGRVYNFLERPTGWKCFVYHFAVFLIVLVCLIFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRVEFGSYADALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSS--TWKIYIRKAPRSHT 404          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Human
Match: KCNQ1 (potassium voltage-gated channel subfamily Q member 1 [Source:HGNC Symbol;Acc:HGNC:6294])

HSP 1 Score: 418.698 bits (1075), Expect = 1.017e-140
Identity = 208/277 (75.09%), Postives = 237/277 (85.56%), Query Frame = 2
Query:  302 FIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENS--NEPSN-EFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVESSMS 1123
            F++VLVCLIFSV+STI+ Y  +++  L+ ME +LV FFG EY++RLWS+GCRSKY+G  GRLRF RKPIS+IDLIVVVAS +VL  GSKG+VFATSAIRGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E    NE    EF SYADALWWGVVTVTTIGYGDKVP+TW+GK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA+LIQ  WR +A+    +S  TW+IY +    S +
Sbjct:    3 FLIVLVCLIFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRVEFGSYADALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSS--TWKIYIRKAPRSHT 277          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Human
Match: KCNQ5 (potassium voltage-gated channel subfamily Q member 5 [Source:HGNC Symbol;Acc:HGNC:6299])

HSP 1 Score: 344.354 bits (882), Expect = 2.721e-113
Identity = 162/291 (55.67%), Postives = 222/291 (76.29%), Query Frame = 2
Query:  242 IYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVES 1114
            +YN LERP GW  F+YH  VF++V  CLI SV STI  + +++S  L I+E +++  FG E+IIR+WS+GC  +Y G+ GRLRF RKP  +ID IV++AS  V+   ++G +FATSA+R +RF+QILRM+ +DR+GGTW+LLGSVVY H +ELIT  YIGFL L+FSS+ VYL E   + + EF +YADALWWG +T+TTIGYGDK P TW+G+++++ F++  ISFFALPAGILGSGFALKVQ++ RQKHF ++   AANLIQC+WR +A+  K  S+ATW+ + + + +
Sbjct:  115 LYNVLERPRGW-AFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIWSAGCCCRYRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFSSFLVYLVE--KDANKEFSTYADALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAANLIQCVWRSYAADEKSVSIATWKPHLKALHT 402          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Human
Match: KCNQ4 (potassium voltage-gated channel subfamily Q member 4 [Source:HGNC Symbol;Acc:HGNC:6298])

HSP 1 Score: 347.436 bits (890), Expect = 7.625e-112
Identity = 170/328 (51.83%), Postives = 233/328 (71.04%), Query Frame = 2
Query:  242 IYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSV-KFNSVATWRIYTQPVESSMSRF----HNRQSNSYPHTRPSNHLSNFCTVPNSP 1210
            +YN LERP GW  F+YH  +F++V  CL+ SV+STI  + E+++  L I+E +++  FG EYI+R+WS+GC  +Y G+ GR RF RKP  +ID IV VAS  V+  G++G +FATSA+R +RF+QILRM+ +DR+GGTW+LLGSVVY H +ELIT  YIGFL L+F+S+ VYL+E   + +++F SYAD+LWWG +T+TTIGYGDK P TW+G+++A+ F++  ISFFALPAGILGSGFALKVQ++ RQKHF ++   AANLIQ  WRL+++ + +    ATW  Y   + S  SR       R  +S   T PS       T+P SP
Sbjct:   87 VYNVLERPRGW-AFVYHVFIFLLVFSCLVLSVLSTIQEHQELANECLLILEFVMIVVFGLEYIVRVWSAGCCCRYRGWQGRFRFARKPFCVIDFIVFVASVAVIAAGTQGNIFATSALRSMRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFASFLVYLAE--KDANSDFSSYADSLWWGTITLTTIGYGDKTPHTWLGRVLAAGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRMPAANLIQAAWRLYSTDMSRAYLTATWYYYDSILPSFSSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSP 411          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Human
Match: KCNQ2 (potassium voltage-gated channel subfamily Q member 2 [Source:HGNC Symbol;Acc:HGNC:6296])

HSP 1 Score: 338.576 bits (867), Expect = 1.332e-111
Identity = 159/300 (53.00%), Postives = 221/300 (73.67%), Query Frame = 2
Query:  242 IYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSV-ATWRIYTQPVESSMSRFHNR 1138
            +YN LERP GW  F+YH  VF++V  CL+ SV STI  Y + S   LYI+E + +  FG EY +R+W++GC  +Y G+ GRL+F RKP  +ID++V++AS  VL  GS+G VFATSA+R +RF+QILRM+ +DR+GGTW+LLGSVVY H +EL+T  YIGFL L+ +S+ VYL+E     ++ F +YADALWWG++T+TTIGYGDK P+TW G+++A+ F++  +SFFALPAGILGSGFALKVQ++ RQKHF ++   AA LIQ  WR +A+++    + +TW+ Y + V   M R+  R
Sbjct:   81 LYNVLERPRGW-AFIYHAYVFLLVFSCLVLSVFSTIKEYEKSSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWRGRLKFARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYIGFLCLILASFLVYLAEKGE--NDHFDTYADALWWGLITLTTIGYGDKYPQTWNGRLLAATFTLIGVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAAGLIQSAWRFYATNLSRTDLHSTWQYYERTVTVPMYRYRRR 377          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Celegans
Match: kqt-3 (Potassium channel, KvQLT family [Source:UniProtKB/TrEMBL;Acc:B7FAS2])

HSP 1 Score: 460.685 bits (1184), Expect = 4.522e-157
Identity = 213/323 (65.94%), Postives = 264/323 (81.73%), Query Frame = 2
Query:  224 LPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSN---EPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVESSMSRFHNRQSNSYPHTRPSNHLS 1183
            + ++  IYN LERPTGWKCFLYHF+VF++VL+CLI SV+ST++ +   ++ LLYI+E +LV FF  E+I+RLWS+GCRSKY+G  GRL+F+RKPI+LIDL+VV+ S  V+ FG++G+VFA SA+RGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E  +   +    F SYADALWWGV+T+TTIGYGD VP+TW+G+I+ASCFS+FAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA LIQCLWR HA+  K +  ATW  +  P+       H+     +  +  SN+L+
Sbjct:   17 MTYRAMIYNCLERPTGWKCFLYHFSVFLIVLICLILSVLSTVEEHSHFAAELLYILEIVLVVFFSVEFIVRLWSAGCRSKYIGVYGRLKFVRKPITLIDLVVVICSLFVICFGTEGQVFAASAMRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDHIGVDGRQAFTSYADALWWGVITMTTIGYGDVVPQTWLGRIVASCFSIFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAATLIQCLWRCHAAEKKVS--ATWNAHIDPLAHETKETHHWNGKKHASSMDSNNLT 337          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Celegans
Match: kqt-3 (Potassium channel, KvQLT family [Source:UniProtKB/TrEMBL;Acc:B7FAS2])

HSP 1 Score: 460.685 bits (1184), Expect = 4.522e-157
Identity = 213/323 (65.94%), Postives = 264/323 (81.73%), Query Frame = 2
Query:  224 LPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSN---EPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVESSMSRFHNRQSNSYPHTRPSNHLS 1183
            + ++  IYN LERPTGWKCFLYHF+VF++VL+CLI SV+ST++ +   ++ LLYI+E +LV FF  E+I+RLWS+GCRSKY+G  GRL+F+RKPI+LIDL+VV+ S  V+ FG++G+VFA SA+RGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E  +   +    F SYADALWWGV+T+TTIGYGD VP+TW+G+I+ASCFS+FAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA LIQCLWR HA+  K +  ATW  +  P+       H+     +  +  SN+L+
Sbjct:   17 MTYRAMIYNCLERPTGWKCFLYHFSVFLIVLICLILSVLSTVEEHSHFAAELLYILEIVLVVFFSVEFIVRLWSAGCRSKYIGVYGRLKFVRKPITLIDLVVVICSLFVICFGTEGQVFAASAMRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDHIGVDGRQAFTSYADALWWGVITMTTIGYGDVVPQTWLGRIVASCFSIFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAATLIQCLWRCHAAEKKVS--ATWNAHIDPLAHETKETHHWNGKKHASSMDSNNLT 337          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Celegans
Match: kqt-3 (Potassium channel, KvQLT family [Source:UniProtKB/TrEMBL;Acc:B7FAS2])

HSP 1 Score: 460.685 bits (1184), Expect = 1.731e-156
Identity = 213/323 (65.94%), Postives = 264/323 (81.73%), Query Frame = 2
Query:  224 LPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSN---EPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVESSMSRFHNRQSNSYPHTRPSNHLS 1183
            + ++  IYN LERPTGWKCFLYHF+VF++VL+CLI SV+ST++ +   ++ LLYI+E +LV FF  E+I+RLWS+GCRSKY+G  GRL+F+RKPI+LIDL+VV+ S  V+ FG++G+VFA SA+RGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E  +   +    F SYADALWWGV+T+TTIGYGD VP+TW+G+I+ASCFS+FAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA LIQCLWR HA+  K +  ATW  +  P+       H+     +  +  SN+L+
Sbjct:   58 MTYRAMIYNCLERPTGWKCFLYHFSVFLIVLICLILSVLSTVEEHSHFAAELLYILEIVLVVFFSVEFIVRLWSAGCRSKYIGVYGRLKFVRKPITLIDLVVVICSLFVICFGTEGQVFAASAMRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDHIGVDGRQAFTSYADALWWGVITMTTIGYGDVVPQTWLGRIVASCFSIFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAATLIQCLWRCHAAEKKVS--ATWNAHIDPLAHETKETHHWNGKKHASSMDSNNLT 378          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Celegans
Match: kqt-3 (Potassium channel, KvQLT family [Source:UniProtKB/TrEMBL;Acc:B7FAS2])

HSP 1 Score: 460.685 bits (1184), Expect = 1.731e-156
Identity = 213/323 (65.94%), Postives = 264/323 (81.73%), Query Frame = 2
Query:  224 LPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSN---EPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVESSMSRFHNRQSNSYPHTRPSNHLS 1183
            + ++  IYN LERPTGWKCFLYHF+VF++VL+CLI SV+ST++ +   ++ LLYI+E +LV FF  E+I+RLWS+GCRSKY+G  GRL+F+RKPI+LIDL+VV+ S  V+ FG++G+VFA SA+RGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E  +   +    F SYADALWWGV+T+TTIGYGD VP+TW+G+I+ASCFS+FAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA LIQCLWR HA+  K +  ATW  +  P+       H+     +  +  SN+L+
Sbjct:   58 MTYRAMIYNCLERPTGWKCFLYHFSVFLIVLICLILSVLSTVEEHSHFAAELLYILEIVLVVFFSVEFIVRLWSAGCRSKYIGVYGRLKFVRKPITLIDLVVVICSLFVICFGTEGQVFAASAMRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDHIGVDGRQAFTSYADALWWGVITMTTIGYGDVVPQTWLGRIVASCFSIFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAATLIQCLWRCHAAEKKVS--ATWNAHIDPLAHETKETHHWNGKKHASSMDSNNLT 378          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Celegans
Match: kqt-3 (Potassium channel, KvQLT family [Source:UniProtKB/TrEMBL;Acc:B7FAS2])

HSP 1 Score: 460.299 bits (1183), Expect = 2.002e-156
Identity = 213/323 (65.94%), Postives = 264/323 (81.73%), Query Frame = 2
Query:  224 LPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSN---EPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVESSMSRFHNRQSNSYPHTRPSNHLS 1183
            + ++  IYN LERPTGWKCFLYHF+VF++VL+CLI SV+ST++ +   ++ LLYI+E +LV FF  E+I+RLWS+GCRSKY+G  GRL+F+RKPI+LIDL+VV+ S  V+ FG++G+VFA SA+RGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E  +   +    F SYADALWWGV+T+TTIGYGD VP+TW+G+I+ASCFS+FAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA LIQCLWR HA+  K +  ATW  +  P+       H+     +  +  SN+L+
Sbjct:   54 MTYRAMIYNCLERPTGWKCFLYHFSVFLIVLICLILSVLSTVEEHSHFAAELLYILEIVLVVFFSVEFIVRLWSAGCRSKYIGVYGRLKFVRKPITLIDLVVVICSLFVICFGTEGQVFAASAMRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDHIGVDGRQAFTSYADALWWGVITMTTIGYGDVVPQTWLGRIVASCFSIFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAATLIQCLWRCHAAEKKVS--ATWNAHIDPLAHETKETHHWNGKKHASSMDSNNLT 374          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Fly
Match: KCNQ (gene:FBgn0033494 transcript:FBtr0299832)

HSP 1 Score: 357.451 bits (916), Expect = 1.433e-115
Identity = 167/289 (57.79%), Postives = 221/289 (76.47%), Query Frame = 2
Query:  230 FKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIY 1096
             ++++YNFLERP G     YH  VF+MV  CL  SV STI  Y E + Y+L+ ME ++V +F  E+  RLWSSGCRS+Y G  GRL+F+++P  +ID++ ++AS +VL  G+ G+VFATSA+RG+RF QILRM+ +DR+GGTW+LLGSVVY HRQELITT+YIGFLGL+F+S+ VY+ E   + +++F ++A ALWWGV+T+ T+GYGD VP TW GK+IASC ++  ISFFALPAGILGSGFALKVQQ+QRQKH  R+   AA LIQ +WR +A+     SVATW I+
Sbjct:   57 LQSRLYNFLERPRGLHAIFYHVMVFLMVFTCLALSVFSTIKEYEEDAVYILFRMEILVVIWFTMEFGARLWSSGCRSRYQGCLGRLKFVKRPFCIIDIVTILASIVVLGMGTSGQVFATSALRGLRFFQILRMVRMDRRGGTWKLLGSVVYAHRQELITTMYIGFLGLIFASFLVYMWE--KDVNDKFSNFAQALWWGVITLCTVGYGDMVPITWQGKLIASCCALLGISFFALPAGILGSGFALKVQQQQRQKHMIRRRQPAATLIQAVWRCYAADEHSVSVATWNIH 343          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Fly
Match: KCNQ (gene:FBgn0033494 transcript:FBtr0299833)

HSP 1 Score: 358.607 bits (919), Expect = 6.066e-115
Identity = 167/289 (57.79%), Postives = 221/289 (76.47%), Query Frame = 2
Query:  230 FKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIY 1096
             ++++YNFLERP G     YH  VF+MV  CL  SV STI  Y E + Y+L+ ME ++V +F  E+  RLWSSGCRS+Y G  GRL+F+++P  +ID++ ++AS +VL  G+ G+VFATSA+RG+RF QILRM+ +DR+GGTW+LLGSVVY HRQELITT+YIGFLGL+F+S+ VY+ E   + +++F ++A ALWWGV+T+ T+GYGD VP TW GK+IASC ++  ISFFALPAGILGSGFALKVQQ+QRQKH  R+   AA LIQ +WR +A+     SVATW I+
Sbjct:   23 LQSRLYNFLERPRGLHAIFYHVMVFLMVFTCLALSVFSTIKEYEEDAVYILFRMEILVVIWFTMEFGARLWSSGCRSRYQGCLGRLKFVKRPFCIIDIVTILASIVVLGMGTSGQVFATSALRGLRFFQILRMVRMDRRGGTWKLLGSVVYAHRQELITTMYIGFLGLIFASFLVYMWE--KDVNDKFSNFAQALWWGVITLCTVGYGDMVPITWQGKLIASCCALLGISFFALPAGILGSGFALKVQQQQRQKHMIRRRQPAATLIQAVWRCYAADEHSVSVATWNIH 309          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Fly
Match: KCNQ (gene:FBgn0033494 transcript:FBtr0310093)

HSP 1 Score: 358.992 bits (920), Expect = 9.202e-115
Identity = 167/289 (57.79%), Postives = 221/289 (76.47%), Query Frame = 2
Query:  230 FKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIY 1096
             ++++YNFLERP G     YH  VF+MV  CL  SV STI  Y E + Y+L+ ME ++V +F  E+  RLWSSGCRS+Y G  GRL+F+++P  +ID++ ++AS +VL  G+ G+VFATSA+RG+RF QILRM+ +DR+GGTW+LLGSVVY HRQELITT+YIGFLGL+F+S+ VY+ E   + +++F ++A ALWWGV+T+ T+GYGD VP TW GK+IASC ++  ISFFALPAGILGSGFALKVQQ+QRQKH  R+   AA LIQ +WR +A+     SVATW I+
Sbjct:   54 LQSRLYNFLERPRGLHAIFYHVMVFLMVFTCLALSVFSTIKEYEEDAVYILFRMEILVVIWFTMEFGARLWSSGCRSRYQGCLGRLKFVKRPFCIIDIVTILASIVVLGMGTSGQVFATSALRGLRFFQILRMVRMDRRGGTWKLLGSVVYAHRQELITTMYIGFLGLIFASFLVYMWE--KDVNDKFSNFAQALWWGVITLCTVGYGDMVPITWQGKLIASCCALLGISFFALPAGILGSGFALKVQQQQRQKHMIRRRQPAATLIQAVWRCYAADEHSVSVATWNIH 340          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Fly
Match: KCNQ (gene:FBgn0033494 transcript:FBtr0310097)

HSP 1 Score: 358.221 bits (918), Expect = 1.137e-114
Identity = 167/289 (57.79%), Postives = 221/289 (76.47%), Query Frame = 2
Query:  230 FKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIY 1096
             ++++YNFLERP G     YH  VF+MV  CL  SV STI  Y E + Y+L+ ME ++V +F  E+  RLWSSGCRS+Y G  GRL+F+++P  +ID++ ++AS +VL  G+ G+VFATSA+RG+RF QILRM+ +DR+GGTW+LLGSVVY HRQELITT+YIGFLGL+F+S+ VY+ E   + +++F ++A ALWWGV+T+ T+GYGD VP TW GK+IASC ++  ISFFALPAGILGSGFALKVQQ+QRQKH  R+   AA LIQ +WR +A+     SVATW I+
Sbjct:   57 LQSRLYNFLERPRGLHAIFYHVMVFLMVFTCLALSVFSTIKEYEEDAVYILFRMEILVVIWFTMEFGARLWSSGCRSRYQGCLGRLKFVKRPFCIIDIVTILASIVVLGMGTSGQVFATSALRGLRFFQILRMVRMDRRGGTWKLLGSVVYAHRQELITTMYIGFLGLIFASFLVYMWE--KDVNDKFSNFAQALWWGVITLCTVGYGDMVPITWQGKLIASCCALLGISFFALPAGILGSGFALKVQQQQRQKHMIRRRQPAATLIQAVWRCYAADEHSVSVATWNIH 343          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Fly
Match: KCNQ (gene:FBgn0033494 transcript:FBtr0301443)

HSP 1 Score: 358.607 bits (919), Expect = 1.448e-114
Identity = 167/289 (57.79%), Postives = 221/289 (76.47%), Query Frame = 2
Query:  230 FKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIY 1096
             ++++YNFLERP G     YH  VF+MV  CL  SV STI  Y E + Y+L+ ME ++V +F  E+  RLWSSGCRS+Y G  GRL+F+++P  +ID++ ++AS +VL  G+ G+VFATSA+RG+RF QILRM+ +DR+GGTW+LLGSVVY HRQELITT+YIGFLGL+F+S+ VY+ E   + +++F ++A ALWWGV+T+ T+GYGD VP TW GK+IASC ++  ISFFALPAGILGSGFALKVQQ+QRQKH  R+   AA LIQ +WR +A+     SVATW I+
Sbjct:   57 LQSRLYNFLERPRGLHAIFYHVMVFLMVFTCLALSVFSTIKEYEEDAVYILFRMEILVVIWFTMEFGARLWSSGCRSRYQGCLGRLKFVKRPFCIIDIVTILASIVVLGMGTSGQVFATSALRGLRFFQILRMVRMDRRGGTWKLLGSVVYAHRQELITTMYIGFLGLIFASFLVYMWE--KDVNDKFSNFAQALWWGVITLCTVGYGDMVPITWQGKLIASCCALLGISFFALPAGILGSGFALKVQQQQRQKHMIRRRQPAATLIQAVWRCYAADEHSVSVATWNIH 343          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Zebrafish
Match: kcnq1.1 (potassium voltage-gated channel, KQT-like subfamily, member 1.1 [Source:ZFIN;Acc:ZDB-GENE-061214-5])

HSP 1 Score: 454.907 bits (1169), Expect = 5.583e-156
Identity = 216/278 (77.70%), Postives = 245/278 (88.13%), Query Frame = 2
Query:  230 FKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSEN---SNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHA 1054
             + ++YNFLERPTGWKCF+YHFTVF++VL CLI SV+STID Y  +++  L+ ME +LV FFG EY++RLWS+GCRSKY+G  GRLRF RKPIS+IDLIVVVAS IVL FGS G+VFATSA+RG+RF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E     +  ++ F SYADALWWGVVTVTTIGYGDKVP+TWIGK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA+LIQ  WR  A
Sbjct:   74 LQGRVYNFLERPTGWKCFVYHFTVFLIVLSCLILSVLSTIDEYQALANKTLFWMELVLVMFFGVEYVVRLWSAGCRSKYVGILGRLRFARKPISVIDLIVVVASIIVLAFGSNGQVFATSAVRGVRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVDDHGNSGFGSYADALWWGVVTVTTIGYGDKVPQTWIGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQASWRCFA 351          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Zebrafish
Match: kcnq1.1 (potassium voltage-gated channel, KQT-like subfamily, member 1.1 [Source:ZFIN;Acc:ZDB-GENE-061214-5])

HSP 1 Score: 459.144 bits (1180), Expect = 2.217e-155
Identity = 216/278 (77.70%), Postives = 245/278 (88.13%), Query Frame = 2
Query:  230 FKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSEN---SNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHA 1054
             + ++YNFLERPTGWKCF+YHFTVF++VL CLI SV+STID Y  +++  L+ ME +LV FFG EY++RLWS+GCRSKY+G  GRLRF RKPIS+IDLIVVVAS IVL FGS G+VFATSA+RG+RF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E     +  ++ F SYADALWWGVVTVTTIGYGDKVP+TWIGK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA+LIQ  WR  A
Sbjct:   74 LQGRVYNFLERPTGWKCFVYHFTVFLIVLSCLILSVLSTIDEYQALANKTLFWMELVLVMFFGVEYVVRLWSAGCRSKYVGILGRLRFARKPISVIDLIVVVASIIVLAFGSNGQVFATSAVRGVRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVDDHGNSGFGSYADALWWGVVTVTTIGYGDKVPQTWIGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQASWRCFA 351          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Zebrafish
Match: kcnq1.1 (potassium voltage-gated channel, KQT-like subfamily, member 1.1 [Source:ZFIN;Acc:ZDB-GENE-061214-5])

HSP 1 Score: 459.144 bits (1180), Expect = 2.612e-155
Identity = 216/278 (77.70%), Postives = 245/278 (88.13%), Query Frame = 2
Query:  230 FKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSEN---SNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHA 1054
             + ++YNFLERPTGWKCF+YHFTVF++VL CLI SV+STID Y  +++  L+ ME +LV FFG EY++RLWS+GCRSKY+G  GRLRF RKPIS+IDLIVVVAS IVL FGS G+VFATSA+RG+RF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E     +  ++ F SYADALWWGVVTVTTIGYGDKVP+TWIGK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA+LIQ  WR  A
Sbjct:   74 LQGRVYNFLERPTGWKCFVYHFTVFLIVLSCLILSVLSTIDEYQALANKTLFWMELVLVMFFGVEYVVRLWSAGCRSKYVGILGRLRFARKPISVIDLIVVVASIIVLAFGSNGQVFATSAVRGVRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVDDHGNSGFGSYADALWWGVVTVTTIGYGDKVPQTWIGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQASWRCFA 351          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Zebrafish
Match: kcnq1.2 (potassium voltage-gated channel, KQT-like subfamily, member 1.2 [Source:ZFIN;Acc:ZDB-GENE-130530-935])

HSP 1 Score: 440.654 bits (1132), Expect = 1.087e-149
Identity = 221/292 (75.68%), Postives = 250/292 (85.62%), Query Frame = 2
Query:  230 FKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSEN---SNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIY 1096
             +  +YNFLERP G +CFLYHF VF+MVLVCLIFSV+STI+ Y + ++  L+ ME +LV FFG EY++RLWS+GCRSKY+G  GRLRF+RKPIS+IDLIVVVAS +VL  GS G+VFATSAIRGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E      E    F SYADALWWGVVTVTTIGYGDKVP+TWIGK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA+LIQ LWR +A     +  ATW++Y
Sbjct:  116 MQGDVYNFLERPAGLRCFLYHFLVFLMVLVCLIFSVLSTIEQYADFATGSLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGIKGRLRFIRKPISIIDLIVVVASVVVLSVGSNGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVDEEGKTGFSSYADALWWGVVTVTTIGYGDKVPQTWIGKAIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTLWRCYACEKSDSCTATWKMY 407          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Zebrafish
Match: kcnq5a (potassium voltage-gated channel, KQT-like subfamily, member 5a [Source:ZFIN;Acc:ZDB-GENE-090312-185])

HSP 1 Score: 349.362 bits (895), Expect = 7.815e-110
Identity = 160/285 (56.14%), Postives = 219/285 (76.84%), Query Frame = 2
Query:  242 IYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIY 1096
            +YN LERP  W  F+YH  VF +V  CL+ SV STI  + ++S++ L I+E +++  FG EYIIR+WS+GC  +Y G+ GRLRF RKP  +ID+IV++AS  V+  GS+G +FATSA+R +RF+QILRM+ +DR+GGTW+LLGSVVY H +EL+T  YIGFL L+FSS+ VYL E   E + +F +YADALWWG +T+TTIGYGDK P+TW G+++++ F++  ISFFALPAGILGSGFALKVQ++ RQKHF ++   AA+LIQC+WR +A+     S+ATW+ +
Sbjct:   94 LYNVLERPRAW-AFVYHAFVFTLVFGCLVLSVFSTIPAHMDLSNHCLLILEFVMIVVFGLEYIIRIWSAGCCCRYRGWQGRLRFARKPFCVIDIIVLIASIAVVSAGSQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELVTAWYIGFLVLIFSSFLVYLVE--KEFNKQFATYADALWWGTITLTTIGYGDKTPQTWTGRLLSAGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAASLIQCVWRSYAADENSVSIATWKPH 375          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Xenopus
Match: ENSXETT00000046791.1 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:100492908])

HSP 1 Score: 483.026 bits (1242), Expect = 1.723e-164
Identity = 238/344 (69.19%), Postives = 275/344 (79.94%), Query Frame = 2
Query:  230 FKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSEN---SNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVE----------SSMSRFHNRQSNSYPHTRPSNHLSNFCTVPNSPQMSP 1222
             +  IYNFLERP+GW+CF+YHF+VF++VL+CLIFSV+STI+ Y E ++  L+ ME +LV FFGAEY+IRLWS+GCRSKY+GF GR+RF RKPIS+IDLIVV+AS IVL  GS G+VFATSAIRGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E      E    F SYADALWWGVVTVTTIGYGDKVP+TWIGK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA+LIQ LWR +A+   ++S ATW+IY  P E          S  SR  NR+       + S  +   C  P SP ++P
Sbjct:   85 MQGDIYNFLERPSGWRCFIYHFSVFLLVLICLIFSVLSTIEHYSEFATGTLFWMEIVLVVFFGAEYLIRLWSAGCRSKYVGFKGRIRFARKPISIIDLIVVIASIIVLSVGSNGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVDEEGRTGFSSYADALWWGVVTVTTIGYGDKVPQTWIGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTLWRCYAAEKSYSSTATWKIYLTPPEQGNKTPMAPASPTSRKQNRRCK-----KKSKSIHEACVNPMSPVLAP 423          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Xenopus
Match: ENSXETT00000046831.1 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:100492908])

HSP 1 Score: 471.47 bits (1212), Expect = 4.237e-164
Identity = 227/296 (76.69%), Postives = 259/296 (87.50%), Query Frame = 2
Query:  233 KTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSEN---SNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVE 1111
            +  IYNFLERP+GW+CF+YHF+VF++VL+CLIFSV+STI+ Y E ++  L+ ME +LV FFGAEY+IRLWS+GCRSKY+GF GR+RF RKPIS+IDLIVV+AS IVL  GS G+VFATSAIRGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E      E    F SYADALWWGVVTVTTIGYGDKVP+TWIGK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA+LIQ LWR +A+   ++S ATW+IY  P E
Sbjct:   57 QGDIYNFLERPSGWRCFIYHFSVFLLVLICLIFSVLSTIEHYSEFATGTLFWMEIVLVVFFGAEYLIRLWSAGCRSKYVGFKGRIRFARKPISIIDLIVVIASIIVLSVGSNGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVDEEGRTGFSSYADALWWGVVTVTTIGYGDKVPQTWIGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTLWRCYAAEKSYSSTATWKIYLTPPE 352          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Xenopus
Match: ENSXETT00000046772.1 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:100492908])

HSP 1 Score: 483.026 bits (1242), Expect = 4.977e-164
Identity = 238/344 (69.19%), Postives = 275/344 (79.94%), Query Frame = 2
Query:  230 FKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSEN---SNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVE----------SSMSRFHNRQSNSYPHTRPSNHLSNFCTVPNSPQMSP 1222
             +  IYNFLERP+GW+CF+YHF+VF++VL+CLIFSV+STI+ Y E ++  L+ ME +LV FFGAEY+IRLWS+GCRSKY+GF GR+RF RKPIS+IDLIVV+AS IVL  GS G+VFATSAIRGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E      E    F SYADALWWGVVTVTTIGYGDKVP+TWIGK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA+LIQ LWR +A+   ++S ATW+IY  P E          S  SR  NR+       + S  +   C  P SP ++P
Sbjct:   85 MQGDIYNFLERPSGWRCFIYHFSVFLLVLICLIFSVLSTIEHYSEFATGTLFWMEIVLVVFFGAEYLIRLWSAGCRSKYVGFKGRIRFARKPISIIDLIVVIASIIVLSVGSNGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVDEEGRTGFSSYADALWWGVVTVTTIGYGDKVPQTWIGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTLWRCYAAEKSYSSTATWKIYLTPPEQGNKTPMAPASPTSRKQNRRCK-----KKSKSIHEACVNPMSPVLAP 423          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Xenopus
Match: ENSXETT00000046823.1 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:100492908])

HSP 1 Score: 472.626 bits (1215), Expect = 5.213e-163
Identity = 227/296 (76.69%), Postives = 259/296 (87.50%), Query Frame = 2
Query:  233 KTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSEN---SNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVE 1111
            +  IYNFLERP+GW+CF+YHF+VF++VL+CLIFSV+STI+ Y E ++  L+ ME +LV FFGAEY+IRLWS+GCRSKY+GF GR+RF RKPIS+IDLIVV+AS IVL  GS G+VFATSAIRGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E      E    F SYADALWWGVVTVTTIGYGDKVP+TWIGK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA+LIQ LWR +A+   ++S ATW+IY  P E
Sbjct:   86 QGDIYNFLERPSGWRCFIYHFSVFLLVLICLIFSVLSTIEHYSEFATGTLFWMEIVLVVFFGAEYLIRLWSAGCRSKYVGFKGRIRFARKPISIIDLIVVIASIIVLSVGSNGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVDEEGRTGFSSYADALWWGVVTVTTIGYGDKVPQTWIGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTLWRCYAAEKSYSSTATWKIYLTPPE 381          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Xenopus
Match: kri1 (KRI1 homolog [Source:Xenbase;Acc:XB-GENE-6036517])

HSP 1 Score: 463.381 bits (1191), Expect = 4.260e-159
Identity = 235/334 (70.36%), Postives = 269/334 (80.54%), Query Frame = 2
Query:  212 GKNPLPFKT----KIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSN---EFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVESSMSRFHNRQSNSYPHTRPSNHLSNFC 1192
            G+ PL  +T    ++YNFLERPTGWKCF+YHFTVF++VL+CLIFSV+STI  Y  +++  L+ ME +LV FFGAEY++RLWS+GCRSKY+G  GRLRF RKPIS+IDLIVVVAS IVL  GS G+VFATSAIRGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E     S+   +F SYADALWWGVVTVTTIGYGDKVP+TWIGK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA+LIQ  WR +A+       ATW+IY +      SR H+  S S  +        N C
Sbjct:   93 GRRPLLTRTNIQGRVYNFLERPTGWKCFVYHFTVFLIVLICLIFSVLSTIQQYNNLATETLFWMEIVLVVFFGAEYVVRLWSAGCRSKYVGIWGRLRFARKPISVIDLIVVVASIIVLCVGSNGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAIDSSGEYQFGSYADALWWGVVTVTTIGYGDKVPQTWIGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAAENP--DSATWKIYIR----KQSRNHHILSPSPKYRGLRKETHNIC 420          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Mouse
Match: Kcnq1 (potassium voltage-gated channel, subfamily Q, member 1 [Source:MGI Symbol;Acc:MGI:108083])

HSP 1 Score: 462.996 bits (1190), Expect = 7.612e-160
Identity = 231/323 (71.52%), Postives = 270/323 (83.59%), Query Frame = 2
Query:  143 PKLFIRKRFSAFSVGSRILRPIGGKNPLPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENS--NEPSN-EFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQ 1102
            P++ +  R S +S      RP+  +  +  + ++YNFLERPTGWKCF+YHFTVF++VLVCLIFSV+STI+ Y  +++  L+ ME +LV FFG EY++RLWS+GCRSKY+G  GRLRF RKPIS+IDLIVVVAS +VL  GSKG+VFATSAIRGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E    NE    EF SYADALWWGVVTVTTIGYGDKVP+TW+GK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA+LIQ  WR +A+  +    ATW+IY +
Sbjct:   18 PRVSLDPRVSIYSA----RRPLLARTHI--QGRVYNFLERPTGWKCFVYHFTVFLIVLVCLIFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGIWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRIEFGSYADALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAA--ENPDSATWKIYVR 332          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Mouse
Match: Kcnq1 (potassium voltage-gated channel, subfamily Q, member 1 [Source:MGI Symbol;Acc:MGI:108083])

HSP 1 Score: 466.848 bits (1200), Expect = 3.986e-158
Identity = 231/323 (71.52%), Postives = 270/323 (83.59%), Query Frame = 2
Query:  143 PKLFIRKRFSAFSVGSRILRPIGGKNPLPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENS--NEPSN-EFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQ 1102
            P++ +  R S +S      RP+  +  +  + ++YNFLERPTGWKCF+YHFTVF++VLVCLIFSV+STI+ Y  +++  L+ ME +LV FFG EY++RLWS+GCRSKY+G  GRLRF RKPIS+IDLIVVVAS +VL  GSKG+VFATSAIRGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E    NE    EF SYADALWWGVVTVTTIGYGDKVP+TW+GK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA+LIQ  WR +A+  +    ATW+IY +
Sbjct:   82 PRVSLDPRVSIYSA----RRPLLARTHI--QGRVYNFLERPTGWKCFVYHFTVFLIVLVCLIFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGIWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRIEFGSYADALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAA--ENPDSATWKIYVR 396          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Mouse
Match: Kcnq5 (potassium voltage-gated channel, subfamily Q, member 5 [Source:MGI Symbol;Acc:MGI:1924937])

HSP 1 Score: 348.977 bits (894), Expect = 1.551e-110
Identity = 162/285 (56.84%), Postives = 219/285 (76.84%), Query Frame = 2
Query:  242 IYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIY 1096
            +YN LERP GW  F+YH  VF++V  CLI SV STI  + +++S  L I+E +++  FG E+IIR+WS+GC  +Y G+ GRLRF RKP  +ID IV++AS  V+   ++G +FATSA+R +RF+QILRM+ +DR+GGTW+LLGSVVY H +ELIT  YIGFL L+FSS+ VYL E   + + EF +YADALWWG +T+TTIGYGDK P TW+G+++++ F++  ISFFALPAGILGSGFALKVQ++ RQKHF ++   AANLIQC+WR +A+  K  S+ATW+ +
Sbjct:  116 LYNVLERPRGW-AFVYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIWSAGCCCRYRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFSSFLVYLVE--KDANKEFSTYADALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAANLIQCVWRSYAADEKSVSIATWKPH 397          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Mouse
Match: Kcnq5 (potassium voltage-gated channel, subfamily Q, member 5 [Source:MGI Symbol;Acc:MGI:1924937])

HSP 1 Score: 349.362 bits (895), Expect = 9.533e-110
Identity = 162/285 (56.84%), Postives = 219/285 (76.84%), Query Frame = 2
Query:  242 IYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIY 1096
            +YN LERP GW  F+YH  VF++V  CLI SV STI  + +++S  L I+E +++  FG E+IIR+WS+GC  +Y G+ GRLRF RKP  +ID IV++AS  V+   ++G +FATSA+R +RF+QILRM+ +DR+GGTW+LLGSVVY H +ELIT  YIGFL L+FSS+ VYL E   + + EF +YADALWWG +T+TTIGYGDK P TW+G+++++ F++  ISFFALPAGILGSGFALKVQ++ RQKHF ++   AANLIQC+WR +A+  K  S+ATW+ +
Sbjct:  116 LYNVLERPRGW-AFVYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIWSAGCCCRYRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFSSFLVYLVE--KDANKEFSTYADALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAANLIQCVWRSYAADEKSVSIATWKPH 397          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Mouse
Match: Kcnq5 (potassium voltage-gated channel, subfamily Q, member 5 [Source:MGI Symbol;Acc:MGI:1924937])

HSP 1 Score: 348.977 bits (894), Expect = 9.914e-110
Identity = 162/285 (56.84%), Postives = 219/285 (76.84%), Query Frame = 2
Query:  242 IYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIY 1096
            +YN LERP GW  F+YH  VF++V  CLI SV STI  + +++S  L I+E +++  FG E+IIR+WS+GC  +Y G+ GRLRF RKP  +ID IV++AS  V+   ++G +FATSA+R +RF+QILRM+ +DR+GGTW+LLGSVVY H +ELIT  YIGFL L+FSS+ VYL E   + + EF +YADALWWG +T+TTIGYGDK P TW+G+++++ F++  ISFFALPAGILGSGFALKVQ++ RQKHF ++   AANLIQC+WR +A+  K  S+ATW+ +
Sbjct:  116 LYNVLERPRGW-AFVYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIWSAGCCCRYRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFSSFLVYLVE--KDANKEFSTYADALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAANLIQCVWRSYAADEKSVSIATWKPH 397          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. UniProt/SwissProt
Match: sp|O73925|KCNQ1_SQUAC (Potassium voltage-gated channel subfamily KQT member 1 OS=Squalus acanthias OX=7797 GN=KCNQ1 PE=2 SV=1)

HSP 1 Score: 471.47 bits (1212), Expect = 4.186e-159
Identity = 232/308 (75.32%), Postives = 262/308 (85.06%), Query Frame = 2
Query:  212 GKNPLPFKTKI----YNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSEN---SNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYT-QPVE 1111
            G+NP   K  I    YNFLERPTGWKCF+YHFTVF++VLVCLIFSV+STI+ Y+  ++  L  ME +LV FFG EYI+RLWS+GCRSKY+GF GRLRF RKPIS+IDLIVVVAS IVL  GS G+VFATSAIRGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E     +  S +F SYADALWWGVVTVTTIGYGDKVP+TWIG+ IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA+LIQ  WR HA+  + +  ATW++Y  QP +
Sbjct:   89 GRNPFFSKVNIQGRTYNFLERPTGWKCFIYHFTVFLIVLVCLIFSVMSTIEQYHYFANRALVWMEIVLVVFFGTEYIVRLWSAGCRSKYVGFWGRLRFARKPISIIDLIVVVASVIVLCVGSNGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVDDSGSQQFGSYADALWWGVVTVTTIGYGDKVPQTWIGRTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTSWRCHAA--ENHESATWKMYVRQPTK 394          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. UniProt/SwissProt
Match: sp|Q9MYS6|KCNQ1_RABIT (Potassium voltage-gated channel subfamily KQT member 1 OS=Oryctolagus cuniculus OX=9986 GN=KCNQ1 PE=2 SV=3)

HSP 1 Score: 467.618 bits (1202), Expect = 1.308e-157
Identity = 233/326 (71.47%), Postives = 270/326 (82.82%), Query Frame = 2
Query:  128 DKLSIPKLFIRKRFSAFSVGSRILRPIGGKNPLPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENS--NEPSN-EFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIY 1096
            D+   P + +  R S +SV     RP+  +  +  + ++YNFLERPTGWKCF YHFTVF++VLVCLIFSV+STI+ Y  +++  L+ ME +LV FFG EY++RLWS+GCRSKY+G  GRLRF RKPIS+IDLIVVVAS +VL  GSKG+VFATSAIRGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E    NE    EF SYADALWWGVVTVTTIGYGDKVP+TW+GK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA+LIQ  WR +A+  +    ATW+IY
Sbjct:   77 DQGPQPPVSLDPRVSIYSV----RRPLLARTHI--QGRVYNFLERPTGWKCFAYHFTVFLIVLVCLIFSVLSTIEQYATLATGTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRVEFGSYADALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAA--ENPDSATWKIY 394          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. UniProt/SwissProt
Match: sp|P70057|KCNQ1_XENLA (Potassium voltage-gated channel subfamily KQT member 1 OS=Xenopus laevis OX=8355 GN=kcnq1 PE=1 SV=2)

HSP 1 Score: 466.848 bits (1200), Expect = 2.161e-157
Identity = 233/320 (72.81%), Postives = 267/320 (83.44%), Query Frame = 2
Query:  212 GKNPLPFKT----KIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSN---EFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVESSMSRFHNRQSNS 1150
            G+ PL  +T    ++YNFLERPTGWKCF+YHFTVF++VL+CLIFSV+STI  Y  +++  L+ ME +LV FFGAEY++RLWS+GCRSKY+G  GRLRF RKPIS+IDLIVVVAS IVL  GS G+VFATSAIRGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E     S+   +F SYADALWWGVVTVTTIGYGDKVP+TWIGK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA+LIQ  WR +A+  +    ATW+IY +      SR H+  S S
Sbjct:   86 GRRPLLSRTNIQGRVYNFLERPTGWKCFVYHFTVFLIVLICLIFSVLSTIQQYNNLATETLFWMEIVLVVFFGAEYVVRLWSAGCRSKYVGVWGRLRFARKPISVIDLIVVVASVIVLCVGSNGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAIDSSGEYQFGSYADALWWGVVTVTTIGYGDKVPQTWIGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAA--ENPDSATWKIYIR----KQSRNHHLMSPS 399          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. UniProt/SwissProt
Match: sp|P97414|KCNQ1_MOUSE (Potassium voltage-gated channel subfamily KQT member 1 OS=Mus musculus OX=10090 GN=Kcnq1 PE=1 SV=3)

HSP 1 Score: 466.848 bits (1200), Expect = 2.788e-157
Identity = 231/323 (71.52%), Postives = 270/323 (83.59%), Query Frame = 2
Query:  143 PKLFIRKRFSAFSVGSRILRPIGGKNPLPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENS--NEPSN-EFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQ 1102
            P++ +  R S +S      RP+  +  +  + ++YNFLERPTGWKCF+YHFTVF++VLVCLIFSV+STI+ Y  +++  L+ ME +LV FFG EY++RLWS+GCRSKY+G  GRLRF RKPIS+IDLIVVVAS +VL  GSKG+VFATSAIRGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E    NE    EF SYADALWWGVVTVTTIGYGDKVP+TW+GK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA+LIQ  WR +A+  +    ATW+IY +
Sbjct:   82 PRVSLDPRVSIYSA----RRPLLARTHI--QGRVYNFLERPTGWKCFVYHFTVFLIVLVCLIFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGIWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRIEFGSYADALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAA--ENPDSATWKIYVR 396          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. UniProt/SwissProt
Match: sp|Q9Z0N7|KCNQ1_RAT (Potassium voltage-gated channel subfamily KQT member 1 OS=Rattus norvegicus OX=10116 GN=Kcnq1 PE=1 SV=1)

HSP 1 Score: 464.922 bits (1195), Expect = 2.062e-156
Identity = 231/323 (71.52%), Postives = 270/323 (83.59%), Query Frame = 2
Query:  143 PKLFIRKRFSAFSVGSRILRPIGGKNPLPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENS--NEPSN-EFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQ 1102
            P++ +  R S +S      RP+  +  +  + ++YNFLERPTGWKCF+YHFTVF++VLVCLIFSV+STI+ Y  +++  L+ ME +LV FFG EY++RLWS+GCRSKY+G  GRLRF RKPIS+IDLIVVVAS +VL  GSKG+VFATSAIRGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E    NE    EF SYADALWWGVVTVTTIGYGDKVP+TW+GK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA+LIQ  WR +A+    +S  TW+IY +
Sbjct:   83 PRVSLDPRVSIYST----RRPLLARTHI--QGRVYNFLERPTGWKCFVYHFTVFLIVLVCLIFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGIWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRIEFGSYADALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSS--TWKIYVR 397          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. TrEMBL
Match: V4AJI8 (Ion_trans domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_81703 PE=3 SV=1)

HSP 1 Score: 481.1 bits (1237), Expect = 1.067e-165
Identity = 226/293 (77.13%), Postives = 261/293 (89.08%), Query Frame = 2
Query:  233 KTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSEN---SNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQ 1102
            + K+YNFLERPTGWKCF+YHFTVF+MVL+CLIFSV+STI+ Y E ++  L+ ME +LV FFG EY+IRLWS+GCRSKY+G SGR RF RKPIS+ID +VVVAS +VL  GS G+VFATSAIRG+RF+QILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGL+FSSYFVYL+E    S + + +F SYADALWWGV+TVTTIGYGD VPKTW+G+I+ASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIP AA+LIQCLWR HA+   F+S+ATW+I+TQ
Sbjct:    5 QNKMYNFLERPTGWKCFVYHFTVFMMVLICLIFSVLSTIEQYTEFANETLFWMEIVLVVFFGLEYVIRLWSAGCRSKYMGISGRFRFARKPISIIDFLVVVASIVVLSVGSNGQVFATSAIRGVRFLQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVSPDGTTDFTSYADALWWGVITVTTIGYGDTVPKTWMGRIVASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPTAASLIQCLWRCHAAEAGFDSIATWQIHTQ 297          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. TrEMBL
Match: A0A1I8IRF1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 491.5 bits (1264), Expect = 5.122e-165
Identity = 233/298 (78.19%), Postives = 260/298 (87.25%), Query Frame = 2
Query:  224 LPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEP---SNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPV 1108
            +  +T+IYNFLERPTGWKCF YHFTVF+MVL+CLIFSV+STID +   ++  L+ ME +LV FF  EY  RLWS+GCRSKY+GF GRLRF RKPISLIDLIVVVAS +VL FGS G+VFATSAIRG+RF+QILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGL+FSSYFV+L+E  N P   SN+F SYADALWWGV+TVTTIGYGD VPKTW+GKI+ASCFSVFAISFFALP+GILGSGFALKVQQKQRQKHFNRQIPAAA LIQCLWR +A S     VATWRIYT P+
Sbjct:  101 VSMQTRIYNFLERPTGWKCFGYHFTVFMMVLICLIFSVLSTIDEFTNFANETLFWMEIVLVVFFSLEYGTRLWSAGCRSKYMGFRGRLRFARKPISLIDLIVVVASIVVLSFGSNGQVFATSAIRGVRFLQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLIFSSYFVFLAEKDNNPEGQSNDFKSYADALWWGVITVTTIGYGDTVPKTWLGKIVASCFSVFAISFFALPSGILGSGFALKVQQKQRQKHFNRQIPAAATLIQCLWRCYACSPNAGFVATWRIYTDPM 398          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. TrEMBL
Match: A0A1I8HV44 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 491.115 bits (1263), Expect = 7.329e-165
Identity = 233/298 (78.19%), Postives = 260/298 (87.25%), Query Frame = 2
Query:  224 LPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEP---SNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPV 1108
            +  +T+IYNFLERPTGWKCF YHFTVF+MVL+CLIFSV+STID +   ++  L+ ME +LV FF  EY  RLWS+GCRSKY+GF GRLRF RKPISLIDLIVVVAS +VL FGS G+VFATSAIRG+RF+QILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGL+FSSYFV+L+E  N P   SN+F SYADALWWGV+TVTTIGYGD VPKTW+GKI+ASCFSVFAISFFALP+GILGSGFALKVQQKQRQKHFNRQIPAAA LIQCLWR +A S     VATWRIYT P+
Sbjct:  101 VSMQTRIYNFLERPTGWKCFGYHFTVFMMVLICLIFSVLSTIDEFTNFANETLFWMEIVLVVFFSLEYGTRLWSAGCRSKYMGFRGRLRFARKPISLIDLIVVVASIVVLSFGSNGQVFATSAIRGVRFLQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLIFSSYFVFLAEKDNNPEGQSNDFKSYADALWWGVITVTTIGYGDTVPKTWLGKIVASCFSVFAISFFALPSGILGSGFALKVQQKQRQKHFNRQIPAAATLIQCLWRCYACSPNAGFVATWRIYTDPM 398          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. TrEMBL
Match: A0A267EPI5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009604g2 PE=3 SV=1)

HSP 1 Score: 491.115 bits (1263), Expect = 1.012e-164
Identity = 233/298 (78.19%), Postives = 260/298 (87.25%), Query Frame = 2
Query:  224 LPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEP---SNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPV 1108
            +  +T+IYNFLERPTGWKCF YHFTVF+MVL+CLIFSV+STID +   ++  L+ ME +LV FF  EY  RLWS+GCRSKY+GF GRLRF RKPISLIDLIVVVAS +VL FGS G+VFATSAIRG+RF+QILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGL+FSSYFV+L+E  N P   SN+F SYADALWWGV+TVTTIGYGD VPKTW+GKI+ASCFSVFAISFFALP+GILGSGFALKVQQKQRQKHFNRQIPAAA LIQCLWR +A S     VATWRIYT P+
Sbjct:  101 VSMQTRIYNFLERPTGWKCFGYHFTVFMMVLICLIFSVLSTIDEFTNFANETLFWMEIVLVVFFSLEYGTRLWSAGCRSKYMGFRGRLRFARKPISLIDLIVVVASIVVLSFGSNGQVFATSAIRGVRFLQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLIFSSYFVFLAEKDNNPEGQSNDFKSYADALWWGVITVTTIGYGDTVPKTWLGKIVASCFSVFAISFFALPSGILGSGFALKVQQKQRQKHFNRQIPAAATLIQCLWRCYACSPNAGFVATWRIYTDPM 398          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. TrEMBL
Match: A0A2T7P771 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_11871 PE=3 SV=1)

HSP 1 Score: 488.034 bits (1255), Expect = 2.262e-164
Identity = 238/363 (65.56%), Postives = 283/363 (77.96%), Query Frame = 2
Query:  182 VGSRILRPIGGKNPLPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVESSMSRFHN--RQSNSYPHTRPSNHLSNFCTVPNSPQMSPDSIRRSITSYKYTE 1264
             GS     I  KN +  ++++YNFLERPTGWKCF+YHFTVF+MVL+CLIFSV+STID Y + +   L+ ME  LV FFGAEY+IRLWS+GCRSKY+G  GR RF RKPIS+IDLIVVVAS +V   GS+G+VFATSAIRG+RF+QILRMLHVDRQGGTWRLLGSV+Y+HRQELITTLYIGFLGL+FSSYFVYL+E   E  ++F SYADALWWGV+TV TIGYGDKVP+TW+GKI+ASCF+VFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA LIQCLWR HA++    S ATW+I+     S  + F    R+++     R  + L +  TV N         R S++S  Y +
Sbjct:   83 TGSHSSSNIHSKNSI--QSRVYNFLERPTGWKCFIYHFTVFMMVLICLIFSVLSTIDQYTKFAMETLFWMEIFLVCFFGAEYVIRLWSAGCRSKYMGIRGRFRFSRKPISIIDLIVVVASIVVFTVGSEGQVFATSAIRGVRFLQILRMLHVDRQGGTWRLLGSVIYLHRQELITTLYIGFLGLIFSSYFVYLAERGEEERDDFKSYADALWWGVITVMTIGYGDKVPQTWMGKIVASCFAVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAATLIQCLWRCHAAAPGSKSEATWKIHVHDPGSEETMFAKMARRASLTLRKRRMSRLDSSSTVANH-----SVYRESVSSITYAD 438          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Cavefish
Match: kcnq1.1 (potassium voltage-gated channel subfamily Q member 1 [Source:NCBI gene;Acc:103046994])

HSP 1 Score: 443.351 bits (1139), Expect = 1.808e-149
Identity = 211/275 (76.73%), Postives = 238/275 (86.55%), Query Frame = 2
Query:  239 KIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSEN---SNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHA 1054
            ++YNFLERP+GWKCF+YHFTVF++VL CLI SV+STI+ Y  ++   L+ +E +LV FFG EY++RLWS+GCRSKY+G  GRLRF RKPIS+IDLIVVVAS IVL  GS G+VFATSA+RGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFL L+F+SYFVYL+E      +   EF SYADALWWGVVTVTTIGYGDKVP+TWIGK I SCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA LIQ  WR  A
Sbjct:   63 RVYNFLERPSGWKCFVYHFTVFLIVLSCLILSVLSTIEEYQTLAQDTLFWVEIVLVVFFGVEYVVRLWSAGCRSKYVGILGRLRFARKPISIIDLIVVVASVIVLSVGSNGQVFATSAVRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLALIFASYFVYLAEKDAVDGDGVTEFGSYADALWWGVVTVTTIGYGDKVPQTWIGKTIGSCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAACLIQTSWRCFA 337          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Cavefish
Match: kcnq1.1 (potassium voltage-gated channel subfamily Q member 1 [Source:NCBI gene;Acc:103046994])

HSP 1 Score: 443.736 bits (1140), Expect = 2.497e-149
Identity = 211/275 (76.73%), Postives = 238/275 (86.55%), Query Frame = 2
Query:  239 KIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSEN---SNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHA 1054
            ++YNFLERP+GWKCF+YHFTVF++VL CLI SV+STI+ Y  ++   L+ +E +LV FFG EY++RLWS+GCRSKY+G  GRLRF RKPIS+IDLIVVVAS IVL  GS G+VFATSA+RGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFL L+F+SYFVYL+E      +   EF SYADALWWGVVTVTTIGYGDKVP+TWIGK I SCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA LIQ  WR  A
Sbjct:   88 RVYNFLERPSGWKCFVYHFTVFLIVLSCLILSVLSTIEEYQTLAQDTLFWVEIVLVVFFGVEYVVRLWSAGCRSKYVGILGRLRFARKPISIIDLIVVVASVIVLSVGSNGQVFATSAVRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLALIFASYFVYLAEKDAVDGDGVTEFGSYADALWWGVVTVTTIGYGDKVPQTWIGKTIGSCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAACLIQTSWRCFA 362          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Cavefish
Match: kcnq1.1 (potassium voltage-gated channel subfamily Q member 1 [Source:NCBI gene;Acc:103046994])

HSP 1 Score: 443.351 bits (1139), Expect = 3.948e-149
Identity = 211/275 (76.73%), Postives = 238/275 (86.55%), Query Frame = 2
Query:  239 KIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSEN---SNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHA 1054
            ++YNFLERP+GWKCF+YHFTVF++VL CLI SV+STI+ Y  ++   L+ +E +LV FFG EY++RLWS+GCRSKY+G  GRLRF RKPIS+IDLIVVVAS IVL  GS G+VFATSA+RGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFL L+F+SYFVYL+E      +   EF SYADALWWGVVTVTTIGYGDKVP+TWIGK I SCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA LIQ  WR  A
Sbjct:   88 RVYNFLERPSGWKCFVYHFTVFLIVLSCLILSVLSTIEEYQTLAQDTLFWVEIVLVVFFGVEYVVRLWSAGCRSKYVGILGRLRFARKPISIIDLIVVVASVIVLSVGSNGQVFATSAVRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLALIFASYFVYLAEKDAVDGDGVTEFGSYADALWWGVVTVTTIGYGDKVPQTWIGKTIGSCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAACLIQTSWRCFA 362          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Cavefish
Match: kcnq1.2 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:103028784])

HSP 1 Score: 443.351 bits (1139), Expect = 2.420e-148
Identity = 222/292 (76.03%), Postives = 250/292 (85.62%), Query Frame = 2
Query:  230 FKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSEN---SNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIY 1096
             +  +YNFLERP G KCFLYHF VF+MVLVCLIFSV+STI+ Y + ++  L+ ME +LV FFG EY++RLWS+GCRSKY+G  GRLRF+RKPIS+IDLIVVVAS +VL  GS G+VFATSAIRGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E     +E    F SYADALWWGVVTVTTIGYGDKVP+TWIGK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA+LIQ LWR +A        ATW++Y
Sbjct:  142 MQGDVYNFLERPAGLKCFLYHFLVFLMVLVCLIFSVLSTIEQYADFATGTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGIKGRLRFIRKPISIIDLIVVVASVVVLSVGSNGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVDDEGKTGFSSYADALWWGVVTVTTIGYGDKVPQTWIGKAIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTLWRCYACEKPDGCPATWKMY 433          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Cavefish
Match: kcnq1.2 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:103028784])

HSP 1 Score: 442.58 bits (1137), Expect = 4.047e-148
Identity = 222/292 (76.03%), Postives = 250/292 (85.62%), Query Frame = 2
Query:  230 FKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSEN---SNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIY 1096
             +  +YNFLERP G KCFLYHF VF+MVLVCLIFSV+STI+ Y + ++  L+ ME +LV FFG EY++RLWS+GCRSKY+G  GRLRF+RKPIS+IDLIVVVAS +VL  GS G+VFATSAIRGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E     +E    F SYADALWWGVVTVTTIGYGDKVP+TWIGK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA+LIQ LWR +A        ATW++Y
Sbjct:  142 MQGDVYNFLERPAGLKCFLYHFLVFLMVLVCLIFSVLSTIEQYADFATGTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGIKGRLRFIRKPISIIDLIVVVASVVVLSVGSNGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVDDEGKTGFSSYADALWWGVVTVTTIGYGDKVPQTWIGKAIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTLWRCYACEKPDGCPATWKMY 433          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Sea Lamprey
Match: kcnq1.1 (potassium voltage-gated channel, KQT-like subfamily, member 1.1 [Source:ZFIN;Acc:ZDB-GENE-061214-5])

HSP 1 Score: 392.119 bits (1006), Expect = 1.146e-132
Identity = 189/235 (80.43%), Postives = 205/235 (87.23%), Query Frame = 2
Query:  392 ETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSE-NSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRI 1093
            E  LV FFG EY++RLWS+GCRSKY+G  GR+RF  KPIS+IDL+VVVAS IVL  GS G+VFATSAIRGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E +     NEF SYADALWWGVVTVTTIGYGDKVP+TWIGK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA LIQ LWR H +    +S ATW I
Sbjct:    1 EIALVVFFGVEYLVRLWSAGCRSKYVGVMGRVRFAHKPISIIDLVVVVASIIVLCVGSNGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDEAREKNEFASYADALWWGVVTVTTIGYGDKVPQTWIGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAATLIQSLWRCHLAESDHHSTATWMI 235          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001128.1 (pep scaffold:Pmarinus_7.0:GL481044:147302:155278:-1 gene:ENSPMAG00000001003.1 transcript:ENSPMAT00000001128.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 300.827 bits (769), Expect = 1.142e-99
Identity = 142/242 (58.68%), Postives = 187/242 (77.27%), Query Frame = 2
Query:  392 ETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSV-KFNSVATWRIYTQPVES 1114
            E I++  FG EYI R+W++GC  +Y G+ GRL+F RKP  +ID+IV++AS  VL  G++G VFATSA+R +RF+QILRM+ +DR+GGTW+LLGSVVY H +ELIT  YIGFL LVFSS+ VYL+E  +E   EF +YADALWWG +T+TTIGYGDK P TW+G+++A+ F++  ISFFALPAGILGSGFALKVQ++ RQKHF ++   AA LIQ  WRLH++   + + +ATWR Y   + S
Sbjct:   19 EYIMIVVFGIEYIARIWAAGCCCRYRGWRGRLKFSRKPFCVIDIIVLIASLAVLAAGTQGNVFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLVFSSFLVYLAEK-DENQKEFGTYADALWWGTITLTTIGYGDKCPVTWVGRLMAASFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRSPAAGLIQAAWRLHSTDASRPHLIATWRFYYDCIPS 259          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009923.1 (pep scaffold:Pmarinus_7.0:GL476399:1077789:1091635:1 gene:ENSPMAG00000008976.1 transcript:ENSPMAT00000009923.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 239.195 bits (609), Expect = 1.114e-76
Identity = 108/182 (59.34%), Postives = 146/182 (80.22%), Query Frame = 2
Query:  392 ETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPA 937
            E I++  FG EY +R+W++GC  +Y G+ GRLRF RKP  +ID IV+VAS  V+  G++G +FATSA+R +RF+QILRM+ +DR+GGTW+LLGSVVY H +ELIT  YIGFL LVFSS+ VYL+E  ++  ++F +YADALWWG +T+TTIGYGDK PKTW+G+++A+ F++  ISFFALPA
Sbjct:   17 EGIMMVLFGLEYFLRIWAAGCCCRYRGWQGRLRFARKPFCIIDSIVLVASLAVIAAGTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLALVFSSFLVYLAEK-DDNKDQFATYADALWWGTITLTTIGYGDKTPKTWLGRMLAAGFALLGISFFALPA 197          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009926.1 (pep scaffold:Pmarinus_7.0:GL476399:1078231:1091635:1 gene:ENSPMAG00000008976.1 transcript:ENSPMAT00000009926.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 234.187 bits (596), Expect = 8.520e-75
Identity = 109/194 (56.19%), Postives = 148/194 (76.29%), Query Frame = 2
Query:  383 YIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGV---------VTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPA 937
            Y+ E I++  FG EY +R+W++GC  +Y G+ GRLRF RKP  +ID IV+VAS  V+  G++G +FATSA+R +RF+QILRM+ +DR+GGTW+LLGSVVY H +ELIT  YIGFL LVFSS+ VYL+E  ++  ++F +YADALWWG          +T+TTIGYGDK PKTW+G+++A+ F++  ISFFALPA
Sbjct:    3 YVCEGIMMVLFGLEYFLRIWAAGCCCRYRGWQGRLRFARKPFCIIDSIVLVASLAVIAAGTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLALVFSSFLVYLAEK-DDNKDQFATYADALWWGTGWGLLVLADITLTTIGYGDKTPKTWLGRMLAAGFALLGISFFALPA 195          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Sea Lamprey
Match: kcnq4 (potassium voltage-gated channel, KQT-like subfamily, member 4 [Source:ZFIN;Acc:ZDB-GENE-120215-132])

HSP 1 Score: 139.813 bits (351), Expect = 7.718e-40
Identity = 66/127 (51.97%), Postives = 95/127 (74.80%), Query Frame = 2
Query:  302 FIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVY 682
            F++VL CL+ SV STI  Y + +S  + ++   ++  FG EY  R+W++GC  +Y G+ GR RF RKP  +ID+IV++AS  V++ G++G VFATSA+R +RF+QILRM+ +DR+GGTWRLLGSVVY
Sbjct:    1 FVLVLSCLVLSVFSTIQTYQDAASKAVLLL---MIGVFGLEYFARIWAAGCCCRYRGWRGRCRFARKPFCVIDIIVLIASLAVIIAGTQGNVFATSALRSLRFLQILRMVRMDRRGGTWRLLGSVVY 124          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Nematostella
Match: EDO42799 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A4])

HSP 1 Score: 269.626 bits (688), Expect = 4.692e-87
Identity = 132/263 (50.19%), Postives = 191/263 (72.62%), Query Frame = 2
Query:  245 YNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQ 1033
            YNFLERP G    +YH  + I+V+V LI + +ST+++Y  +    ++I+E +LV  F  EY +RLWS+GCRS Y+G  GRL F +K  +++D++V+ +S   L   + G   ++  +R +RF+ +LR+L  DRQG TW+LL SV+YIHR+EL+TTLY+GF+ L+F+S+ +Y+ E   + + +F S+ ++ WWG+VT+TTIGYGDK P TW G++ AS F+V  ISFFALPAGILGSGFALKV Q+QRQKHF+R+   AA L+Q
Sbjct:    9 YNFLERPRGLA-IVYHVALCILVIVSLILTALSTVNIYEALLDTPIFIVEIVLVTVFIVEYGLRLWSAGCRSTYVGLRGRLNFAKKTYAILDVLVIFSSIAGLALSTNG---SSITVRLVRFLPLLRVLRFDRQGSTWKLLASVIYIHRKELLTTLYLGFISLIFASFVLYMVEK--DENVKFDSWPNSFWWGIVTLTTIGYGDKTPITWYGRLCASIFAVCGISFFALPAGILGSGFALKVTQQQRQKHFHRRRRPAAILLQ 265          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Nematostella
Match: SHAKR12 (Potassium channel; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI05])

HSP 1 Score: 101.679 bits (252), Expect = 3.607e-23
Identity = 53/181 (29.28%), Postives = 101/181 (55.80%), Query Frame = 2
Query:  377 LLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVL-LFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAI 916
            L ++++T ++ +F +EYI RL S+           +L+F+   ++LIDLI ++  FI L L   +      + +R  R ++++R+L + R     R+LG  +   + +L   +++  + ++  S  +Y  EN   P+ EF S   A WW ++T+TT+GYGD  P+T  G+++ +C +VF +
Sbjct:  205 LWFVIDTCIITWFTSEYIARLISA---------PHKLKFVFSTLALIDLIAIIPYFISLGLDADQTHAITFTVLRIFRLLRVIRLLKLTRYVAALRILGYTIQSCQDQLTALMFLLLISIILFSSLMYYLENEENPT-EFYSIPAAFWWCIITMTTVGYGDTCPRTPFGRLVGACCAVFGV 375          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Nematostella
Match: SHAKR6 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIU6])

HSP 1 Score: 99.7525 bits (247), Expect = 2.573e-22
Identity = 70/232 (30.17%), Postives = 119/232 (51.29%), Query Frame = 2
Query:  341 STIDVYYEMSS--YLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFA--LKVQ-------QKQRQKHFNR 1003
            ST + Y + S    +   +ETI   +F  EY+IR  ++  RSK         F+  P++L+DL+ +   FI+LL  S+ +V + + +R IR +++ R+L + R  G  R+L   +    +EL   +    + +V SS  VY ++  + P ++F S  DA WW   TVTT+GYGD++P T  G+ +    +V  +  F+LP     + F   LK +        ++R +  NR
Sbjct:  179 STFEKYEKCSKTKEIFMFLETICYSWFLFEYVIRFATAPDRSK---------FVISPLNLVDLLAICPFFILLLIRSE-RVVSLAVLRIIRVLRVFRVLKLSRYSGGLRVLCYTLRSSLKELEMAMLFVCMIVVLSSSAVYYTDLGH-PKSQFSSIPDAFWWCATTVTTVGYGDQIPVTASGRFVGCICAVLGVLAFSLPVMAFATNFNAYLKCEPVRKLDPARERTESINR 399          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Nematostella
Match: SHAK6 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFM4])

HSP 1 Score: 94.7449 bits (234), Expect = 3.295e-21
Identity = 75/298 (25.17%), Postives = 140/298 (46.98%), Query Frame = 2
Query:  137 SIPKLFIRKRFSAFSVGSRILRPIGGK--------NPLP---FKTKIYNFLERP---TGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLY--IMETIL-------VFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFA 961
            +IP+         F +G + LR  G           P+P   F+  +++  E P    G +  +  F+V ++VL  ++F V  T+  +      +L   I ETI+       VFF    + I  ++     ++L    + +F+   ++LIDL+ ++  FI L       V + + +R +R +++ R+  + R     ++LG  +    +EL    +   +G++  S  VY +E +     EF+S   + WW ++T+TT+GYGD  PKT  GK++    ++  +   ALP  ++ S FA
Sbjct:   71 NIPRKVFVSDIKYFDLGEQALRQAGDDLEITDREIRPMPKNKFQRTVWSLFEHPDTSNGARA-IAIFSVAVIVLSIVLFCV-ETLPQFQRRPKEVLRNNITETIMIDNPKKSVFFAIESFCIAWFTLEYFIRFLCSPDKCKFVVSVLNLIDLVAILPFFITLPMTEPTSVSSLAILRCVRLVRVFRIFKLSRYSRGLQILGHTLKASLRELGLLFFFLCVGVILFSSAVYYAEYNYNRDTEFLSIPHSFWWSIITMTTVGYGDMAPKTLGGKLVGCFCAISGVLAIALPVPVIVSNFA 366          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Nematostella
Match: EDO39804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8W8])

HSP 1 Score: 94.7449 bits (234), Expect = 5.050e-21
Identity = 68/264 (25.76%), Postives = 127/264 (48.11%), Query Frame = 2
Query:  230 FKTKIYNFLERPTGW--KCFLYHFTVFIMVL-VCL-IFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAI-RGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQ 1006
            ++ +I+   E P        L   T+F+++  VCL     +   D       ++LYI+E + V +F  E++ RL         +    +L F +KP++ IDL  ++  ++ L+       F T  + R +R +++ R+  + R     ++LG  +     EL   ++   +G+V  S  ++ +E   + ++ F +     WW VVT+TT+GYGD VP TW G+I+ S  +V  +   ALP  ++ S F+L     + +    R+
Sbjct:  165 YQPRIWTMFEEPYSSIPAQVLAFITMFLIISSVCLFCLETVPKFDNPKTSEGFVLYILEAVCVAWFTLEFLFRL---------IFCPDKLSFFKKPMNWIDLGAILPFYLTLIVRESN--FKTIVVLRVVRLIRVFRIFKLSRHSYGLQILGHTLRSSCSELFLLVFFLTIGVVIFSSVIFYAEKDTKGTH-FTTIPHTFWWAVVTMTTLGYGDMVPITWQGQIVGSLCAVCGVLMIALPVPVIVSNFSLYYSHAKARMKLPRR 416          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Medaka
Match: ENSORLT00000044551.1 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:101166715])

HSP 1 Score: 464.151 bits (1193), Expect = 7.373e-157
Identity = 222/292 (76.03%), Postives = 248/292 (84.93%), Query Frame = 2
Query:  230 FKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSEN---SNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIY 1096
             +  +YNFLERP G KCFLYHF VFIMVLVCLIFSV+STI+ Y + ++  L+ ME +LV FFG EY++RLWS+GCRSKY G  GRLRF+RKPIS+IDLIVV+AS IVL  GS G+VFATSAIRGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E      E    F SYADALWWGVVTVTTIGYGDK+P+TWIGK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA LIQ LWR +A+       ATW++Y
Sbjct:  142 MQGDVYNFLERPAGMKCFLYHFLVFIMVLVCLIFSVLSTIEQYADFATGTLFWMEIVLVLFFGTEYVVRLWSAGCRSKYAGIKGRLRFIRKPISIIDLIVVIASIIVLGVGSNGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVDEEGKTGFSSYADALWWGVVTVTTIGYGDKIPQTWIGKAIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAACLIQTLWRCYAAEKPNGCAATWKMY 433          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Medaka
Match: ENSORLT00000003018.2 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:101166715])

HSP 1 Score: 462.611 bits (1189), Expect = 1.980e-156
Identity = 222/292 (76.03%), Postives = 248/292 (84.93%), Query Frame = 2
Query:  230 FKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSEN---SNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIY 1096
             +  +YNFLERP G KCFLYHF VFIMVLVCLIFSV+STI+ Y + ++  L+ ME +LV FFG EY++RLWS+GCRSKY G  GRLRF+RKPIS+IDLIVV+AS IVL  GS G+VFATSAIRGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E      E    F SYADALWWGVVTVTTIGYGDK+P+TWIGK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA LIQ LWR +A+       ATW++Y
Sbjct:  142 MQGDVYNFLERPAGMKCFLYHFLVFIMVLVCLIFSVLSTIEQYADFATGTLFWMEIVLVLFFGTEYVVRLWSAGCRSKYAGIKGRLRFIRKPISIIDLIVVIASIIVLGVGSNGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVDEEGKTGFSSYADALWWGVVTVTTIGYGDKIPQTWIGKAIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAACLIQTLWRCYAAEKPNGCAATWKMY 433          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Medaka
Match: ENSORLT00000035260.1 (potassium voltage-gated channel subfamily KQT member 1-like [Source:NCBI gene;Acc:101166715])

HSP 1 Score: 463.381 bits (1191), Expect = 3.271e-156
Identity = 222/292 (76.03%), Postives = 248/292 (84.93%), Query Frame = 2
Query:  230 FKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSEN---SNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIY 1096
             +  +YNFLERP G KCFLYHF VFIMVLVCLIFSV+STI+ Y + ++  L+ ME +LV FFG EY++RLWS+GCRSKY G  GRLRF+RKPIS+IDLIVV+AS IVL  GS G+VFATSAIRGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFLGL+FSSYFVYL+E      E    F SYADALWWGVVTVTTIGYGDK+P+TWIGK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA LIQ LWR +A+       ATW++Y
Sbjct:  142 MQGDVYNFLERPAGMKCFLYHFLVFIMVLVCLIFSVLSTIEQYADFATGTLFWMEIVLVLFFGTEYVVRLWSAGCRSKYAGIKGRLRFIRKPISIIDLIVVIASIIVLGVGSNGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVDEEGKTGFSSYADALWWGVVTVTTIGYGDKIPQTWIGKAIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAACLIQTLWRCYAAEKPNGCAATWKMY 433          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Medaka
Match: kcnq1.1 (potassium voltage-gated channel subfamily KQT member 1 [Source:NCBI gene;Acc:101161541])

HSP 1 Score: 447.973 bits (1151), Expect = 1.275e-150
Identity = 227/323 (70.28%), Postives = 266/323 (82.35%), Query Frame = 2
Query:  137 SIPKLFIRKRFSAFSVGSRILRPIGGKNPLPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSN---EFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIY 1096
            S P++ +R   S +S G   +RP+  +  +  + ++YNFLERPTGW+CF+YHFTVF++VL CLI SV+STID +  ++   L+ +E +LV FFG EY IRLWS+GCRSKY+G  GRLRF RKPIS+IDLIVVVAS IVL  GSKG+VFATSA+RGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFL L+FSSYFVYL+E     S+   EF +YADALWWGVVTVTTIGYGDKVP+TWIGK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA LIQ  WR  A    F+S AT++++
Sbjct:   75 SHPRMSVR--MSVYSTG---VRPVLTRTYI--QGRVYNFLERPTGWRCFVYHFTVFLIVLACLILSVLSTIDQFQALAHTTLFWVEIVLVVFFGVEYFIRLWSAGCRSKYVGIWGRLRFARKPISIIDLIVVVASIIVLSVGSKGQVFATSAVRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLSLIFSSYFVYLAEKDAVDSSGATEFGNYADALWWGVVTVTTIGYGDKVPQTWIGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAACLIQTAWRCFAVE-NFDS-ATFKMF 388          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Medaka
Match: kcnq1.1 (potassium voltage-gated channel subfamily KQT member 1 [Source:NCBI gene;Acc:101161541])

HSP 1 Score: 447.973 bits (1151), Expect = 1.810e-150
Identity = 227/323 (70.28%), Postives = 266/323 (82.35%), Query Frame = 2
Query:  137 SIPKLFIRKRFSAFSVGSRILRPIGGKNPLPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSN---EFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIY 1096
            S P++ +R   S +S G   +RP+  +  +  + ++YNFLERPTGW+CF+YHFTVF++VL CLI SV+STID +  ++   L+ +E +LV FFG EY IRLWS+GCRSKY+G  GRLRF RKPIS+IDLIVVVAS IVL  GSKG+VFATSA+RGIRF+QILRMLHVDRQGGTWRLLGSVV+IHRQELITTLYIGFL L+FSSYFVYL+E     S+   EF +YADALWWGVVTVTTIGYGDKVP+TWIGK IASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA LIQ  WR  A    F+S AT++++
Sbjct:   75 SHPRMSVR--MSVYSTG---VRPVLTRTYI--QGRVYNFLERPTGWRCFVYHFTVFLIVLACLILSVLSTIDQFQALAHTTLFWVEIVLVVFFGVEYFIRLWSAGCRSKYVGIWGRLRFARKPISIIDLIVVVASIIVLSVGSKGQVFATSAVRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLSLIFSSYFVYLAEKDAVDSSGATEFGNYADALWWGVVTVTTIGYGDKVPQTWIGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAACLIQTAWRCFAVE-NFDS-ATFKMF 388          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Planmine SMEST
Match: SMESG000040474.1 (SMESG000040474.1)

HSP 1 Score: 748.043 bits (1930), Expect = 0.000e+0
Identity = 362/363 (99.72%), Postives = 363/363 (100.00%), Query Frame = 2
Query:   83 MLKVDLNIDDEFGSTDKLSIPKLFIRKRFSAFSVGSRILRPIGGKNPLPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVESSMSRFHNRQSNSYPHTRPS 1171
            MLKVDLNIDDEFGSTDKLSIPKLFIRKRFSAFSVGSRILRPIGGKNPLPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVESSMSRFHNRQSNSYPHTRP+
Sbjct:    1 MLKVDLNIDDEFGSTDKLSIPKLFIRKRFSAFSVGSRILRPIGGKNPLPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVESSMSRFHNRQSNSYPHTRPN 363          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Planmine SMEST
Match: SMESG000040474.1 (SMESG000040474.1)

HSP 1 Score: 538.88 bits (1387), Expect = 0.000e+0
Identity = 259/261 (99.23%), Postives = 261/261 (100.00%), Query Frame = 2
Query:  389 METILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVESSMSRFHNRQSNSYPHTRPS 1171
            +ETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVESSMSRFHNRQSNSYPHTRP+
Sbjct:   71 LETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVESSMSRFHNRQSNSYPHTRPN 331          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Planmine SMEST
Match: SMESG000028167.1 (SMESG000028167.1)

HSP 1 Score: 522.316 bits (1344), Expect = 0.000e+0
Identity = 256/376 (68.09%), Postives = 306/376 (81.38%), Query Frame = 2
Query:   92 VDLNIDDEFGSTDKLSIPKLFIRKRFSAF--SVGSRILRPIGGKNPLPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVESSMSRFHNRQSNSYPHTRPSNHLSNFCTVPNSPQ 1213
            + +++D+E GS  K++     +RKR S+       +I      +  L F+TK+YNFLERPTGWKCFLYHFTVF+MVL+CLI SV+ST++ Y EM+  LL+IME IL+ FF  E+ IRLWS+GCRSK+LG SGRL+F++KPIS+IDL+V++AS  VL+ G+KG+VFATSAIRGIRF+QILRMLHVDRQG TWRLLGSVVYIHRQELITTLYIGFLGL+FSSYFV+L+EN+ E S EF+SYAD+LWWGVVTVTTIGYGDKVPKTWIGKI+ASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA+LIQCLWRL+ASS K NS ATW+IYT PV +S    H +QS+ +             + PNSP 
Sbjct:   64 LTIDLDNENGSDLKVNEK---VRKRLSSLFGKDWQKISIFTSYRAKLSFQTKVYNFLERPTGWKCFLYHFTVFLMVLICLILSVLSTVEYYSEMAIELLFIMEMILLIFFTTEFSIRLWSAGCRSKFLGLSGRLKFIKKPISIIDLVVIIASMTVLIAGTKGQVFATSAIRGIRFLQILRMLHVDRQGSTWRLLGSVVYIHRQELITTLYIGFLGLIFSSYFVFLAENATEQSAEFISYADSLWWGVVTVTTIGYGDKVPKTWIGKIVASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQCLWRLYASSNKKNSEATWKIYTYPVANSS---HQQQSHRHSSASSQGGAVETSSAPNSPN 433          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Planmine SMEST
Match: SMESG000022978.1 (SMESG000022978.1)

HSP 1 Score: 486.493 bits (1251), Expect = 8.845e-163
Identity = 243/356 (68.26%), Postives = 281/356 (78.93%), Query Frame = 2
Query:   77 YIMLKVDLNIDDEFGSTDKLSIPKLFIRKRFSAFSVGSRILRPIGG--KNPLPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSEN-SNEPSNE-----------FMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQ 1102
            Y  L+ D + D+++  T + S  +   + R    +V   + R I     N    +T IYNFLE PTGWKCFLYHF VF++VL+CLI SV+STID Y E++   L+ ME +LV FFG EY IRLWS+GCRSKY+GF GR+RF RKPIS+IDL+V++AS +VL FGSKG+VFATSAIRG+RF+QILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGL+FSSYFVYL+EN SNE +N            F SYADALWWGV+TVTTIGYGD VPKTW+GKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAA LIQCLWR +A S   N  +TW+IYTQ
Sbjct:   33 YDKLENDEDRDEDYLLTKRKSELEKRRQSRMITNAVRLDLQRSILNHMNNTQSRQTIIYNFLEFPTGWKCFLYHFAVFLLVLICLILSVLSTIDHYREVAVNTLFWMEIVLVIFFGCEYGIRLWSAGCRSKYMGFRGRIRFARKPISMIDLVVLLASCVVLGFGSKGQVFATSAIRGVRFLQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLIFSSYFVYLAENKSNEDNNNLKSDEDSEISYFKSYADALWWGVITVTTIGYGDAVPKTWVGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAATLIQCLWRCYAVSPDSNLHSTWKIYTQ 388          
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Planmine SMEST
Match: SMESG000078460.1 (SMESG000078460.1)

HSP 1 Score: 432.565 bits (1111), Expect = 2.890e-146
Identity = 215/333 (64.56%), Postives = 268/333 (80.48%), Query Frame = 2
Query:   95 DLNIDD--EFGSTDKLSIPKLFIRKRFSAFSVGSRILRPIGGKNPLPFKTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLLYIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVVVASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVYIHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVTVTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATW 1087
            D N+ D  +FGS   L+ P  F++++  +++  S+  R I  K+   FK++IYNFL+RP+GWKCF+YHFTVFI+VL CLI SV+STI V+ E +  +LYI+E ILV  FG EY  RLWS GCRS+Y+G+ GR+R+  KPI++IDLIVV++S +VL  G   ++FAT+AIRGIRF+QILR+LHVDR GGTW+LLGSV+Y HRQELIT+LYIGFLGL+FSSYFVYL+ENS + S +F +YADALWWGVVTVTTIGYGDKVP +W  KIIASCFSV  ISFF+LPAGI+GSGFALKVQQKQR+KHF RQIPAAA LIQCLWR + +  +  S ATW
Sbjct:   61 DENLSDFNQFGSAKDLTEP--FVKQKRESYN--SKFNRRI--KSQKSFKSQIYNFLDRPSGWKCFIYHFTVFILVLTCLILSVLSTITVFLETTHKILYILEFILVLCFGFEYFTRLWSCGCRSRYIGWRGRIRYAYKPIAIIDLIVVLSSVVVLCVGVGSQMFATTAIRGIRFIQILRILHVDRHGGTWKLLGSVIYNHRQELITSLYIGFLGLIFSSYFVYLAENSEKISEDFTTYADALWWGVVTVTTIGYGDKVPHSWSAKIIASCFSVVTISFFSLPAGIIGSGFALKVQQKQREKHFTRQIPAAATLIQCLWRYYCTFPEVKSTATW 387          
The following BLAST results are available for this feature:
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNQ17.372e-15670.00potassium voltage-gated channel subfamily Q member... [more]
KCNQ11.017e-14075.09potassium voltage-gated channel subfamily Q member... [more]
KCNQ52.721e-11355.67potassium voltage-gated channel subfamily Q member... [more]
KCNQ47.625e-11251.83potassium voltage-gated channel subfamily Q member... [more]
KCNQ21.332e-11153.00potassium voltage-gated channel subfamily Q member... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kqt-34.522e-15765.94Potassium channel, KvQLT family [Source:UniProtKB... [more]
kqt-34.522e-15765.94Potassium channel, KvQLT family [Source:UniProtKB... [more]
kqt-31.731e-15665.94Potassium channel, KvQLT family [Source:UniProtKB... [more]
kqt-31.731e-15665.94Potassium channel, KvQLT family [Source:UniProtKB... [more]
kqt-32.002e-15665.94Potassium channel, KvQLT family [Source:UniProtKB... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNQ1.433e-11557.79gene:FBgn0033494 transcript:FBtr0299832[more]
KCNQ6.066e-11557.79gene:FBgn0033494 transcript:FBtr0299833[more]
KCNQ9.202e-11557.79gene:FBgn0033494 transcript:FBtr0310093[more]
KCNQ1.137e-11457.79gene:FBgn0033494 transcript:FBtr0310097[more]
KCNQ1.448e-11457.79gene:FBgn0033494 transcript:FBtr0301443[more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnq1.15.583e-15677.70potassium voltage-gated channel, KQT-like subfamil... [more]
kcnq1.12.217e-15577.70potassium voltage-gated channel, KQT-like subfamil... [more]
kcnq1.12.612e-15577.70potassium voltage-gated channel, KQT-like subfamil... [more]
kcnq1.21.087e-14975.68potassium voltage-gated channel, KQT-like subfamil... [more]
kcnq5a7.815e-11056.14potassium voltage-gated channel, KQT-like subfamil... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000046791.11.723e-16469.19potassium voltage-gated channel subfamily KQT memb... [more]
ENSXETT00000046831.14.237e-16476.69potassium voltage-gated channel subfamily KQT memb... [more]
ENSXETT00000046772.14.977e-16469.19potassium voltage-gated channel subfamily KQT memb... [more]
ENSXETT00000046823.15.213e-16376.69potassium voltage-gated channel subfamily KQT memb... [more]
kri14.260e-15970.36KRI1 homolog [Source:Xenbase;Acc:XB-GENE-6036517][more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnq17.612e-16071.52potassium voltage-gated channel, subfamily Q, memb... [more]
Kcnq13.986e-15871.52potassium voltage-gated channel, subfamily Q, memb... [more]
Kcnq51.551e-11056.84potassium voltage-gated channel, subfamily Q, memb... [more]
Kcnq59.533e-11056.84potassium voltage-gated channel, subfamily Q, memb... [more]
Kcnq59.914e-11056.84potassium voltage-gated channel, subfamily Q, memb... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O73925|KCNQ1_SQUAC4.186e-15975.32Potassium voltage-gated channel subfamily KQT memb... [more]
sp|Q9MYS6|KCNQ1_RABIT1.308e-15771.47Potassium voltage-gated channel subfamily KQT memb... [more]
sp|P70057|KCNQ1_XENLA2.161e-15772.81Potassium voltage-gated channel subfamily KQT memb... [more]
sp|P97414|KCNQ1_MOUSE2.788e-15771.52Potassium voltage-gated channel subfamily KQT memb... [more]
sp|Q9Z0N7|KCNQ1_RAT2.062e-15671.52Potassium voltage-gated channel subfamily KQT memb... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4AJI81.067e-16577.13Ion_trans domain-containing protein (Fragment) OS=... [more]
A0A1I8IRF15.122e-16578.19Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HV447.329e-16578.19Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EPI51.012e-16478.19Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2T7P7712.262e-16465.56Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnq1.11.808e-14976.73potassium voltage-gated channel subfamily Q member... [more]
kcnq1.12.497e-14976.73potassium voltage-gated channel subfamily Q member... [more]
kcnq1.13.948e-14976.73potassium voltage-gated channel subfamily Q member... [more]
kcnq1.22.420e-14876.03potassium voltage-gated channel subfamily KQT memb... [more]
kcnq1.24.047e-14876.03potassium voltage-gated channel subfamily KQT memb... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnq1.11.146e-13280.43potassium voltage-gated channel, KQT-like subfamil... [more]
ENSPMAT00000001128.11.142e-9958.68pep scaffold:Pmarinus_7.0:GL481044:147302:155278:-... [more]
ENSPMAT00000009923.11.114e-7659.34pep scaffold:Pmarinus_7.0:GL476399:1077789:1091635... [more]
ENSPMAT00000009926.18.520e-7556.19pep scaffold:Pmarinus_7.0:GL476399:1078231:1091635... [more]
kcnq47.718e-4051.97potassium voltage-gated channel, KQT-like subfamil... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO427994.692e-8750.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAKR123.607e-2329.28Potassium channel; Predicted protein [Source:UniP... [more]
SHAKR62.573e-2230.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK63.295e-2125.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398045.050e-2125.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000044551.17.373e-15776.03potassium voltage-gated channel subfamily KQT memb... [more]
ENSORLT00000003018.21.980e-15676.03potassium voltage-gated channel subfamily KQT memb... [more]
ENSORLT00000035260.13.271e-15676.03potassium voltage-gated channel subfamily KQT memb... [more]
kcnq1.11.275e-15070.28potassium voltage-gated channel subfamily KQT memb... [more]
kcnq1.11.810e-15070.28potassium voltage-gated channel subfamily KQT memb... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily KQT member 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040474.10.000e+099.72SMESG000040474.1[more]
SMESG000040474.10.000e+099.23SMESG000040474.1[more]
SMESG000028167.10.000e+068.09SMESG000028167.1[more]
SMESG000022978.18.845e-16368.26SMESG000022978.1[more]
SMESG000078460.12.890e-14664.56SMESG000078460.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003893 ID=SMED30003893|Name=Potassium voltage-gated channel subfamily KQT member 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1604bp
GTTTGAATACAGTTTTTAATCAGCTAATTGTGATGATAACTTATATATTA
AATAGGAAATTTTAGACTTATAAAAATATATTATGCTTAAAGTCGATTTG
AATATTGACGATGAATTCGGTAGCACAGATAAATTATCAATTCCAAAGCT
CTTTATCAGAAAGAGATTTTCAGCTTTTTCTGTTGGTTCCAGAATTTTAA
GACCAATTGGCGGAAAGAATCCATTGCCATTTAAAACGAAAATTTATAAT
TTTCTCGAAAGACCAACTGGTTGGAAATGTTTCTTATATCATTTTACCGT
ATTTATTATGGTTTTAGTTTGTTTGATTTTCAGTGTTATATCGACAATTG
ATGTTTACTATGAAATGTCTAGTTATTTACTCTATATTATGGAAACAATT
CTTGTGTTTTTCTTTGGAGCCGAATACATTATCAGATTGTGGTCGTCCGG
TTGTAGGAGTAAATATCTGGGATTTAGTGGCCGTCTACGATTTATGAGGA
AGCCAATATCTTTGATAGATCTCATTGTTGTTGTCGCATCATTTATAGTT
CTTCTTTTTGGAAGTAAAGGAAAGGTTTTTGCGACATCAGCTATTAGAGG
TATAAGATTTATGCAGATCTTGAGAATGCTTCATGTAGACCGGCAAGGAG
GAACTTGGAGATTACTAGGATCAGTTGTGTATATTCATAGACAAGAATTA
ATAACAACTTTATACATCGGGTTTTTGGGACTTGTTTTCTCGTCATATTT
TGTGTATTTATCTGAAAACAGCAATGAACCAAGCAATGAATTTATGAGTT
ATGCGGATGCTCTTTGGTGGGGCGTGGTGACAGTTACTACAATCGGTTAT
GGTGACAAAGTTCCTAAGACATGGATAGGAAAAATAATTGCGTCGTGCTT
TTCAGTATTCGCCATTTCATTCTTTGCTTTACCCGCGGGTATCCTTGGAT
CTGGATTTGCCTTAAAAGTTCAACAGAAACAACGTCAAAAACATTTCAAT
CGTCAAATACCAGCTGCAGCAAATTTAATACAATGCCTTTGGCGTCTTCA
TGCGTCTTCTGTAAAATTCAATTCTGTTGCTACGTGGAGGATATACACGC
AACCAGTGGAATCTTCAATGTCGCGTTTCCACAATAGACAATCAAATTCT
TACCCCCACACTCGCCCTAGTAATCATTTATCTAATTTCTGTACTGTTCC
CAATAGTCCTCAAATGTCTCCTGATTCTATTAGGCGTTCAATAACTTCAT
ATAAATACACTGAGTGCGGCATTCTCGGTTGGAGTTTCTACTTATTCATA
AAATATGGATGTTGTTCCTTTATGTTGTCAATTTGTGAACATACGTACTT
TTACGGAAATTATTGATCCAACTCTTTTACAACTTTGAGAAAGAAAACCT
TAATAGAAAACAATTGAAAAATATTGTTACAATCGAAAAATCCACAGGCA
TAGGTTCTTTTATCTTCGTTTAATTTTAGACTAGATCAATGTTTTCTATT
TAACCCGTAACTGATGTGAAGTCATTTTAAATACGCACACACTGTTCACC
GGTCAAATTGACTGGCACGCTTAAATCGAGTTTTATCTGTGAGATGTGAG
TATA
back to top

protein sequence of SMED30003893-orf-1

>SMED30003893-orf-1 ID=SMED30003893-orf-1|Name=SMED30003893-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=428bp
MLKVDLNIDDEFGSTDKLSIPKLFIRKRFSAFSVGSRILRPIGGKNPLPF
KTKIYNFLERPTGWKCFLYHFTVFIMVLVCLIFSVISTIDVYYEMSSYLL
YIMETILVFFFGAEYIIRLWSSGCRSKYLGFSGRLRFMRKPISLIDLIVV
VASFIVLLFGSKGKVFATSAIRGIRFMQILRMLHVDRQGGTWRLLGSVVY
IHRQELITTLYIGFLGLVFSSYFVYLSENSNEPSNEFMSYADALWWGVVT
VTTIGYGDKVPKTWIGKIIASCFSVFAISFFALPAGILGSGFALKVQQKQ
RQKHFNRQIPAAANLIQCLWRLHASSVKFNSVATWRIYTQPVESSMSRFH
NRQSNSYPHTRPSNHLSNFCTVPNSPQMSPDSIRRSITSYKYTECGILGW
SFYLFIKYGCCSFMLSICEHTYFYGNY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR005827K_chnl_volt-dep_KCQN1
IPR028325VG_K_chnl
IPR003937K_chnl_volt-dep_KCNQ
IPR005821Ion_trans_dom
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0006810transport
GO:0034765regulation of ion transmembrane transport
GO:0048839inner ear development
GO:0050892intestinal absorption
GO:0060453regulation of gastric acid secretion
GO:0070293renal absorption
GO:0071805potassium ion transmembrane transport
GO:0086009membrane repolarization
Vocabulary: cellular component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO:0005737cytoplasm
GO:0005783endoplasmic reticulum
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0016323basolateral plasma membrane
GO:0030659cytoplasmic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0034702ion channel complex
GO:0045121membrane raft
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005251delayed rectifier potassium channel activity
GO:0005267potassium channel activity
GO:0005516calmodulin binding
GO:0005546phosphatidylinositol-4,5-bisphosphate binding
GO:0015271outward rectifier potassium channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00169KCHANNELcoord: 205..228
score: 27.02
coord: 237..259
score: 54.59
coord: 176..202
score: 19.85
coord: 266..292
score: 30.7
coord: 102..125
score: 27.28
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 67..295
e-value: 3.7E-53
score: 182.3
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 61..293
NoneNo IPR availableTMHMMTMhelixcoord: 395..417
NoneNo IPR availableTMHMMTMhelixcoord: 238..257
NoneNo IPR availableTMHMMTMhelixcoord: 142..161
NoneNo IPR availableTMHMMTMhelixcoord: 99..121
NoneNo IPR availableTMHMMTMhelixcoord: 67..89
NoneNo IPR availableTMHMMTMhelixcoord: 272..294
NoneNo IPR availableTMHMMTMhelixcoord: 207..226
IPR003937Potassium channel, voltage dependent, KCNQPRINTSPR01459KCNQCHANNELcoord: 110..129
score: 53.55
coord: 192..211
score: 71.94
coord: 130..149
score: 59.84
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 71..295
e-value: 1.3E-24
score: 86.7
IPR005827Potassium channel, voltage dependent, KCNQ1PANTHERPTHR11537:SF144POTASSIUM VOLTAGE-GATED CHANNEL SUBFAMILY KQT MEMBER 1coord: 50..350
IPR028325Voltage-gated potassium channelPANTHERPTHR11537VOLTAGE-GATED POTASSIUM CHANNELcoord: 50..350