c-Myc-binding protein

Overview
Namec-Myc-binding protein
Smed IDSMED30003887
Length (bp)603
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of c-Myc-binding protein (SMED30003887) t-SNE clustered cells

Violin plots show distribution of expression levels for c-Myc-binding protein (SMED30003887) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of c-Myc-binding protein (SMED30003887) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for c-Myc-binding protein (SMED30003887) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003887

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30003887SMESG000001466.1 dd_Smed_v4_891_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30003887SMESG000001466.1 dd_Smed_v4_891_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30003887SMESG000001466.1 dd_Smed_v4_891_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003887SMESG000001466.1 dd_Smed_v4_891_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003887SMESG000001466.1 dd_Smed_v4_891_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30003887SMESG000001466.1 dd_Smed_v4_891_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
posterior muscle cellSMED30003887SMESG000001466.1 dd_Smed_v4_891_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30003887SMESG000001466.1 dd_Smed_v4_891_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003887SMESG000001466.1 Contig51256newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003887SMESG000001466.1 Contig51256uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30003887SMESG000001466.1 OX_Smed_1.0.02900ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30003887SMESG000001466.1 dd_Smed_v4_891_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of c-Myc-binding protein vs. Ensembl Human
Match: AL139260.3 (novel protein)

HSP 1 Score: 79.7221 bits (195), Expect = 5.172e-19
Identity = 35/79 (44.30%), Postives = 59/79 (74.68%), Query Frame = 2
Query:   44 ICCYRFLK*INMSTDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMKSTIS 280
            + C+  L  +  + D+K+E+F++YLE+ GVLD LTKVLV LYEEPEKP++AL+FL++ +G   ++ EN ++E ++  ++
Sbjct:    1 MVCFSDLPKLRKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGA--ATPENPEIELLRLELA 77          
BLAST of c-Myc-binding protein vs. Ensembl Human
Match: MYCBP (MYC binding protein [Source:HGNC Symbol;Acc:HGNC:7554])

HSP 1 Score: 77.411 bits (189), Expect = 4.258e-18
Identity = 33/67 (49.25%), Postives = 54/67 (80.60%), Query Frame = 2
Query:   80 STDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMKSTIS 280
            + D+K+E+F++YLE+ GVLD LTKVLV LYEEPEKP++AL+FL++ +G   ++ EN ++E ++  ++
Sbjct:    6 AADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGA--ATPENPEIELLRLELA 70          
BLAST of c-Myc-binding protein vs. Ensembl Fly
Match: CG4546 (gene:FBgn0038373 transcript:FBtr0083184)

HSP 1 Score: 55.8398 bits (133), Expect = 4.078e-9
Identity = 29/72 (40.28%), Postives = 45/72 (62.50%), Query Frame = 2
Query:   80 STDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDV-----ESMKSTIS 280
            S ++K+ +++KYLER GV+D L+K L++LYEE  KP +A+ F+R  +  +   D   DV     E  K+ IS
Sbjct:    3 SIESKRVQYRKYLERAGVIDALSKALIKLYEEQNKPEDAIRFVRKFMCESCPDDAQYDVMKNDLEEAKTHIS 74          
BLAST of c-Myc-binding protein vs. Ensembl Fly
Match: CG17202 (gene:FBgn0038043 transcript:FBtr0082587)

HSP 1 Score: 50.8322 bits (120), Expect = 8.112e-8
Identity = 21/49 (42.86%), Postives = 35/49 (71.43%), Query Frame = 2
Query:   86 DTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQ 232
            D K++E ++YLER  VLD LTK+ + + +  E+P N ++++RN IGV +
Sbjct:    7 DPKRDEIRRYLERGSVLDSLTKLFIRVIK--ERPENPMDYIRNHIGVVR 53          
BLAST of c-Myc-binding protein vs. Ensembl Zebrafish
Match: mycbp (MYC binding protein [Source:ZFIN;Acc:ZDB-GENE-060331-97])

HSP 1 Score: 75.0998 bits (183), Expect = 3.228e-17
Identity = 52/121 (42.98%), Postives = 80/121 (66.12%), Query Frame = 2
Query:    8 YCLNN*LYFYRSICCYRFLK*INMSTDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMKSTISXXXXXXXXXXXXXXXXKSQLEELQKNQPQE 370
            +CL++ +  YR+             +++K+E+F++YLE+ GVLD LT VLV LYEE EKP+NAL+F+++ +GV  S  E  D ES++  ++ LQQ+ +QL  EN+ LKS+L  LQ   PQ+
Sbjct:   13 WCLSSAMAHYRA-------------SESKREQFRRYLEKAGVLDSLTNVLVALYEETEKPNNALDFIKHHLGV--SGVEAEDAESLREELNTLQQKHQQLMEENQELKSRL--LQYEPPQD 116          
BLAST of c-Myc-binding protein vs. Ensembl Xenopus
Match: adrb2 (adrenoceptor beta 2 [Source:Xenbase;Acc:XB-GENE-494302])

HSP 1 Score: 81.6481 bits (200), Expect = 8.402e-20
Identity = 35/67 (52.24%), Postives = 52/67 (77.61%), Query Frame = 2
Query:   80 STDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMKSTIS 280
            + D+K+E+F++YLE+ GVLD LTKVLV LYEEPEKP+NAL+FL+  +G   +  E  DVE+++  ++
Sbjct:    2 AADSKREQFRRYLEKAGVLDTLTKVLVALYEEPEKPNNALDFLKQHMGA--AGPETADVEALRLEVA 66          
BLAST of c-Myc-binding protein vs. Ensembl Xenopus
Match: adrb2 (adrenoceptor beta 2 [Source:Xenbase;Acc:XB-GENE-494302])

HSP 1 Score: 81.6481 bits (200), Expect = 8.865e-20
Identity = 35/67 (52.24%), Postives = 52/67 (77.61%), Query Frame = 2
Query:   80 STDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMKSTIS 280
            + D+K+E+F++YLE+ GVLD LTKVLV LYEEPEKP+NAL+FL+  +G   +  E  DVE+++  ++
Sbjct:    6 AADSKREQFRRYLEKAGVLDTLTKVLVALYEEPEKPNNALDFLKQHMGA--AGPETADVEALRLEVA 70          
BLAST of c-Myc-binding protein vs. Ensembl Mouse
Match: Mycbp (MYC binding protein [Source:MGI Symbol;Acc:MGI:1891750])

HSP 1 Score: 77.411 bits (189), Expect = 2.288e-18
Identity = 33/63 (52.38%), Postives = 52/63 (82.54%), Query Frame = 2
Query:   80 STDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMK 268
            + D+K+E+F++YLE+ GVLD LTKVLV LYEEPEKP++AL+FL++ +G   ++ EN ++E ++
Sbjct:    6 AADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPTSALDFLKHHLGA--ATPENPEIELLR 66          
BLAST of c-Myc-binding protein vs. Ensembl Mouse
Match: Mycbp (MYC binding protein [Source:MGI Symbol;Acc:MGI:1891750])

HSP 1 Score: 76.2554 bits (186), Expect = 1.851e-17
Identity = 33/63 (52.38%), Postives = 52/63 (82.54%), Query Frame = 2
Query:   80 STDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMK 268
            + D+K+E+F++YLE+ GVLD LTKVLV LYEEPEKP++AL+FL++ +G   ++ EN ++E ++
Sbjct:    6 AADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPTSALDFLKHHLGA--ATPENPEIELLR 66          
BLAST of c-Myc-binding protein vs. UniProt/SwissProt
Match: sp|Q9EQS3|MYCBP_MOUSE (c-Myc-binding protein OS=Mus musculus OX=10090 GN=Mycbp PE=1 SV=5)

HSP 1 Score: 77.411 bits (189), Expect = 1.600e-17
Identity = 33/63 (52.38%), Postives = 52/63 (82.54%), Query Frame = 2
Query:   80 STDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMK 268
            + D+K+E+F++YLE+ GVLD LTKVLV LYEEPEKP++AL+FL++ +G   ++ EN ++E ++
Sbjct:    6 AADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPTSALDFLKHHLGA--ATPENPEIELLR 66          
BLAST of c-Myc-binding protein vs. UniProt/SwissProt
Match: sp|Q99417|MYCBP_HUMAN (c-Myc-binding protein OS=Homo sapiens OX=9606 GN=MYCBP PE=1 SV=3)

HSP 1 Score: 77.411 bits (189), Expect = 2.045e-17
Identity = 33/67 (49.25%), Postives = 54/67 (80.60%), Query Frame = 2
Query:   80 STDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMKSTIS 280
            + D+K+E+F++YLE+ GVLD LTKVLV LYEEPEKP++AL+FL++ +G   ++ EN ++E ++  ++
Sbjct:    6 AADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGA--ATPENPEIELLRLELA 70          
BLAST of c-Myc-binding protein vs. UniProt/SwissProt
Match: sp|Q5R7A8|MYCBP_PONAB (c-Myc-binding protein OS=Pongo abelii OX=9601 GN=MYCBP PE=3 SV=3)

HSP 1 Score: 77.0258 bits (188), Expect = 2.451e-17
Identity = 33/67 (49.25%), Postives = 54/67 (80.60%), Query Frame = 2
Query:   80 STDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMKSTIS 280
            + D+K+E+F++YLE+ GVLD LTKVLV LYEEPEKP++AL+FL++ +G   ++ EN ++E ++  ++
Sbjct:    6 AADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGA--ATPENPEIELLRLELA 70          
BLAST of c-Myc-binding protein vs. UniProt/SwissProt
Match: sp|Q2TBP7|MYCBP_BOVIN (c-Myc-binding protein OS=Bos taurus OX=9913 GN=MYCBP PE=3 SV=3)

HSP 1 Score: 77.0258 bits (188), Expect = 2.531e-17
Identity = 33/67 (49.25%), Postives = 54/67 (80.60%), Query Frame = 2
Query:   80 STDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMKSTIS 280
            + D+K+E+F++YLE+ GVLD LTKVLV LYEEPEKP++AL+FL++ +G   ++ EN ++E ++  ++
Sbjct:    6 AADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGA--ATPENPEIELLRLELA 70          
BLAST of c-Myc-binding protein vs. UniProt/SwissProt
Match: sp|Q54I57|MYCBP_DICDI (c-Myc-binding protein homolog OS=Dictyostelium discoideum OX=44689 GN=mycbp PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.766e-14
Identity = 33/64 (51.56%), Postives = 46/64 (71.88%), Query Frame = 2
Query:   77 MSTDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMK 268
            M    +KEEFK YLE+ GV+D LTKVLV LYEE +KPS+ALEF++  +G +      +DV+++K
Sbjct:    1 MQNSAEKEEFKGYLEKSGVIDALTKVLVGLYEESDKPSDALEFIKKHLGNSLG----IDVDALK 60          
BLAST of c-Myc-binding protein vs. TrEMBL
Match: V4A7X2 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_210400 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 7.469e-19
Identity = 40/67 (59.70%), Postives = 54/67 (80.60%), Query Frame = 2
Query:   80 STDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMKSTIS 280
            + D+K+EE++KYLE+ GVLD+LTKVLV LYEEPEKP+NAL+FLR  +G   SS E  DVE++K  ++
Sbjct:    6 AADSKREEYRKYLEKAGVLDVLTKVLVGLYEEPEKPNNALDFLRQHLGA--SSPETADVEALKLEVT 70          
BLAST of c-Myc-binding protein vs. TrEMBL
Match: C3YH74 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_115113 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.144e-18
Identity = 40/67 (59.70%), Postives = 52/67 (77.61%), Query Frame = 2
Query:   80 STDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMKSTIS 280
            + D+K+EEF+KYLE+ GVLD LTKVLV LYEEP+KP+NAL+FLR  +G   SS E  DVE ++  +S
Sbjct:    6 AADSKREEFRKYLEKAGVLDALTKVLVGLYEEPDKPNNALDFLRQHLGA--SSPETADVEGLRLELS 70          
BLAST of c-Myc-binding protein vs. TrEMBL
Match: A0A1I8GVQ6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017412g1 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.569e-17
Identity = 40/67 (59.70%), Postives = 52/67 (77.61%), Query Frame = 2
Query:   80 STDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMKSTIS 280
            + D+K+EEF+KYLE+ GVLD LTKVLV LYEEPEKP+NALEFL+  +G   +  +  DVE+MK  I+
Sbjct:    6 AADSKREEFRKYLEKAGVLDALTKVLVGLYEEPEKPNNALEFLKQHLGT--AGPDAPDVEAMKVEIT 70          
BLAST of c-Myc-binding protein vs. TrEMBL
Match: A0A0L8GMQ0 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22031218mg PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 3.597e-17
Identity = 39/62 (62.90%), Postives = 50/62 (80.65%), Query Frame = 2
Query:   83 TDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMK 268
             D+K+EEF+KYLE+ GVLD LTKVLV LYEEP+KP+NALEFL+  +GV  S  E  DV+++K
Sbjct:    8 ADSKREEFRKYLEKAGVLDALTKVLVGLYEEPDKPNNALEFLKQHLGV--SGPETADVDALK 67          
BLAST of c-Myc-binding protein vs. TrEMBL
Match: K1PTC2 (c-Myc-binding protein OS=Crassostrea gigas OX=29159 GN=CGI_10002799 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 4.554e-17
Identity = 38/70 (54.29%), Postives = 53/70 (75.71%), Query Frame = 2
Query:   71 INMSTDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMKSTIS 280
             ++  D+K+EEF++YLE+ GVLD LTKVLV LYEEPEKP+NAL+FL+  +G   S  E  DVE++K  ++
Sbjct:    5 FDIGADSKREEFRRYLEKAGVLDALTKVLVGLYEEPEKPNNALDFLKQHLGA--SGPETADVEALKLEVT 72          
BLAST of c-Myc-binding protein vs. Ensembl Cavefish
Match: mycbp (MYC binding protein [Source:NCBI gene;Acc:111197019])

HSP 1 Score: 64.6994 bits (156), Expect = 1.670e-13
Identity = 30/62 (48.39%), Postives = 48/62 (77.42%), Query Frame = 2
Query:   80 STDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESM 265
            + ++K+E+F++YLE+ GVLD LT VLV LYEE +KP+NALEF+R  + ++    ++ DVE++
Sbjct:    6 AAESKREQFRRYLEKAGVLDSLTNVLVALYEETDKPNNALEFIR--LHLSTGEPDSGDVETL 65          
BLAST of c-Myc-binding protein vs. Ensembl Cavefish
Match: mycbp (MYC binding protein [Source:NCBI gene;Acc:111197019])

HSP 1 Score: 64.3142 bits (155), Expect = 2.226e-13
Identity = 30/62 (48.39%), Postives = 48/62 (77.42%), Query Frame = 2
Query:   80 STDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESM 265
            + ++K+E+F++YLE+ GVLD LT VLV LYEE +KP+NALEF+R  + ++    ++ DVE++
Sbjct:    7 AAESKREQFRRYLEKAGVLDSLTNVLVALYEETDKPNNALEFIR--LHLSTGEPDSGDVETL 66          
BLAST of c-Myc-binding protein vs. Ensembl Nematostella
Match: EDO42036 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2N6])

HSP 1 Score: 76.2554 bits (186), Expect = 1.853e-18
Identity = 36/66 (54.55%), Postives = 49/66 (74.24%), Query Frame = 2
Query:   83 TDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMKSTIS 280
             D+K+EEF+KYLE+ GVLD LTKVLV LYEEPEKP NAL+F++  +     + E  DV+++K  +S
Sbjct:    8 ADSKREEFRKYLEKAGVLDSLTKVLVNLYEEPEKPHNALDFVKQHLH--GGAPETADVDALKLEVS 71          
BLAST of c-Myc-binding protein vs. Ensembl Medaka
Match: ENSORLT00000043049.1 (c-Myc-binding protein [Source:NCBI gene;Acc:101175507])

HSP 1 Score: 74.3294 bits (181), Expect = 2.767e-17
Identity = 30/59 (50.85%), Postives = 47/59 (79.66%), Query Frame = 2
Query:   80 STDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDV 256
            ++D+K+E+F++YLE+ GV+D LT VLV LYE+PEKP+NALEF++  +G    + E+V+ 
Sbjct:    6 ASDSKREQFRRYLEKAGVVDSLTSVLVSLYEKPEKPTNALEFVKQNLGAVGQTSEDVEA 64          
BLAST of c-Myc-binding protein vs. Ensembl Medaka
Match: ENSORLT00000034494.1 (c-Myc-binding protein [Source:NCBI gene;Acc:101175507])

HSP 1 Score: 73.559 bits (179), Expect = 4.554e-17
Identity = 32/66 (48.48%), Postives = 51/66 (77.27%), Query Frame = 2
Query:   80 STDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMKSTI 277
            ++D+K+E+F++YLE+ GV+D LT VLV LYE+PEKP+NALEF++  +G    + E  DVE+++  +
Sbjct:    6 ASDSKREQFRRYLEKAGVVDSLTSVLVSLYEKPEKPTNALEFVKQNLGAVGQTSE--DVEALQQEV 69          
BLAST of c-Myc-binding protein vs. Ensembl Medaka
Match: mycbp (c-Myc-binding protein [Source:NCBI gene;Acc:101171593])

HSP 1 Score: 73.559 bits (179), Expect = 5.568e-17
Identity = 31/68 (45.59%), Postives = 52/68 (76.47%), Query Frame = 2
Query:   77 MSTDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMKSTIS 280
            ++ ++K+E+F++YLE+ GVLD LT +LV LYEEPEKP+NAL+F++ Q+G   +  E  D E+++  ++
Sbjct:    1 LAPESKREQFRRYLEKSGVLDTLTSILVALYEEPEKPNNALDFIKLQLGA--AGPEPADAEALRMELA 66          
BLAST of c-Myc-binding protein vs. Ensembl Medaka
Match: mycbp (c-Myc-binding protein [Source:NCBI gene;Acc:101171593])

HSP 1 Score: 71.633 bits (174), Expect = 3.148e-16
Identity = 31/64 (48.44%), Postives = 49/64 (76.56%), Query Frame = 2
Query:   89 TKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMKSTIS 280
            +K+E+F++YLE+ GVLD LT +LV LYEEPEKP+NAL+F++ Q+G   +  E  D E+++  ++
Sbjct:    3 SKREQFRRYLEKSGVLDTLTSILVALYEEPEKPNNALDFIKLQLGA--AGPEPADAEALRMELA 64          
BLAST of c-Myc-binding protein vs. Planmine SMEST
Match: SMESG000001466.1 (SMESG000001466.1)

HSP 1 Score: 172.94 bits (437), Expect = 6.661e-56
Identity = 105/105 (100.00%), Postives = 105/105 (100.00%), Query Frame = 2
Query:   77 MSTDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMKSTISXXXXXXXXXXXXXXXXKSQLEELQKNQPQELNGDTTQ 391
            MSTDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMKSTISELQQQLEQLTTENETLKSQLEELQKNQPQELNGDTTQ
Sbjct:    1 MSTDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGVTQSSDENVDVESMKSTISELQQQLEQLTTENETLKSQLEELQKNQPQELNGDTTQ 105          
BLAST of c-Myc-binding protein vs. Planmine SMEST
Match: SMESG000006427.1 (SMESG000006427.1)

HSP 1 Score: 51.9878 bits (123), Expect = 5.286e-9
Identity = 22/42 (52.38%), Postives = 32/42 (76.19%), Query Frame = 2
Query:   98 EEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIG 223
            +E++KYL+R G+ D L KVL  +Y+EPEKP  ALE++RN + 
Sbjct:   11 QEYRKYLDRSGITDNLFKVLTGIYQEPEKPLEALEYIRNNLS 52          
The following BLAST results are available for this feature:
BLAST of c-Myc-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
AL139260.35.172e-1944.30novel protein[more]
MYCBP4.258e-1849.25MYC binding protein [Source:HGNC Symbol;Acc:HGNC:7... [more]
back to top
BLAST of c-Myc-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of c-Myc-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG45464.078e-940.28gene:FBgn0038373 transcript:FBtr0083184[more]
CG172028.112e-842.86gene:FBgn0038043 transcript:FBtr0082587[more]
back to top
BLAST of c-Myc-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mycbp3.228e-1742.98MYC binding protein [Source:ZFIN;Acc:ZDB-GENE-0603... [more]
back to top
BLAST of c-Myc-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
adrb28.402e-2052.24adrenoceptor beta 2 [Source:Xenbase;Acc:XB-GENE-49... [more]
adrb28.865e-2052.24adrenoceptor beta 2 [Source:Xenbase;Acc:XB-GENE-49... [more]
back to top
BLAST of c-Myc-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Mycbp2.288e-1852.38MYC binding protein [Source:MGI Symbol;Acc:MGI:189... [more]
Mycbp1.851e-1752.38MYC binding protein [Source:MGI Symbol;Acc:MGI:189... [more]
back to top
BLAST of c-Myc-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9EQS3|MYCBP_MOUSE1.600e-1752.38c-Myc-binding protein OS=Mus musculus OX=10090 GN=... [more]
sp|Q99417|MYCBP_HUMAN2.045e-1749.25c-Myc-binding protein OS=Homo sapiens OX=9606 GN=M... [more]
sp|Q5R7A8|MYCBP_PONAB2.451e-1749.25c-Myc-binding protein OS=Pongo abelii OX=9601 GN=M... [more]
sp|Q2TBP7|MYCBP_BOVIN2.531e-1749.25c-Myc-binding protein OS=Bos taurus OX=9913 GN=MYC... [more]
sp|Q54I57|MYCBP_DICDI1.766e-1451.56c-Myc-binding protein homolog OS=Dictyostelium dis... [more]
back to top
BLAST of c-Myc-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4A7X27.469e-1959.70Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
C3YH743.144e-1859.70Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A1I8GVQ61.569e-1759.70Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0L8GMQ03.597e-1762.90Uncharacterized protein OS=Octopus bimaculoides OX... [more]
K1PTC24.554e-1754.29c-Myc-binding protein OS=Crassostrea gigas OX=2915... [more]
back to top
BLAST of c-Myc-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mycbp1.670e-1348.39MYC binding protein [Source:NCBI gene;Acc:11119701... [more]
mycbp2.226e-1348.39MYC binding protein [Source:NCBI gene;Acc:11119701... [more]
back to top
BLAST of c-Myc-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of c-Myc-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of c-Myc-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO420361.853e-1854.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of c-Myc-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000043049.12.767e-1750.85c-Myc-binding protein [Source:NCBI gene;Acc:101175... [more]
ENSORLT00000034494.14.554e-1748.48c-Myc-binding protein [Source:NCBI gene;Acc:101175... [more]
mycbp5.568e-1745.59c-Myc-binding protein [Source:NCBI gene;Acc:101171... [more]
mycbp3.148e-1648.44c-Myc-binding protein [Source:NCBI gene;Acc:101171... [more]
back to top
BLAST of c-Myc-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000001466.16.661e-56100.00SMESG000001466.1[more]
SMESG000006427.15.286e-952.38SMESG000006427.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003887 ID=SMED30003887|Name=c-Myc-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=603bp
TGTTTATTATTGTTTAAATAATTAACTTTACTTTTACAGAAGTATCTGTT
GCTATAGATTTCTAAAATAAATAAACATGTCCACGGATACTAAAAAAGAA
GAGTTTAAAAAATATTTGGAACGCTGTGGTGTTCTAGATATTCTAACAAA
AGTGCTTGTGGAGTTATACGAAGAACCAGAAAAGCCAAGCAATGCATTAG
AATTTTTACGAAATCAAATTGGTGTTACTCAGTCTTCTGATGAAAATGTA
GATGTGGAAAGTATGAAATCTACAATATCAGAATTACAACAGCAGTTGGA
ACAATTAACAACAGAAAATGAAACTTTAAAATCTCAATTAGAAGAACTTC
AAAAAAATCAACCCCAGGAATTGAATGGTGATACAACTCAATAAAACATT
TTAGTCTGTGATTTATCTATTCATTGTTTTCATGATAATGAAAATATTCA
AATAGGATTATGTTGTATCGATTTTAATAAACAATTAATGAACTTTTTAT
TCAGTTTAAAATATTTAATTAGATTGCTGTTTTATTTTTTTAATCACCTA
ATTGTTGTTGAATTTAATTTTAAATCGATGATTTATGCTAATTTGAACTT
ATA
back to top

protein sequence of SMED30003887-orf-1

>SMED30003887-orf-1 ID=SMED30003887-orf-1|Name=SMED30003887-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=106bp
MSTDTKKEEFKKYLERCGVLDILTKVLVELYEEPEKPSNALEFLRNQIGV
TQSSDENVDVESMKSTISELQQQLEQLTTENETLKSQLEELQKNQPQELN
GDTTQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:1903508positive regulation of nucleic acid-templated transcription
GO:0006355regulation of transcription, DNA-templated
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR026060AMY1
Vocabulary: molecular function
TermDefinition
GO:0003713transcription coactivator activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 60..94
NoneNo IPR availablePRINTSPR02028CMYCBINDINGPcoord: 14..28
score: 68.21
coord: 4..14
score: 57.58
coord: 28..42
score: 62.51
NoneNo IPR availableGENE3DG3DSA:1.20.5.490coord: 57..89
e-value: 4.3E-5
score: 25.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 84..105
NoneNo IPR availableSUPERFAMILYSSF58046Fibritincoord: 19..94
IPR026060Associate of Myc 1PANTHERPTHR13168ASSOCIATE OF C-MYC AMY-1coord: 2..97