Drebrin-like protein

Overview
NameDrebrin-like protein
Smed IDSMED30003885
Length (bp)2193
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Drebrin-like protein (SMED30003885) t-SNE clustered cells

Violin plots show distribution of expression levels for Drebrin-like protein (SMED30003885) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Drebrin-like protein (SMED30003885) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Drebrin-like protein (SMED30003885) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003885

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30003885SMESG000073128.1 dd_Smed_v4_1221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003885SMESG000073128.1 dd_Smed_v4_1221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
progenitor cellSMED30003885SMESG000073128.1 dd_Smed_v6_1221_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003885SMESG000073128.1 dd_Smed_v6_1221_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003885SMESG000073128.1 dd_Smed_v4_1221_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Drebrin-like protein vs. Ensembl Human
Match: DBNL (drebrin like [Source:HGNC Symbol;Acc:HGNC:2696])

HSP 1 Score: 112.079 bits (279), Expect = 1.234e-25
Identity = 60/173 (34.68%), Postives = 92/173 (53.18%), Query Frame = 1
Query:   61 MDLDLSTNGSSIKECIGKLSSGK--ISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKP--VVKSQCNTANAIQEERR 564
            M  +LS NG +++E   ++ + K    W +  Y GN   + +  TG+  LE+M +E +  ++MY F  V DPN+ L K + I+W G G   V K     H + +    K  HVTI AR  +D++ + +M+KVA ASG+NYS H E  +  +  P   V S     NA+ E +R
Sbjct:    1 MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESGRFQDVGPQAPVGSVYQKTNAVSEIKR 173          

HSP 2 Score: 61.6178 bits (148), Expect = 2.412e-9
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 1
Query: 1981 KSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            + L   A+Y Y +  D EISF+    I  +  IDEGWW+G   DG  GMFP+NYV +
Sbjct:  373 QGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFGMFPANYVEL 429          
BLAST of Drebrin-like protein vs. Ensembl Human
Match: DBNL (drebrin like [Source:HGNC Symbol;Acc:HGNC:2696])

HSP 1 Score: 112.079 bits (279), Expect = 1.374e-25
Identity = 60/173 (34.68%), Postives = 92/173 (53.18%), Query Frame = 1
Query:   61 MDLDLSTNGSSIKECIGKLSSGK--ISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKP--VVKSQCNTANAIQEERR 564
            M  +LS NG +++E   ++ + K    W +  Y GN   + +  TG+  LE+M +E +  ++MY F  V DPN+ L K + I+W G G   V K     H + +    K  HVTI AR  +D++ + +M+KVA ASG+NYS H E  +  +  P   V S     NA+ E +R
Sbjct:    1 MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESGRFQDVGPQAPVGSVYQKTNAVSEIKR 173          

HSP 2 Score: 61.6178 bits (148), Expect = 2.448e-9
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 1
Query: 1981 KSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            + L   A+Y Y +  D EISF+    I  +  IDEGWW+G   DG  GMFP+NYV +
Sbjct:  372 QGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFGMFPANYVEL 428          
BLAST of Drebrin-like protein vs. Ensembl Human
Match: DBNL (drebrin like [Source:HGNC Symbol;Acc:HGNC:2696])

HSP 1 Score: 112.079 bits (279), Expect = 1.407e-25
Identity = 60/173 (34.68%), Postives = 92/173 (53.18%), Query Frame = 1
Query:   61 MDLDLSTNGSSIKECIGKLSSGK--ISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKP--VVKSQCNTANAIQEERR 564
            M  +LS NG +++E   ++ + K    W +  Y GN   + +  TG+  LE+M +E +  ++MY F  V DPN+ L K + I+W G G   V K     H + +    K  HVTI AR  +D++ + +M+KVA ASG+NYS H E  +  +  P   V S     NA+ E +R
Sbjct:    1 MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESGRFQDVGPQAPVGSVYQKTNAVSEIKR 173          

HSP 2 Score: 62.003 bits (149), Expect = 2.204e-9
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 1
Query: 1981 KSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            + L   A+Y Y +  D EISF+    I  +  IDEGWW+G   DG  GMFP+NYV +
Sbjct:  381 QGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFGMFPANYVEL 437          
BLAST of Drebrin-like protein vs. Ensembl Human
Match: DBNL (drebrin like [Source:HGNC Symbol;Acc:HGNC:2696])

HSP 1 Score: 89.3521 bits (220), Expect = 2.546e-18
Identity = 56/173 (32.37%), Postives = 86/173 (49.71%), Query Frame = 1
Query:   61 MDLDLSTNGSSIKECIGKLSSGK--ISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKP--VVKSQCNTANAIQEERR 564
            M  +LS NG +++E   ++ + K    W +  Y GN   + +  TG+  LE+M +E +  ++MY F  V DPN+ L K + I+W   GA                      HVTI AR  +D++ + +M+KVA ASG+NYS H E  +  +  P   V S     NA+ E +R
Sbjct:    1 MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVKDPNSGLPKFVLINW---GA----------------------HVTINARAEEDVEPECIMEKVAKASGANYSFHKESGRFQDVGPQAPVGSVYQKTNAVSEIKR 148          

HSP 2 Score: 61.6178 bits (148), Expect = 2.302e-9
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 1
Query: 1981 KSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            + L   A+Y Y +  D EISF+    I  +  IDEGWW+G   DG  GMFP+NYV +
Sbjct:  348 QGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFGMFPANYVEL 404          
BLAST of Drebrin-like protein vs. Ensembl Human
Match: DBNL (drebrin like [Source:HGNC Symbol;Acc:HGNC:2696])

HSP 1 Score: 67.3958 bits (163), Expect = 7.547e-13
Identity = 34/109 (31.19%), Postives = 55/109 (50.46%), Query Frame = 1
Query:   61 MDLDLSTNGSSIKECIGKLSSGK--ISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFK 378
            M  +LS NG +++E   ++ + K    W +  Y GN   + +  TG+  LE+M +E +  ++MY F  V DPN+ L K + I+W G G   V K     H + +    K
Sbjct:    1 MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLK 109          
BLAST of Drebrin-like protein vs. Ensembl Celegans
Match: dbn-1 (DreBriN 1/DreBriN-like (Where Drebrin is from Developmentally REgulated BRaIN protein) family homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUT0])

HSP 1 Score: 68.1662 bits (165), Expect = 1.413e-11
Identity = 42/159 (26.42%), Postives = 74/159 (46.54%), Query Frame = 1
Query:   61 MDLDLSTNGSSIKECIGKLS--SGKISWMILGYSGNR-TLHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLD---LKEVMQKVAAASG-----SNYSVHNEKQQIYE 504
            M L+   +G  I+    + S  S    W+I  Y GN  TL + E G   LE+  D F   ++ +G  SV   +    K + +HWQG G   +    +  H+   R   K +H+ + AR   D++   +++ ++K+ AA+      S YS+  +   +Y+
Sbjct:    1 MTLNYHAHGKEIEASYRRASDDSDGDKWVIFDYEGNSNTLRVKEEGTGGLEEFADSFSSGKLQFGVISVRLSSDVFPKIVLVHWQGEGVPTLRLASTTPHAEEFRRFLKTVHIVLHARSEIDIEPDAIRKEVRKLPAANANAIVESTYSMPEKVNSVYQ 159          
BLAST of Drebrin-like protein vs. Ensembl Celegans
Match: cdap-2 (CD2AP homolog [Source:UniProtKB/TrEMBL;Acc:Q6A573])

HSP 1 Score: 57.3806 bits (137), Expect = 3.115e-8
Identity = 24/53 (45.28%), Postives = 37/53 (69.81%), Query Frame = 1
Query: 1996 VAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKD-GDKGMFPSNYVMI 2151
            VA Y+Y S QDDE+SF  G+ I  ++ +++GW +G+ K  G  GMFP+N+V +
Sbjct:   52 VATYAYSSKQDDELSFVVGDLIELISDVEDGWSKGKLKSTGAVGMFPTNFVTL 104          
BLAST of Drebrin-like protein vs. Ensembl Celegans
Match: nck-1 (NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family [Source:UniProtKB/TrEMBL;Acc:Q95PX0])

HSP 1 Score: 51.9878 bits (123), Expect = 5.970e-7
Identity = 20/51 (39.22%), Postives = 31/51 (60.78%), Query Frame = 1
Query: 1993 VVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYV 2145
             V  ++Y    +DE+   +G+ +Y V +  +GWW+GE  +G  G FPSNYV
Sbjct:    7 AVVKFTYEPRLEDELGLTKGDFVYVVEKSTDGWWKGEAPNGGVGWFPSNYV 57          

HSP 2 Score: 50.447 bits (119), Expect = 2.342e-6
Identity = 51/158 (32.28%), Postives = 78/158 (49.37%), Query Frame = 1
Query: 1723 KTKSAKAVFEYECQDSDEIDFXXXXXXXXXXXXXXXXXXXCNKSGKRGMFPSNYVELI--TTNDEPIDINDENYSPAN-------QQNPDEDNVEKS----LTVVAVYSYHSLQDDEISFEEGEHIYNVN--QIDEGWWQGETKDGDKGMFPSNYVMI 2151
            KTK A   F YE +  DE+    G+ +  +E+  +GWW G   +G  G FPSNYVE +  +TN     I + N + A        Q  P +    +S      VVA+YS+ +   +E+SF++GE +  V+  + D  WW      G  G+ P NY+ +
Sbjct:    4 KTK-AVVKFTYEPRLEDELGLTKGDFVYVVEKSTDGWWKGEAPNGGVGWFPSNYVEEVEASTNGNQGSIENRNPAAAAVPAPIMMQAPPPKLQASRSSFEIQVVVALYSFDASSSEELSFKKGERLEIVDHPEHDPDWWMARNASGTTGLVPRNYIEV 160          
BLAST of Drebrin-like protein vs. Ensembl Celegans
Match: nck-1 (NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family [Source:UniProtKB/TrEMBL;Acc:Q95PX0])

HSP 1 Score: 51.9878 bits (123), Expect = 5.970e-7
Identity = 20/51 (39.22%), Postives = 31/51 (60.78%), Query Frame = 1
Query: 1993 VVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYV 2145
             V  ++Y    +DE+   +G+ +Y V +  +GWW+GE  +G  G FPSNYV
Sbjct:    7 AVVKFTYEPRLEDELGLTKGDFVYVVEKSTDGWWKGEAPNGGVGWFPSNYV 57          

HSP 2 Score: 50.447 bits (119), Expect = 2.342e-6
Identity = 51/158 (32.28%), Postives = 78/158 (49.37%), Query Frame = 1
Query: 1723 KTKSAKAVFEYECQDSDEIDFXXXXXXXXXXXXXXXXXXXCNKSGKRGMFPSNYVELI--TTNDEPIDINDENYSPAN-------QQNPDEDNVEKS----LTVVAVYSYHSLQDDEISFEEGEHIYNVN--QIDEGWWQGETKDGDKGMFPSNYVMI 2151
            KTK A   F YE +  DE+    G+ +  +E+  +GWW G   +G  G FPSNYVE +  +TN     I + N + A        Q  P +    +S      VVA+YS+ +   +E+SF++GE +  V+  + D  WW      G  G+ P NY+ +
Sbjct:    4 KTK-AVVKFTYEPRLEDELGLTKGDFVYVVEKSTDGWWKGEAPNGGVGWFPSNYVEEVEASTNGNQGSIENRNPAAAAVPAPIMMQAPPPKLQASRSSFEIQVVVALYSFDASSSEELSFKKGERLEIVDHPEHDPDWWMARNASGTTGLVPRNYIEV 160          
BLAST of Drebrin-like protein vs. Ensembl Celegans
Match: nck-1 (NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family [Source:UniProtKB/TrEMBL;Acc:Q95PX0])

HSP 1 Score: 51.9878 bits (123), Expect = 5.970e-7
Identity = 20/51 (39.22%), Postives = 31/51 (60.78%), Query Frame = 1
Query: 1993 VVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYV 2145
             V  ++Y    +DE+   +G+ +Y V +  +GWW+GE  +G  G FPSNYV
Sbjct:    7 AVVKFTYEPRLEDELGLTKGDFVYVVEKSTDGWWKGEAPNGGVGWFPSNYV 57          

HSP 2 Score: 50.447 bits (119), Expect = 2.342e-6
Identity = 51/158 (32.28%), Postives = 78/158 (49.37%), Query Frame = 1
Query: 1723 KTKSAKAVFEYECQDSDEIDFXXXXXXXXXXXXXXXXXXXCNKSGKRGMFPSNYVELI--TTNDEPIDINDENYSPAN-------QQNPDEDNVEKS----LTVVAVYSYHSLQDDEISFEEGEHIYNVN--QIDEGWWQGETKDGDKGMFPSNYVMI 2151
            KTK A   F YE +  DE+    G+ +  +E+  +GWW G   +G  G FPSNYVE +  +TN     I + N + A        Q  P +    +S      VVA+YS+ +   +E+SF++GE +  V+  + D  WW      G  G+ P NY+ +
Sbjct:    4 KTK-AVVKFTYEPRLEDELGLTKGDFVYVVEKSTDGWWKGEAPNGGVGWFPSNYVEEVEASTNGNQGSIENRNPAAAAVPAPIMMQAPPPKLQASRSSFEIQVVVALYSFDASSSEELSFKKGERLEIVDHPEHDPDWWMARNASGTTGLVPRNYIEV 160          
BLAST of Drebrin-like protein vs. Ensembl Fly
Match: Abp1 (gene:FBgn0036372 transcript:FBtr0075819)

HSP 1 Score: 85.8853 bits (211), Expect = 3.805e-17
Identity = 44/129 (34.11%), Postives = 69/129 (53.49%), Query Frame = 1
Query:  136 WMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKPVV 519
            W + GY G    L +V TGD  ++++ ++ +  +IMY F  + DP T L K + I+WQG GA  + K     H   V +L    H+TI AR+  D+DL  +++K++  S S YS    +  + E K  V
Sbjct:   28 WSLFGYEGQTNELKVVATGDGGVDELNEDLNSGKIMYAFVRIEDPKTGLNKYLLINWQGEGAPVLRKGTCANHIRDVSNLLSGAHLTINARNEDDIDLDRLLKKLSTVS-SAYSFKEPRGAMEEQKAPV 155          

HSP 2 Score: 65.855 bits (159), Expect = 7.883e-11
Identity = 26/51 (50.98%), Postives = 37/51 (72.55%), Query Frame = 1
Query: 1999 AVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            A+Y Y +  + EI+F+ G+ I +++QIDEGWWQG   DG  G+FP+NYV I
Sbjct:  479 ALYDYQAADETEITFDPGDVITHIDQIDEGWWQGLGPDGTYGLFPANYVEI 529          
BLAST of Drebrin-like protein vs. Ensembl Fly
Match: Abi (gene:FBgn0020510 transcript:FBtr0307076)

HSP 1 Score: 60.077 bits (144), Expect = 4.275e-9
Identity = 25/51 (49.02%), Postives = 37/51 (72.55%), Query Frame = 1
Query: 1993 VVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYV 2145
            VVA+Y Y++ +DDE+SF+E   +Y + + D+GWW+G   DG  G+FP NYV
Sbjct:  419 VVAIYDYYADKDDELSFQESSVLYVLKKNDDGWWEG-VMDGVTGLFPGNYV 468          
BLAST of Drebrin-like protein vs. Ensembl Fly
Match: Abi (gene:FBgn0020510 transcript:FBtr0337096)

HSP 1 Score: 60.077 bits (144), Expect = 4.275e-9
Identity = 25/51 (49.02%), Postives = 37/51 (72.55%), Query Frame = 1
Query: 1993 VVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYV 2145
            VVA+Y Y++ +DDE+SF+E   +Y + + D+GWW+G   DG  G+FP NYV
Sbjct:  419 VVAIYDYYADKDDELSFQESSVLYVLKKNDDGWWEG-VMDGVTGLFPGNYV 468          
BLAST of Drebrin-like protein vs. Ensembl Fly
Match: Abi (gene:FBgn0020510 transcript:FBtr0337097)

HSP 1 Score: 60.077 bits (144), Expect = 4.284e-9
Identity = 25/51 (49.02%), Postives = 37/51 (72.55%), Query Frame = 1
Query: 1993 VVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYV 2145
            VVA+Y Y++ +DDE+SF+E   +Y + + D+GWW+G   DG  G+FP NYV
Sbjct:  420 VVAIYDYYADKDDELSFQESSVLYVLKKNDDGWWEG-VMDGVTGLFPGNYV 469          
BLAST of Drebrin-like protein vs. Ensembl Fly
Match: Abi (gene:FBgn0020510 transcript:FBtr0082910)

HSP 1 Score: 60.077 bits (144), Expect = 4.284e-9
Identity = 25/51 (49.02%), Postives = 37/51 (72.55%), Query Frame = 1
Query: 1993 VVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYV 2145
            VVA+Y Y++ +DDE+SF+E   +Y + + D+GWW+G   DG  G+FP NYV
Sbjct:  420 VVAIYDYYADKDDELSFQESSVLYVLKKNDDGWWEG-VMDGVTGLFPGNYV 469          
BLAST of Drebrin-like protein vs. Ensembl Zebrafish
Match: dbnlb (drebrin-like b [Source:ZFIN;Acc:ZDB-GENE-050522-293])

HSP 1 Score: 116.701 bits (291), Expect = 1.790e-27
Identity = 62/172 (36.05%), Postives = 97/172 (56.40%), Query Frame = 1
Query:   61 MDLDLSTNGSSIK----ECIGKLSSGKISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKP--VVKSQCNTANAIQE 555
            M ++LS NG ++     E +G+ S  + +W++  Y GN   + + E GD  LE+M +E +  ++MYGF  V DPN+ L K + I+W G G +   K +   H +++ +  K  HVTI AR  +D++   VM+KVA ASG+NYS H E  +  ++ P   V S     NA+ E
Sbjct:    1 MAVNLSKNGPALTAAYNEVVGEKS--ETNWVLFTYEGNTNDIRLAEKGDGGLEEMVEELNSGKVMYGFCRVKDPNSGLPKYVLINWTGEGVKDARKGQCANHVSSMANFLKGAHVTINARAEEDVEPDAVMEKVAKASGANYSFHKETSRFRDSGPQGPVGSVYQKTNAMSE 170          

HSP 2 Score: 64.3142 bits (155), Expect = 2.581e-10
Identity = 30/74 (40.54%), Postives = 44/74 (59.46%), Query Frame = 1
Query: 1930 ENYSPANQQNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            EN +   +Q+  E   E+ +   A+Y Y +  D EISF+  + I ++  IDEGWW+G   DG  GMFP+NYV +
Sbjct:  346 ENPTQVEEQSTYEPVDERGVCARALYDYQAADDTEISFDPDDIITSIEMIDEGWWRGYGPDGHFGMFPANYVEL 419          
BLAST of Drebrin-like protein vs. Ensembl Zebrafish
Match: dbnlb (drebrin-like b [Source:ZFIN;Acc:ZDB-GENE-050522-293])

HSP 1 Score: 117.857 bits (294), Expect = 1.817e-27
Identity = 62/172 (36.05%), Postives = 97/172 (56.40%), Query Frame = 1
Query:   61 MDLDLSTNGSSIK----ECIGKLSSGKISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKP--VVKSQCNTANAIQE 555
            M ++LS NG ++     E +G+ S  + +W++  Y GN   + + E GD  LE+M +E +  ++MYGF  V DPN+ L K + I+W G G +   K +   H +++ +  K  HVTI AR  +D++   VM+KVA ASG+NYS H E  +  ++ P   V S     NA+ E
Sbjct:    1 MAVNLSKNGPALTAAYNEVVGEKS--ETNWVLFTYEGNTNDIRLAEKGDGGLEEMVEELNSGKVMYGFCRVKDPNSGLPKYVLINWTGEGVKDARKGQCANHVSSMANFLKGAHVTINARAEEDVEPDAVMEKVAKASGANYSFHKETSRFRDSGPQGPVGSVYQKTNAMSE 170          

HSP 2 Score: 64.6994 bits (156), Expect = 2.037e-10
Identity = 26/58 (44.83%), Postives = 37/58 (63.79%), Query Frame = 1
Query: 1978 EKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            E+ +   A+Y Y +  D EISF+  + I ++  IDEGWW+G   DG  GMFP+NYV +
Sbjct:  418 ERGVCARALYDYQAADDTEISFDPDDIITSIEMIDEGWWRGYGPDGHFGMFPANYVEL 475          
BLAST of Drebrin-like protein vs. Ensembl Zebrafish
Match: dbnla (drebrin-like a [Source:ZFIN;Acc:ZDB-GENE-040704-42])

HSP 1 Score: 115.931 bits (289), Expect = 7.617e-27
Identity = 52/152 (34.21%), Postives = 87/152 (57.24%), Query Frame = 1
Query:   61 MDLDLSTNGSSIKECIGKLSSGKISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKP 513
            M ++LS NG ++ E   ++ SGK  W++  Y GN   + +   GD  LE+M DE +  ++MY F  V+DP++ + K + I+W G G + + K    +H  ++ +  +  HVTI AR   D++   +M+KVA  SG NY++H E  Q   ++P
Sbjct:    1 MAVNLSKNGPALTEAYDEVVSGKKDWVLFTYEGNSNDIRVAGKGDGGLEEMVDELNSGKVMYAFCRVLDPSSGVPKFVLINWTGEGVKDLRKGVCARHVHSMANFLRGAHVTINARSDDDVEPAAIMEKVAKGSGVNYNIHRESSQNNHSEP 152          

HSP 2 Score: 65.0846 bits (157), Expect = 1.702e-10
Identity = 29/71 (40.85%), Postives = 45/71 (63.38%), Query Frame = 1
Query: 1939 SPANQQNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            SPA+++   E+   +++   A+Y Y +  D EISF+  + I  ++ IDEGWW+G   DG  GMFP+NYV +
Sbjct:  428 SPADEE---ENGDNQNICARALYDYQASDDTEISFDPDDVISGIDMIDEGWWRGYGPDGHYGMFPANYVEL 495          
BLAST of Drebrin-like protein vs. Ensembl Zebrafish
Match: si:dkey-40c11.2 (si:dkey-40c11.2 [Source:ZFIN;Acc:ZDB-GENE-060526-300])

HSP 1 Score: 65.4698 bits (158), Expect = 6.688e-12
Identity = 27/56 (48.21%), Postives = 40/56 (71.43%), Query Frame = 1
Query: 1978 EKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYV 2145
            E+ L V A+Y Y +  D E+SFE G+ I +V  ID+ WW+G +KDG +G+FP+N+V
Sbjct:  113 ERLLRVRALYDYQAEDDTELSFEPGDIISDVETIDKAWWRGCSKDGRQGLFPANFV 168          
BLAST of Drebrin-like protein vs. Ensembl Zebrafish
Match: si:dkey-40c11.2 (si:dkey-40c11.2 [Source:ZFIN;Acc:ZDB-GENE-060526-300])

HSP 1 Score: 68.9366 bits (167), Expect = 1.461e-11
Identity = 28/60 (46.67%), Postives = 42/60 (70.00%), Query Frame = 1
Query: 1966 EDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYV 2145
            E + E+ L V A+Y Y +  D E+SFE G+ I +V  ID+ WW+G +KDG +G+FP+N+V
Sbjct:  683 ESSPERLLRVRALYDYQAEDDTELSFEPGDIISDVETIDKAWWRGCSKDGRQGLFPANFV 742          

HSP 2 Score: 55.8398 bits (133), Expect = 1.683e-7
Identity = 25/106 (23.58%), Postives = 50/106 (47.17%), Query Frame = 1
Query:  136 WMILGYSG-NRTLHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVA 450
            W +  Y G +  L + ++G   L ++  +FH S  +YG   V    T   + + + W G G  ++ + +   H  A+++ FK     ITA    ++  ++++  VA
Sbjct:   29 WALFTYEGVSNNLKLTDSGAGGLTELVGKFHNSRPVYGLCRVGLTETGQPQIVMVCWVGDGVDELRRAECASHVPAIKNFFKEAQAFITASQQDEVTEEQILAAVA 134          
BLAST of Drebrin-like protein vs. Ensembl Xenopus
Match: ap2s1 (adaptor related protein complex 2 subunit sigma 1 [Source:Xenbase;Acc:XB-GENE-999486])

HSP 1 Score: 103.99 bits (258), Expect = 1.738e-23
Identity = 57/172 (33.14%), Postives = 90/172 (52.33%), Query Frame = 1
Query:   61 MDLDLSTNGSSIKECIGKL--SSGKISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYE-TKPVVKSQCNTANAIQEERR 564
            M ++LS NG++++     +     K  W +  Y GN   + + ETGD  LE++ +E    ++MY F  V DPN+ L K + ++W G G     K     H + + +  K  HVTI AR  +D++   +M+KVA ASG+NY+ H E  +  E  +  V S     NA+ E +R
Sbjct:    1 MSVNLSKNGAALQAAYKDVLDEKTKTDWALYTYEGNSNDIRLAETGDGGLEELVEELSSGKVMYAFCRVKDPNSGLPKFVLVNWTGEGVNDARKGVCANHVSTMANFLKGAHVTINARAEEDVEPDAIMEKVAKASGANYNFHKESNRGNEGPQGPVGSVYQKTNAMSEIKR 172          

HSP 2 Score: 60.4622 bits (145), Expect = 4.266e-9
Identity = 32/85 (37.65%), Postives = 48/85 (56.47%), Query Frame = 1
Query: 1897 TTNDEPIDINDENYSPANQQNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            TT DE I  +     P  +   +ED   + +   A+Y Y +  D EISF+  + I ++ +IDEGWW+G   +G  GMFP+NYV +
Sbjct:  265 TTEDENIYQDTPLDEPVYETGVEED---RGICARALYDYQAADDTEISFDPDDFITHIEKIDEGWWRGIGPNGHFGMFPANYVEL 346          
BLAST of Drebrin-like protein vs. Ensembl Xenopus
Match: ap2s1 (adaptor related protein complex 2 subunit sigma 1 [Source:Xenbase;Acc:XB-GENE-999486])

HSP 1 Score: 105.145 bits (261), Expect = 3.225e-23
Identity = 50/145 (34.48%), Postives = 79/145 (54.48%), Query Frame = 1
Query:   61 MDLDLSTNGSSIKECIGKL--SSGKISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNE 486
            M ++LS NG++++     +     K  W +  Y GN   + + ETGD  LE++ +E    ++MY F  V DPN+ L K + ++W G G     K     H + + +  K  HVTI AR  +D++   +M+KVA ASG+NY+ H E
Sbjct:    1 MSVNLSKNGAALQAAYKDVLDEKTKTDWALYTYEGNSNDIRLAETGDGGLEELVEELSSGKVMYAFCRVKDPNSGLPKFVLVNWTGEGVNDARKGVCANHVSTMANFLKGAHVTINARAEEDVEPDAIMEKVAKASGANYNFHKE 145          

HSP 2 Score: 62.7734 bits (151), Expect = 1.083e-9
Identity = 32/85 (37.65%), Postives = 48/85 (56.47%), Query Frame = 1
Query: 1897 TTNDEPIDINDENYSPANQQNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            TT DE I  +     P  +   +ED   + +   A+Y Y +  D EISF+  + I ++ +IDEGWW+G   +G  GMFP+NYV +
Sbjct:  354 TTEDENIYQDTPLDEPVYETGVEED---RGICARALYDYQAADDTEISFDPDDFITHIEKIDEGWWRGIGPNGHFGMFPANYVEL 435          
BLAST of Drebrin-like protein vs. Ensembl Xenopus
Match: ap2s1 (adaptor related protein complex 2 subunit sigma 1 [Source:Xenbase;Acc:XB-GENE-999486])

HSP 1 Score: 104.375 bits (259), Expect = 3.645e-23
Identity = 57/172 (33.14%), Postives = 90/172 (52.33%), Query Frame = 1
Query:   61 MDLDLSTNGSSIKECIGKL--SSGKISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYET-KPVVKSQCNTANAIQEERR 564
            M ++LS NG++++     +     K  W +  Y GN   + + ETGD  LE++ +E    ++MY F  V DPN+ L K + ++W G G     K     H + + +  K  HVTI AR  +D++   +M+KVA ASG+NY+ H E  +  E  +  V S     NA+ E +R
Sbjct:    1 MSVNLSKNGAALQAAYKDVLDEKTKTDWALYTYEGNSNDIRLAETGDGGLEELVEELSSGKVMYAFCRVKDPNSGLPKFVLVNWTGEGVNDARKGVCANHVSTMANFLKGAHVTINARAEEDVEPDAIMEKVAKASGANYNFHKESNRGNEGPQGPVGSVYQKTNAMSEIKR 172          

HSP 2 Score: 62.3882 bits (150), Expect = 1.271e-9
Identity = 32/85 (37.65%), Postives = 48/85 (56.47%), Query Frame = 1
Query: 1897 TTNDEPIDINDENYSPANQQNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            TT DE I  +     P  +   +ED   + +   A+Y Y +  D EISF+  + I ++ +IDEGWW+G   +G  GMFP+NYV +
Sbjct:  354 TTEDENIYQDTPLDEPVYETGVEED---RGICARALYDYQAADDTEISFDPDDFITHIEKIDEGWWRGIGPNGHFGMFPANYVEL 435          
BLAST of Drebrin-like protein vs. Ensembl Xenopus
Match: ap2s1 (adaptor related protein complex 2 subunit sigma 1 [Source:Xenbase;Acc:XB-GENE-999486])

HSP 1 Score: 103.99 bits (258), Expect = 3.649e-23
Identity = 57/172 (33.14%), Postives = 90/172 (52.33%), Query Frame = 1
Query:   61 MDLDLSTNGSSIKECIGKL--SSGKISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYE-TKPVVKSQCNTANAIQEERR 564
            M ++LS NG++++     +     K  W +  Y GN   + + ETGD  LE++ +E    ++MY F  V DPN+ L K + ++W G G     K     H + + +  K  HVTI AR  +D++   +M+KVA ASG+NY+ H E  +  E  +  V S     NA+ E +R
Sbjct:    1 MSVNLSKNGAALQAAYKDVLDEKTKTDWALYTYEGNSNDIRLAETGDGGLEELVEELSSGKVMYAFCRVKDPNSGLPKFVLVNWTGEGVNDARKGVCANHVSTMANFLKGAHVTINARAEEDVEPDAIMEKVAKASGANYNFHKESNRGNEGPQGPVGSVYQKTNAMSEIKR 172          

HSP 2 Score: 61.2326 bits (147), Expect = 3.390e-9
Identity = 32/85 (37.65%), Postives = 48/85 (56.47%), Query Frame = 1
Query: 1897 TTNDEPIDINDENYSPANQQNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            TT DE I  +     P  +   +ED   + +   A+Y Y +  D EISF+  + I ++ +IDEGWW+G   +G  GMFP+NYV +
Sbjct:  326 TTEDENIYQDTPLDEPVYETGVEED---RGICARALYDYQAADDTEISFDPDDFITHIEKIDEGWWRGIGPNGHFGMFPANYVEL 407          
BLAST of Drebrin-like protein vs. Ensembl Xenopus
Match: ap2s1 (adaptor related protein complex 2 subunit sigma 1 [Source:Xenbase;Acc:XB-GENE-999486])

HSP 1 Score: 103.99 bits (258), Expect = 5.096e-23
Identity = 57/172 (33.14%), Postives = 90/172 (52.33%), Query Frame = 1
Query:   61 MDLDLSTNGSSIKECIGKL--SSGKISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYE-TKPVVKSQCNTANAIQEERR 564
            M ++LS NG++++     +     K  W +  Y GN   + + ETGD  LE++ +E    ++MY F  V DPN+ L K + ++W G G     K     H + + +  K  HVTI AR  +D++   +M+KVA ASG+NY+ H E  +  E  +  V S     NA+ E +R
Sbjct:    1 MSVNLSKNGAALQAAYKDVLDEKTKTDWALYTYEGNSNDIRLAETGDGGLEELVEELSSGKVMYAFCRVKDPNSGLPKFVLVNWTGEGVNDARKGVCANHVSTMANFLKGAHVTINARAEEDVEPDAIMEKVAKASGANYNFHKESNRGNEGPQGPVGSVYQKTNAMSEIKR 172          

HSP 2 Score: 61.2326 bits (147), Expect = 3.396e-9
Identity = 32/85 (37.65%), Postives = 48/85 (56.47%), Query Frame = 1
Query: 1897 TTNDEPIDINDENYSPANQQNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            TT DE I  +     P  +   +ED   + +   A+Y Y +  D EISF+  + I ++ +IDEGWW+G   +G  GMFP+NYV +
Sbjct:  340 TTEDENIYQDTPLDEPVYETGVEED---RGICARALYDYQAADDTEISFDPDDFITHIEKIDEGWWRGIGPNGHFGMFPANYVEL 421          
BLAST of Drebrin-like protein vs. Ensembl Mouse
Match: Dbnl (drebrin-like [Source:MGI Symbol;Acc:MGI:700006])

HSP 1 Score: 95.9005 bits (237), Expect = 2.084e-20
Identity = 60/173 (34.68%), Postives = 93/173 (53.76%), Query Frame = 1
Query:   61 MDLDLSTNGSSIKECIGKLSSGK--ISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKP--VVKSQCNTANAIQEERR 564
            M ++LS NG +++E   ++ + K    W +  Y GN   + +  TG+  LE++ +E +  ++MY F  V DPN+ L K + I+W G G   V K     H + + +  K  HVTI AR  +D++ + +M+KVA ASG+NYS H E     +  P   V S     NAI E +R
Sbjct:    1 MAVNLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEELVEELNSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACANHVSTMANFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESTSFQDVGPQAPVGSVYQKTNAISEIKR 173          

HSP 2 Score: 60.077 bits (144), Expect = 6.242e-9
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 1
Query: 1981 KSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            + L   A+Y Y +  D EISF+    I  +  IDEGWW+G   DG  GMFP+NYV +
Sbjct:  378 QGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFGMFPANYVEL 434          
BLAST of Drebrin-like protein vs. Ensembl Mouse
Match: Dbnl (drebrin-like [Source:MGI Symbol;Acc:MGI:700006])

HSP 1 Score: 95.5153 bits (236), Expect = 2.164e-20
Identity = 60/173 (34.68%), Postives = 93/173 (53.76%), Query Frame = 1
Query:   61 MDLDLSTNGSSIKECIGKLSSGK--ISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKP--VVKSQCNTANAIQEERR 564
            M ++LS NG +++E   ++ + K    W +  Y GN   + +  TG+  LE++ +E +  ++MY F  V DPN+ L K + I+W G G   V K     H + + +  K  HVTI AR  +D++ + +M+KVA ASG+NYS H E     +  P   V S     NAI E +R
Sbjct:    1 MAVNLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEELVEELNSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACANHVSTMANFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESTSFQDVGPQAPVGSVYQKTNAISEIKR 173          

HSP 2 Score: 60.077 bits (144), Expect = 6.394e-9
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 1
Query: 1981 KSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            + L   A+Y Y +  D EISF+    I  +  IDEGWW+G   DG  GMFP+NYV +
Sbjct:  374 QGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFGMFPANYVEL 430          
BLAST of Drebrin-like protein vs. Ensembl Mouse
Match: Dbnl (drebrin-like [Source:MGI Symbol;Acc:MGI:700006])

HSP 1 Score: 95.5153 bits (236), Expect = 2.183e-20
Identity = 60/173 (34.68%), Postives = 93/173 (53.76%), Query Frame = 1
Query:   61 MDLDLSTNGSSIKECIGKLSSGK--ISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKP--VVKSQCNTANAIQEERR 564
            M ++LS NG +++E   ++ + K    W +  Y GN   + +  TG+  LE++ +E +  ++MY F  V DPN+ L K + I+W G G   V K     H + + +  K  HVTI AR  +D++ + +M+KVA ASG+NYS H E     +  P   V S     NAI E +R
Sbjct:    1 MAVNLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEELVEELNSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACANHVSTMANFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESTSFQDVGPQAPVGSVYQKTNAISEIKR 173          

HSP 2 Score: 60.077 bits (144), Expect = 6.191e-9
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 1
Query: 1981 KSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            + L   A+Y Y +  D EISF+    I  +  IDEGWW+G   DG  GMFP+NYV +
Sbjct:  375 QGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFGMFPANYVEL 431          
BLAST of Drebrin-like protein vs. Ensembl Mouse
Match: Itsn1 (intersectin 1 (SH3 domain protein 1A) [Source:MGI Symbol;Acc:MGI:1338069])

HSP 1 Score: 65.855 bits (159), Expect = 2.023e-10
Identity = 35/99 (35.35%), Postives = 53/99 (53.54%), Query Frame = 1
Query: 1864 GMFPSNYVELI---TTNDEPIDINDENYSPANQQNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            G FP+NYV+L+   T+   P ++      PA  Q            V+ +Y Y +  DDE++F +G+ I  +N+ D  WW+GE   G  G+FPSNYV +
Sbjct: 1119 GWFPANYVKLLSPGTSKITPTELPKTAVQPAVCQ------------VIGMYDYTAQNDDELAFSKGQIINVLNKEDPDWWKGEV-SGQVGLFPSNYVKL 1204          

HSP 2 Score: 53.5286 bits (127), Expect = 1.015e-6
Identity = 35/106 (33.02%), Postives = 58/106 (54.72%), Query Frame = 1
Query: 1855 GKRGMFPSNYVELIT---TNDEPIDINDENYSPANQQNPDEDNVEKSLT---VVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDK-GMFPSNYVMI 2151
            G++G FP +YV+LI+        ID      SPA+ +       + ++     +A+Y+Y S +  +++F++G+ I  V + D  WW G    GDK G+FPSNYV +
Sbjct:  949 GQKGWFPKSYVKLISGPVRKSTSIDTGPTE-SPASLKRVASPAAKPAIPGEEFIAMYTYESSEQGDLTFQQGDVIV-VTKKDGDWWTGTV--GDKSGVFPSNYVRL 1050          
BLAST of Drebrin-like protein vs. Ensembl Mouse
Match: Itsn1 (intersectin 1 (SH3 domain protein 1A) [Source:MGI Symbol;Acc:MGI:1338069])

HSP 1 Score: 65.855 bits (159), Expect = 2.095e-10
Identity = 35/99 (35.35%), Postives = 53/99 (53.54%), Query Frame = 1
Query: 1864 GMFPSNYVELI---TTNDEPIDINDENYSPANQQNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            G FP+NYV+L+   T+   P ++      PA  Q            V+ +Y Y +  DDE++F +G+ I  +N+ D  WW+GE   G  G+FPSNYV +
Sbjct: 1124 GWFPANYVKLLSPGTSKITPTELPKTAVQPAVCQ------------VIGMYDYTAQNDDELAFSKGQIINVLNKEDPDWWKGEV-SGQVGLFPSNYVKL 1209          

HSP 2 Score: 53.5286 bits (127), Expect = 1.068e-6
Identity = 35/106 (33.02%), Postives = 58/106 (54.72%), Query Frame = 1
Query: 1855 GKRGMFPSNYVELIT---TNDEPIDINDENYSPANQQNPDEDNVEKSLT---VVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDK-GMFPSNYVMI 2151
            G++G FP +YV+LI+        ID      SPA+ +       + ++     +A+Y+Y S +  +++F++G+ I  V + D  WW G    GDK G+FPSNYV +
Sbjct:  954 GQKGWFPKSYVKLISGPVRKSTSIDTGPTE-SPASLKRVASPAAKPAIPGEEFIAMYTYESSEQGDLTFQQGDVIV-VTKKDGDWWTGTV--GDKSGVFPSNYVRL 1055          
BLAST of Drebrin-like protein vs. UniProt/SwissProt
Match: sp|A6H7G2|DBNL_BOVIN (Drebrin-like protein OS=Bos taurus OX=9913 GN=DBNL PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 1.149e-25
Identity = 62/173 (35.84%), Postives = 94/173 (54.34%), Query Frame = 1
Query:   61 MDLDLSTNGSSIKECIGKLSSGKIS--WMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKP--VVKSQCNTANAIQEERR 564
            M ++LS NG ++ E   ++ + K S  W +  Y GN   + +  TG+  LE+M +E +  ++MY F  V DPN+ L K + I+W G G   V K     H + +    K  HVTI AR  +D++ + +MQKVA ASG+NY+ H E  +  +T P   V S     NA+ E +R
Sbjct:    1 MAVNLSRNGPALLEAYQQVVNEKSSTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACANHVSTMAGFLKGAHVTINARAEEDVEPECIMQKVARASGANYTFHKESSRFQDTGPQAPVGSVYQKTNAVSEIKR 173          

HSP 2 Score: 59.6918 bits (143), Expect = 5.523e-8
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 1
Query: 1981 KSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            K L   A+Y Y +  + EISF+    I  +  IDEGWW+G   DG  GMFP+NYV +
Sbjct:  365 KGLCARALYDYQAADETEISFDPENLITGIEVIDEGWWRGYGPDGHFGMFPANYVEL 421          
BLAST of Drebrin-like protein vs. UniProt/SwissProt
Match: sp|Q9UJU6|DBNL_HUMAN (Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 6.597e-25
Identity = 60/173 (34.68%), Postives = 92/173 (53.18%), Query Frame = 1
Query:   61 MDLDLSTNGSSIKECIGKLSSGK--ISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKP--VVKSQCNTANAIQEERR 564
            M  +LS NG +++E   ++ + K    W +  Y GN   + +  TG+  LE+M +E +  ++MY F  V DPN+ L K + I+W G G   V K     H + +    K  HVTI AR  +D++ + +M+KVA ASG+NYS H E  +  +  P   V S     NA+ E +R
Sbjct:    1 MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESGRFQDVGPQAPVGSVYQKTNAVSEIKR 173          

HSP 2 Score: 61.6178 bits (148), Expect = 1.175e-8
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 1
Query: 1981 KSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            + L   A+Y Y +  D EISF+    I  +  IDEGWW+G   DG  GMFP+NYV +
Sbjct:  372 QGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFGMFPANYVEL 428          
BLAST of Drebrin-like protein vs. UniProt/SwissProt
Match: sp|Q7ZXQ9|DBNLA_XENLA (Drebrin-like protein A OS=Xenopus laevis OX=8355 GN=dbnl-a PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.647e-23
Identity = 57/172 (33.14%), Postives = 93/172 (54.07%), Query Frame = 1
Query:   61 MDLDLSTNGSSIKECIGKL--SSGKISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYET-KPVVKSQCNTANAIQEERR 564
            M ++LS NG++++     +     K  W +  Y GN   + + ETGD  LE++ +E    ++MY F  V DPN+ L K + ++W G G +   K     H + + +  K  HVTI AR  +D++ + +M+KVA ASG+NY+ H E ++  E  +  V S     NA+ E +R
Sbjct:    1 MSVNLSKNGAALQGAYKDVLDEKTKTDWALYTYEGNSNDIRLAETGDGGLEELVEELSSGKVMYAFCRVKDPNSGLPKFVLVNWTGEGVKDARKGACANHVSTMANFLKGAHVTINARAEEDVEPESIMEKVAKASGANYNFHKESKRGNEGPQGPVGSVYQKTNAMSEIKR 172          

HSP 2 Score: 62.003 bits (149), Expect = 1.171e-8
Identity = 26/58 (44.83%), Postives = 36/58 (62.07%), Query Frame = 1
Query: 1978 EKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            EK +   A+Y Y +  D EISF+  + I  +  IDEGWW+G +  G  GMFP+NYV +
Sbjct:  388 EKGVCARALYDYQAADDTEISFDPDDLITQIQFIDEGWWRGFSPAGHFGMFPANYVEL 445          
BLAST of Drebrin-like protein vs. UniProt/SwissProt
Match: sp|Q6GM14|DBNLB_XENLA (Drebrin-like protein B OS=Xenopus laevis OX=8355 GN=dbnl-b PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.897e-23
Identity = 58/172 (33.72%), Postives = 91/172 (52.91%), Query Frame = 1
Query:   61 MDLDLSTNGSSIKECIGKL--SSGKISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYET-KPVVKSQCNTANAIQEERR 564
            M ++LS NG++++     +     K  W +  Y GN   + + ETGD  LE++ +E    ++MY F  V DPN+ L K + I+W G G +   K     H + +    K  HVTI AR  +D++ + +M+KVA ASG+NY+ H E  +  E  +  V S     NA+ E +R
Sbjct:    1 MSVNLSKNGAALQAAYKDVLDEKTKTDWALYTYEGNSNDIRLAETGDGGLEELVEELSSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVKDARKGMCANHVSTMASFLKGAHVTINARAEEDVEPESIMEKVAKASGANYNFHKESNRGNEGPQGPVGSVYQKTNAMSEIKR 172          

HSP 2 Score: 58.151 bits (139), Expect = 1.283e-7
Identity = 27/71 (38.03%), Postives = 38/71 (53.52%), Query Frame = 1
Query: 1960 PDEDNV-------EKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            P ED V       +  +   A+Y Y +  D EISF+  + I  +  ID+GWW+G    G  GMFP+NYV +
Sbjct:  304 PQEDPVYETGVAEDSGMCARALYDYQAADDTEISFDPDDVIIQIEMIDDGWWRGVAPSGHFGMFPANYVEL 374          
BLAST of Drebrin-like protein vs. UniProt/SwissProt
Match: sp|Q62418|DBNL_MOUSE (Drebrin-like protein OS=Mus musculus OX=10090 GN=Dbnl PE=1 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 1.458e-19
Identity = 60/173 (34.68%), Postives = 93/173 (53.76%), Query Frame = 1
Query:   61 MDLDLSTNGSSIKECIGKLSSGK--ISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKP--VVKSQCNTANAIQEERR 564
            M ++LS NG +++E   ++ + K    W +  Y GN   + +  TG+  LE++ +E +  ++MY F  V DPN+ L K + I+W G G   V K     H + + +  K  HVTI AR  +D++ + +M+KVA ASG+NYS H E     +  P   V S     NAI E +R
Sbjct:    1 MAVNLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEELVEELNSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACANHVSTMANFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESTSFQDVGPQAPVGSVYQKTNAISEIKR 173          

HSP 2 Score: 60.077 bits (144), Expect = 4.366e-8
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 1
Query: 1981 KSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            + L   A+Y Y +  D EISF+    I  +  IDEGWW+G   DG  GMFP+NYV +
Sbjct:  378 QGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFGMFPANYVEL 434          
BLAST of Drebrin-like protein vs. TrEMBL
Match: A0A267EQZ3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024634g1 PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 6.565e-49
Identity = 138/427 (32.32%), Postives = 218/427 (51.05%), Query Frame = 1
Query:   67 LDLSTNGSSIKECIGKLSS--GKISWMILGYSGNR-TLHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKPVV----KSQCNTANAIQEERRKELASLGNMKNEFSDNRKNNSPQVNI--------------SNKPVVFSKPGVTKVGTNYEKINPEKEFKSLNLHQKSTYETQARIQSENNTAEKAREERQKELSKLANRTYIDEGFQQVGTNYTKINPIAEIQKLKRQSVSNESESPIRSPSANYTKCDALDEITRLRRESVNNDDGSVFTTSTYKKINPVSELQELRKSHQIADKIETTSSSSYKKINPIEEIKNLRAKSELISNEPTPVTSSYKKINPAEEI 1284
            L+L+ +G+ I+  I  +++  GKI+W++ GY G    L +VETGD+ +  M DEF+GS++ YGF  V DPNTKL K ++I WQG GA + +K  S  H+  V+ L   IHV + AR+  DLD K+V++KV  +SGSNY+    KQ    ++       + +   A  ++ +R+ E+ +L   + E     K   P  ++                KP      G  ++GT+Y++I+P+ E  SL    K+    Q  + S      KA  E   + SK       D G Q+VGT+Y +I+P AEI  L R      +E P +   + Y + D   EI  L R         V   S YK+++P +E+  L + H  A++      S YK+++P  EI+  R ++E +  E  P  SSY++++P  EI
Sbjct:    4 LNLNRHGNEIRSAIADVAAQEGKINWVVFGYEGQTFDLKVVETGDDGISGMADEFNGSKVQYGFVRVKDPNTKLNKFVFITWQGEGALEKIKAMSSSHTNEVQRLCPAIHVRLEARNEDDLDEKDVLKKVGGSSGSNYAAGAVKQGAEYSEAAAMRDAEERRRRAEELRRQRQTEVQNLATQRREAP--MKPQKPAASVYQRVNPGAELARLAKEKPAGDEAVGQQRIGTSYKRIDPKAEIASLT-KDKTEDVPQRTVTSYKRIDPKAEIESLTKDSKAE-----DVGPQKVGTSYKRIDPKAEIASLTR----GHAEEPPQPVGSGYKRVDPRAEIANLTRGHAEEPPQPV--GSGYKRVDPRAEIANLTRGH--AEEPPQPVGSGYKRVDPRAEIE--RQQAETVREESEPQPSSYQRVDPRAEI 412          

HSP 2 Score: 69.3218 bits (168), Expect = 2.067e-8
Identity = 28/54 (51.85%), Postives = 37/54 (68.52%), Query Frame = 1
Query: 1990 TVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            T VA+Y Y +  DDE++  EGE I  V  IDEGWW G  + G++GMFP+NYV +
Sbjct:  516 TAVALYEYIAEDDDELTIAEGETITQVEMIDEGWWVGINQAGERGMFPANYVQL 569          

HSP 3 Score: 63.1586 bits (152), Expect = 1.634e-6
Identity = 40/136 (29.41%), Postives = 72/136 (52.94%), Query Frame = 1
Query:  889 YTKINPIAEIQKLKRQSVSNESESPIRSPSANYTKCDALDEITRLRRESVNNDDGSVFTTSTYKKINPVSELQELRKSHQIADKIETTSSSSYKKINPIEEIKNL-RAKSELISNEPTPVTSSYKKINPAEEIMSV 1293
            Y ++NP AE+ +L ++  + +     +    +Y + D   EI  L ++    +D    T ++YK+I+P +E++ L K  +  D       +SYK+I+P  EI +L R  +E     P PV S YK+++P  EI ++
Sbjct:  201 YQRVNPGAELARLAKEKPAGDEAVGQQRIGTSYKRIDPKAEIASLTKD--KTEDVPQRTVTSYKRIDPKAEIESLTKDSKAEDVGPQKVGTSYKRIDPKAEIASLTRGHAE---EPPQPVGSGYKRVDPRAEIANL 331          
BLAST of Drebrin-like protein vs. TrEMBL
Match: A0A1I8HZC2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026014g2 PE=4 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 1.570e-48
Identity = 140/433 (32.33%), Postives = 223/433 (51.50%), Query Frame = 1
Query:   64 DLDLSTNGSSIKECIGKLSS--GKISWMILGYSGNR-TLHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKPVV----KSQCNTANAIQEERRKELASLGNMKNEFSDNRKNNSPQVNI--------------SNKPVVFSKPGVTKVGTNYEKINPEKEFKSLNLHQKSTYETQARIQSENNTAEKAREERQKELSKLANRTYI-DEGFQQVGTNYTKINPIAEIQKLKRQSVSNESESPIRSPSANYTKCDALDEITRLRRESVNNDDGSVFTTSTYKKINPVSELQELRKSHQIADKIETTSSSSYKKINPIEEIKNL-RAKSELISNEPTPVTSSYKKINPAEEIMSV 1293
            +L+L+ +G+ I+  I  +++  GKI+W+I GY G    L +VETGD+ +  M DEF+GS++ YGF  V DPNTKL K ++I WQG GA + +K  S  H+  V+ L   IHV + AR+  DLD K+V++KV  +SGSNY+    KQ    ++       + +   A  ++ +R+ E+ +L   + E     K   P  ++                KP      G  ++GT+Y++I+P+ E  SL      T +    +     T+ K R + + E+  L   +   D G Q+VGT+Y +I+P AEI  L R      +E P +   + Y + D   EI  L R        +V   S YK+++P +E+  L + H  A++   T  S YK+++P  EI NL R  +E     P  V S YK+++P  EI ++
Sbjct:    3 NLNLNRHGNEIRSAIADVAAQEGKINWVIFGYEGQTYDLKVVETGDDGISGMADEFNGSKVQYGFVRVKDPNTKLNKFVFITWQGEGALEKIKAMSSSHTNEVQRLCPAIHVRLEARNEDDLDEKDVLKKVGGSSGSNYAAGAVKQGAEYSEAAAMRDAEERRRRAEELRRQRQTEVQNLATQRREAP--MKPQKPAASVYQRVNPGAELARLAKEKPAGDEAVGQQRIGTSYKRIDPKAEIASL------TKDKTEDVPQRTATSYK-RIDPKAEIESLTKDSKAEDVGPQKVGTSYKRIDPKAEIASLTR----GHAEEPPQPVGSGYKRVDPRAEIANLTRGHAEEPPQTV--GSGYKRVDPRAEIANLTRGH--AEEPPQTVGSGYKRVDPRAEIANLTRGHAE---EPPQTVGSGYKRVDPRAEIANL 415          

HSP 2 Score: 86.2705 bits (212), Expect = 1.457e-13
Identity = 83/291 (28.52%), Postives = 137/291 (47.08%), Query Frame = 1
Query:  673 GVTKVGTNYEKINPEKEFKSLNLHQK--------STYE-TQARIQSENNTAEKARE---------ERQKELSKLAN--RTYIDEGFQQVGTNYTKINPIAEIQKLKRQSVSNESESPIRSPSANYTKCDALDEITRLRRESVNNDDGSVFTTSTYKKINPVSELQELRKSHQIADKIETTSSSSYKKINPIEEIKNL-RAKSELISNEPTPVTSSYKKINPAEEIMSVRAKIPSISNSSETKASVLHN--RFEEKKPIQRQNS---RGEQKSARSTFQKLHKSIDDPHFDV 1467
            G  KVGT+Y++I+P+ E  SL             S Y+    R +  N T   A E         +R    +++AN  R + +E  Q VG+ Y +++P AEI  L R      +E P ++  + Y + D   EI  L R        +V   S YK+++P +E+  L + H  A++   T  S YK+++P  EI NL R  +E     P PV S YK+++P  EI ++     +  ++ E    V  N  R + +  I+RQ +   R E +   S++Q++     DP  ++
Sbjct:  283 GPQKVGTSYKRIDPKAEIASLTRGHAEEPPQPVGSGYKRVDPRAEIANLTRGHAEEPPQTVGSGYKRVDPRAEIANLTRGHAEEPPQTVGSGYKRVDPRAEIANLTR----GHAEEPPQTVGSGYKRVDPRAEIANLTRGHAEEPPQTV--GSGYKRVDPRAEIANLTRGH--AEEPPQTVGSGYKRVDPRAEIANLTRGHAE---EPPQPVGSGYKRVDPRAEIANL-----TRGHAQEPPQPVGTNYKRVDPRAEIERQQAETVREESEPQPSSYQRV-----DPRAEI 552          

HSP 3 Score: 69.707 bits (169), Expect = 1.850e-8
Identity = 28/54 (51.85%), Postives = 37/54 (68.52%), Query Frame = 1
Query: 1990 TVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            T VA+Y Y +  DDE++  EGE I  V  IDEGWW G  + G++GMFP+NYV +
Sbjct:  658 TAVALYEYIAEDDDELTIAEGETITQVEMIDEGWWVGINQAGERGMFPANYVQL 711          
BLAST of Drebrin-like protein vs. TrEMBL
Match: A0A267FKM7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017976g1 PE=4 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 2.807e-48
Identity = 136/431 (31.55%), Postives = 221/431 (51.28%), Query Frame = 1
Query:   67 LDLSTNGSSIKECIGKLSS--GKISWMILGYSGNR-TLHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKPVV----KSQCNTANAIQEERRKELASLGNMKNEFSDNRKNNSPQVNI--------------SNKPVVFSKPGVTKVGTNYEKINPEKEFKSLNLHQKSTYETQARIQSENNTAEKAREERQKELSKLANRTYI-DEGFQQVGTNYTKINPIAEIQKLKRQSVSNESESPIRSPSANYTKCDALDEITRLRRESVNNDDGSVFTTSTYKKINPVSELQELRKSHQIADKIETTSSSSYKKINPIEEIKNLRAKSELISNEPTPVTSSYKKINPAEEIMSV 1293
            L+L+ +G+ I+  I  +++  GKI+W+I GY G    L +VETGD+ +  M DEF+GS++ YGF  V DPNTKL K ++I WQG GA + +K  S  H+  V+ L   IH+ + AR+  DLD K+V++KV  +SGSNY+    KQ    ++       + +   A  ++ +R+ E+ +L   + E     K   P  ++                KP      G  ++GTNY++I+P+ E  SL      T +    +     T+ K R + + E+  L   +   D G Q+VGT+Y +I+P AEI  L R      +E P +   + Y + D   EI  L R        +V   S YK+++P +E+  L + H  A +      ++YK+++P  EI+  R ++E +  E  P  SSY++++P  EI   
Sbjct:    4 LNLNRHGNEIRSAIADVAAQEGKINWVIFGYEGQTFDLKVVETGDDGISGMADEFNGSKVQYGFVRVKDPNTKLNKFVFITWQGEGALEKVKAMSSSHTYEVQRLCPAIHMRLEARNEDDLDEKDVLKKVGGSSGSNYAAGAVKQGAEYSEAAAMRDAEERRRRAEELRRQRQTEVQNLATQRREAP--MKPQKPAASVYQRVNPGAELARLAKEKPAGDEAVGQQRIGTNYKRIDPKAEIASL------TKDKTEDVPQRTATSYK-RIDPKAEIESLTKDSKAEDVGPQKVGTSYKRIDPKAEIASLTR----GHAEEPPQPVGSGYKRVDPRAEIANLTRGHAEEPPQTV--GSGYKRVDPRAEIANLTRGH--AQEPPQPVGTNYKRVDPRAEIE--RQQAETVREESEPQPSSYQRVDPRAEIAGA 415          

HSP 2 Score: 69.3218 bits (168), Expect = 2.039e-8
Identity = 28/54 (51.85%), Postives = 37/54 (68.52%), Query Frame = 1
Query: 1990 TVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            T VA+Y Y +  DDE++  EGE I  V  IDEGWW G  + G++GMFP+NYV +
Sbjct:  518 TAVALYEYIAEDDDELTIAEGETITQVEMIDEGWWVGINQAGERGMFPANYVQL 571          
BLAST of Drebrin-like protein vs. TrEMBL
Match: A0A1I8GK84 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 4.552e-37
Identity = 108/360 (30.00%), Postives = 176/360 (48.89%), Query Frame = 1
Query:   67 LDLSTNGSSIKECIGKLSS--GKISWMILGYSGNR-TLHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKPVV----KSQCNTANAIQEERRKELASLGNMKNEFSDNRKNNSPQVNISNKPVVFSKPGVTKVGTNYEKINPEKEFKSLNLHQKSTYETQARIQSENNTAEKAREERQKELSKLANRTYIDEGFQQVGTNYTKINPIAEIQKLKRQSVSNESESPIRSPSANYTKCDALDEITRLRRESVNNDDGSVFTTSTYKKINPVSELQELRKSH 1125
            L+L+ +G+ I+  I  +++  GKI+W++ GY G    L +VETGD+ +  M DEF+GS++ YGF  V DPNTKL K ++I WQG GA + +K  S  H+  V+ L   IHV + AR+  DLD K+V++KV  +SGSNY+    KQ    ++       + +   A  ++ +R+ E+ +L   + E                 P+   KP  +     Y+++NP  E               AR+  E    ++A                   G Q++GT+Y +I+P AEI  L +    +  +  + S    Y + D   EI  L ++S   D G     ++YK+I+P +E+  L + H
Sbjct:    4 LNLNRHGNEIRSAIADVAAQEGKINWVVFGYEGQTFDLKVVETGDDGISGMADEFNGSKVQYGFVRVKDPNTKLNKFVFITWQGEGALEKIKAMSSSHTNEVQRLCPAIHVRLEARNEDDLDEKDVLKKVGGSSGSNYAAGAVKQGAEYSEAAAMRDAEERRRRAEELRRQRQTEVQNLATQRRE----------------APMKPQKPAASV----YQRVNPGAEL--------------ARLAKEKPAGDEAV------------------GQQRIGTSYKRIDPKAEIASLTKDKTEDVPQRTVTS----YKRIDPKAEIESLTKDSKAEDVGPQKVGTSYKRIDPKAEIASLTRGH 307          

HSP 2 Score: 66.2402 bits (160), Expect = 1.390e-7
Identity = 27/51 (52.94%), Postives = 35/51 (68.63%), Query Frame = 1
Query: 1990 TVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNY 2142
            T VA+Y Y +  DDE++  EGE I  V  IDEGWW G  + G++GMFP+NY
Sbjct:  426 TAVALYEYIAEDDDELTIAEGETITQVEMIDEGWWVGINQAGERGMFPANY 476          
BLAST of Drebrin-like protein vs. TrEMBL
Match: A0A1I8GWD9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 1.696e-29
Identity = 105/319 (32.92%), Postives = 159/319 (49.84%), Query Frame = 1
Query:  139 MILGYSGNR-TLHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKPVV----KSQCNTANAIQEERRKELASLGNMKNEFSDNRKNNSPQVNI--------------SNKPVVFSKPGVTKVGTNYEKINPEKEFKSLNLHQKSTYETQARIQSENNTAEKAREERQKELSKLANRTYI-DEGFQQVGTNYTKINPIAEIQKLKRQSVSNESESPIRSPSANYTKCDALDEITRLRRES 1035
            +I GY G    L +VETGD+ +  M DEF+GS++ YGF  V DPNTKL K ++I WQG GA + +K  S  H+  V+ L   IH+ + AR+  DLD K+V++KV  +SGSNY+    KQ    ++       + +   A  ++ +R+ E+ +L   + E     K   P  ++                KP      G  ++GTNY++I+P+ E  SL      T +    +     T+ K R + + E+  L   +   D G Q+VGT+Y +I+P AEI  L R   + E   P   P A      A +E TR + ES
Sbjct:  105 VIFGYEGQTFDLKVVETGDDGISGMADEFNGSKVQYGFVRVKDPNTKLNKFVFITWQGEGALEKVKAMSSSHTYEVQRLCPAIHMRLEARNEDDLDEKDVLKKVGGSSGSNYAAGAVKQGAEYSEAAAMRDAEERRRRAEELRRQRQTEVQNLATQRREAP--MKPQKPAASVYQRVNPGAELARLAKEKPAGDEAVGQQRIGTNYKRIDPKAEIASL------TKDKTEDVPQRTATSYK-RIDPKAEIESLTKDSKAEDVGPQKVGTSYKRIDPKAEIASLTRGH-AEEPPQPRVDPRAEI--AGAAEEDTRRQPES 411          

HSP 2 Score: 69.707 bits (169), Expect = 1.700e-8
Identity = 28/54 (51.85%), Postives = 37/54 (68.52%), Query Frame = 1
Query: 1990 TVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            T VA+Y Y +  DDE++  EGE I  V  IDEGWW G  + G++GMFP+NYV +
Sbjct:  503 TAVALYEYIAEDDDELTIAEGETITQVEMIDEGWWVGINQAGERGMFPANYVQL 556          
BLAST of Drebrin-like protein vs. Ensembl Cavefish
Match: dbnlb (drebrin like [Source:NCBI gene;Acc:103021432])

HSP 1 Score: 113.235 bits (282), Expect = 2.061e-26
Identity = 61/175 (34.86%), Postives = 96/175 (54.86%), Query Frame = 1
Query:   61 MDLDLSTNGSSI----KECIGKLSSGKISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKP--VVKSQCNTANAIQEERR 564
            M ++LS NG ++    KE + + S    +W +  Y GN   + + E GD  LE++ +E +  ++MY F  V DPN+ L K + I+W G G +   K     H +++ +  K  HVTI AR  +D++ + +MQKVA ASG+NYS H E  +  ++ P   V S     NA+ E +R
Sbjct:    1 MSVNLSKNGPALTAAYKEVVDEKSD--TNWALFTYEGNSNDIRLAEKGDGGLEELVEELNSGKVMYAFCRVQDPNSGLPKYVLINWTGEGVKDARKGLCANHVSSMANFLKGAHVTINARAEEDVEPESIMQKVAKASGANYSFHKESNRFKDSGPQGPVGSVYQKTNAMSEIKR 173          

HSP 2 Score: 69.707 bits (169), Expect = 4.003e-12
Identity = 30/67 (44.78%), Postives = 41/67 (61.19%), Query Frame = 1
Query: 1951 QQNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            QQN  ED  ++ +   A+Y Y +  D EISF+  + I  +  IDEGWW+G   DG  GMFP+NYV +
Sbjct:  348 QQNTYEDAGDRGVCARALYDYQAADDTEISFDPDDIITGIEMIDEGWWRGYAPDGHFGMFPANYVEL 414          
BLAST of Drebrin-like protein vs. Ensembl Cavefish
Match: dbnlb (drebrin like [Source:NCBI gene;Acc:103021432])

HSP 1 Score: 113.62 bits (283), Expect = 2.588e-26
Identity = 61/175 (34.86%), Postives = 96/175 (54.86%), Query Frame = 1
Query:   61 MDLDLSTNGSSI----KECIGKLSSGKISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKP--VVKSQCNTANAIQEERR 564
            M ++LS NG ++    KE + + S    +W +  Y GN   + + E GD  LE++ +E +  ++MY F  V DPN+ L K + I+W G G +   K     H +++ +  K  HVTI AR  +D++ + +MQKVA ASG+NYS H E  +  ++ P   V S     NA+ E +R
Sbjct:    1 MSVNLSKNGPALTAAYKEVVDEKSD--TNWALFTYEGNSNDIRLAEKGDGGLEELVEELNSGKVMYAFCRVQDPNSGLPKYVLINWTGEGVKDARKGLCANHVSSMANFLKGAHVTINARAEEDVEPESIMQKVAKASGANYSFHKESNRFKDSGPQGPVGSVYQKTNAMSEIKR 173          

HSP 2 Score: 69.3218 bits (168), Expect = 5.009e-12
Identity = 30/67 (44.78%), Postives = 41/67 (61.19%), Query Frame = 1
Query: 1951 QQNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            QQN  ED  ++ +   A+Y Y +  D EISF+  + I  +  IDEGWW+G   DG  GMFP+NYV +
Sbjct:  372 QQNTYEDAGDRGVCARALYDYQAADDTEISFDPDDIITGIEMIDEGWWRGYAPDGHFGMFPANYVEL 438          
BLAST of Drebrin-like protein vs. Ensembl Cavefish
Match: dbnlb (drebrin like [Source:NCBI gene;Acc:103021432])

HSP 1 Score: 113.62 bits (283), Expect = 2.733e-26
Identity = 61/175 (34.86%), Postives = 96/175 (54.86%), Query Frame = 1
Query:   61 MDLDLSTNGSSI----KECIGKLSSGKISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKP--VVKSQCNTANAIQEERR 564
            M ++LS NG ++    KE + + S    +W +  Y GN   + + E GD  LE++ +E +  ++MY F  V DPN+ L K + I+W G G +   K     H +++ +  K  HVTI AR  +D++ + +MQKVA ASG+NYS H E  +  ++ P   V S     NA+ E +R
Sbjct:    1 MSVNLSKNGPALTAAYKEVVDEKSD--TNWALFTYEGNSNDIRLAEKGDGGLEELVEELNSGKVMYAFCRVQDPNSGLPKYVLINWTGEGVKDARKGLCANHVSSMANFLKGAHVTINARAEEDVEPESIMQKVAKASGANYSFHKESNRFKDSGPQGPVGSVYQKTNAMSEIKR 173          

HSP 2 Score: 70.0922 bits (170), Expect = 3.032e-12
Identity = 30/67 (44.78%), Postives = 41/67 (61.19%), Query Frame = 1
Query: 1951 QQNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            QQN  ED  ++ +   A+Y Y +  D EISF+  + I  +  IDEGWW+G   DG  GMFP+NYV +
Sbjct:  379 QQNTYEDAGDRGVCARALYDYQAADDTEISFDPDDIITGIEMIDEGWWRGYAPDGHFGMFPANYVEL 445          
BLAST of Drebrin-like protein vs. Ensembl Cavefish
Match: dbnlb (drebrin like [Source:NCBI gene;Acc:103021432])

HSP 1 Score: 113.62 bits (283), Expect = 2.876e-26
Identity = 61/175 (34.86%), Postives = 96/175 (54.86%), Query Frame = 1
Query:   61 MDLDLSTNGSSI----KECIGKLSSGKISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKP--VVKSQCNTANAIQEERR 564
            M ++LS NG ++    KE + + S    +W +  Y GN   + + E GD  LE++ +E +  ++MY F  V DPN+ L K + I+W G G +   K     H +++ +  K  HVTI AR  +D++ + +MQKVA ASG+NYS H E  +  ++ P   V S     NA+ E +R
Sbjct:    1 MSVNLSKNGPALTAAYKEVVDEKSD--TNWALFTYEGNSNDIRLAEKGDGGLEELVEELNSGKVMYAFCRVQDPNSGLPKYVLINWTGEGVKDARKGLCANHVSSMANFLKGAHVTINARAEEDVEPESIMQKVAKASGANYSFHKESNRFKDSGPQGPVGSVYQKTNAMSEIKR 173          

HSP 2 Score: 70.0922 bits (170), Expect = 3.562e-12
Identity = 30/67 (44.78%), Postives = 41/67 (61.19%), Query Frame = 1
Query: 1951 QQNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            QQN  ED  ++ +   A+Y Y +  D EISF+  + I  +  IDEGWW+G   DG  GMFP+NYV +
Sbjct:  403 QQNTYEDAGDRGVCARALYDYQAADDTEISFDPDDIITGIEMIDEGWWRGYAPDGHFGMFPANYVEL 469          
BLAST of Drebrin-like protein vs. Ensembl Cavefish
Match: dbnlb (drebrin like [Source:NCBI gene;Acc:103021432])

HSP 1 Score: 113.235 bits (282), Expect = 3.180e-26
Identity = 61/175 (34.86%), Postives = 96/175 (54.86%), Query Frame = 1
Query:   61 MDLDLSTNGSSI----KECIGKLSSGKISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKP--VVKSQCNTANAIQEERR 564
            M ++LS NG ++    KE + + S    +W +  Y GN   + + E GD  LE++ +E +  ++MY F  V DPN+ L K + I+W G G +   K     H +++ +  K  HVTI AR  +D++ + +MQKVA ASG+NYS H E  +  ++ P   V S     NA+ E +R
Sbjct:    1 MSVNLSKNGPALTAAYKEVVDEKSD--TNWALFTYEGNSNDIRLAEKGDGGLEELVEELNSGKVMYAFCRVQDPNSGLPKYVLINWTGEGVKDARKGLCANHVSSMANFLKGAHVTINARAEEDVEPESIMQKVAKASGANYSFHKESNRFKDSGPQGPVGSVYQKTNAMSEIKR 173          

HSP 2 Score: 70.0922 bits (170), Expect = 3.425e-12
Identity = 30/67 (44.78%), Postives = 41/67 (61.19%), Query Frame = 1
Query: 1951 QQNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            QQN  ED  ++ +   A+Y Y +  D EISF+  + I  +  IDEGWW+G   DG  GMFP+NYV +
Sbjct:  381 QQNTYEDAGDRGVCARALYDYQAADDTEISFDPDDIITGIEMIDEGWWRGYAPDGHFGMFPANYVEL 447          
BLAST of Drebrin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004122.1 (pep scaffold:Pmarinus_7.0:GL479870:143934:164000:1 gene:ENSPMAG00000003763.1 transcript:ENSPMAT00000004122.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 6.838e-16
Identity = 34/106 (32.08%), Postives = 53/106 (50.00%), Query Frame = 1
Query:  196 SLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKP 513
             LE+M +E +  ++MY F  V D    L K + I+W G G     K     H  +V + FK  HVTI AR  +D++ + +M+KV  A+G  + +  E     +  P
Sbjct:    1 GLEEMVEELNSGKVMYAFCKVKDSKAGLCKYVLINWIGEGVSDGRKGTCANHVNSVANFFKGAHVTINARAEEDVEPEVIMEKVGKAAGVTFGLQQENSCFVDNAP 106          
BLAST of Drebrin-like protein vs. Ensembl Sea Lamprey
Match: DBNL (drebrin like [Source:HGNC Symbol;Acc:HGNC:2696])

HSP 1 Score: 71.633 bits (174), Expect = 1.362e-13
Identity = 27/51 (52.94%), Postives = 36/51 (70.59%), Query Frame = 1
Query: 1999 AVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            A+Y Y +  D EISF+ G+ I N+ QID+GWW G   DG +GMFP+NYV +
Sbjct:  304 ALYDYQAADDTEISFDPGDLISNIEQIDDGWWNGSGPDGSRGMFPANYVEL 354          

HSP 2 Score: 61.2326 bits (147), Expect = 2.958e-10
Identity = 30/76 (39.47%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  289 IYIHWQ-GSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKP 513
            I++  Q G G +   K     H +A+   FK  HVT+ AR  +D++  ++ +KVA ASGSNYS+H EK ++ + KP
Sbjct:    7 IFLGRQTGEGVKDSQKGICANHVSAIAAFFKGAHVTVNARSEEDVEPDQIREKVAKASGSNYSIHKEKPRVADNKP 82          
BLAST of Drebrin-like protein vs. Ensembl Sea Lamprey
Match: cttn (cortactin [Source:ZFIN;Acc:ZDB-GENE-040715-3])

HSP 1 Score: 63.929 bits (154), Expect = 7.484e-11
Identity = 28/54 (51.85%), Postives = 37/54 (68.52%), Query Frame = 1
Query: 1990 TVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            T VA+Y Y    DDEISFE  + I N+  +DEGWW+GE  +G  G+FP+NYV +
Sbjct:  506 TAVAIYDYQKAGDDEISFEPDDIITNIECLDEGWWRGEC-NGQVGIFPANYVEL 558          
BLAST of Drebrin-like protein vs. Ensembl Sea Lamprey
Match: nebl (nebulette [Source:ZFIN;Acc:ZDB-GENE-050320-151])

HSP 1 Score: 59.6918 bits (143), Expect = 3.903e-10
Identity = 29/70 (41.43%), Postives = 40/70 (57.14%), Query Frame = 1
Query: 1939 SPANQQNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGET-KDGDKGMFPSNYV 2145
            + ++QQ P       +    AVY Y +  DDE+SF +G+ I NV QIDEGW  G   + G  GM P+NY+
Sbjct:  180 AASSQQRPVSQTPRATRPYRAVYDYAAADDDEVSFLDGDVIENVKQIDEGWMYGTVQRTGQTGMLPANYL 249          
BLAST of Drebrin-like protein vs. Ensembl Sea Lamprey
Match: ABI1 (abl interactor 1 [Source:HGNC Symbol;Acc:HGNC:11320])

HSP 1 Score: 59.6918 bits (143), Expect = 1.271e-9
Identity = 28/51 (54.90%), Postives = 36/51 (70.59%), Query Frame = 1
Query: 1993 VVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYV 2145
            VVAVY Y   +DDE+SF EG  IY V + D+GW++G T +G  G+FP NYV
Sbjct:  397 VVAVYDYVQDKDDELSFHEGSIIYVVRKNDDGWYEGAT-NGHTGLFPGNYV 446          
BLAST of Drebrin-like protein vs. Ensembl Yeast
Match: ABP1 (Actin-binding protein of the cortical actin cytoskeleton; important for activation of the Arp2/3 complex that plays a key role actin in cytoskeleton organization; inhibits barbed-end actin filament elongation; phosphorylation within its Proline-Rich Regio, mediated by Cdc28p and Pho85p, protects Abp1p from proteolysis mediated by its own PEST sequences; mammalian homolog of HIP-55 (hematopoietic progenitor kinase 1 [HPK1]-interacting protein of 55 kDa) [Source:SGD;Acc:S000000684])

HSP 1 Score: 68.9366 bits (167), Expect = 1.192e-12
Identity = 43/148 (29.05%), Postives = 73/148 (49.32%), Query Frame = 1
Query:  133 SWMILGYSGNRTLHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHW-QGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVH-NEKQQIYETKPVVKSQCNTANAIQEERRKE 570
            +W+I+  +  +      TG +S  D    F  +++ YG A V  P + ++K I I W   S   +   + +   +    +LFK  HV +TARD  DLD  E++ K++ A+G+ YS+  + KQQ   + P VK     + +     +KE
Sbjct:   31 TWLIISPNAKKEYEPESTG-SSFHDFLQLFDETKVQYGLARVSPPGSDVEKIIIIGWCPDSAPLKTRASFAANFAAVANNLFKGYHVQVTARDEDDLDENELLMKISNAAGARYSIQTSSKQQGKASTPPVKKSFTPSKSPAPVSKKE 177          

HSP 2 Score: 61.2326 bits (147), Expect = 3.416e-10
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 1
Query: 1993 VVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGET-KDGDKGMFPSNYVMI 2151
              A Y Y + +D+E++F E + I N+  +D+ WW GE  KDG KG+FPSNYV +
Sbjct:  537 ATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYVSL 590          
BLAST of Drebrin-like protein vs. Ensembl Yeast
Match: BZZ1 (SH3 domain protein implicated in regulating actin polymerization; able to recruit actin polymerization machinery through its SH3 domains; colocalizes with cortical actin patches and Las17p; interacts with type I myosins [Source:SGD;Acc:S000001156])

HSP 1 Score: 52.373 bits (124), Expect = 1.849e-7
Identity = 42/139 (30.22%), Postives = 69/139 (49.64%), Query Frame = 1
Query: 1738 KAVFEYECQDSDEIDFXXXXXXXXXXXXXXXXXXXCN--KSGKRGMFPSNYVELITTNDEPIDINDENYSPANQQNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQID-EGWWQGETKDGDKGMFPSNYV 2145
            K ++ Y  +D DEI    G+ I+ +       W   N   +G+ G+ P+ Y+ +  ++   +  ND    PA +  P   +     T+ A+Y+Y +  DDEIS + G+ I  +   D  GW  GE  DG KG+FP++Y 
Sbjct:  499 KVLYAYVQKDDDEITITPGDKISLVARDTGSGWTKINNDTTGETGLVPTTYIRI--SSAATVKANDR--GPAPEVPPPRRSTLPVRTMEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGEC-DGLKGLFPTSYC 632          
BLAST of Drebrin-like protein vs. Ensembl Nematostella
Match: EDO31290 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYD1])

HSP 1 Score: 78.5666 bits (192), Expect = 2.742e-16
Identity = 46/130 (35.38%), Postives = 66/130 (50.77%), Query Frame = 1
Query:  193 NSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYE-TKPV--VKSQCNTANAIQEERRKEL 573
              LE++ DE +  +++Y    VIDPNT L K ++I+W   G     K     H   V   F   HVTI AR+  D++   +++KV  ASG+ YSVH EK +  E   PV  V  + N    I  ++R E 
Sbjct:    2 GGLEELADEMNDGKLLYAGIKVIDPNTSLPKIVFINWVREGVPSSRKGLCANHVMPVEKFFSGAHVTINARNEDDIEESFILEKVKKASGAAYSVHKEKAKPAEPILPVGSVYKRANIGKDINVKKRDEF 131          

HSP 2 Score: 67.0106 bits (162), Expect = 2.489e-12
Identity = 31/64 (48.44%), Postives = 40/64 (62.50%), Query Frame = 1
Query: 1960 PDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            P ED     +T  A+Y Y    D+EI+F+  + I N+ QIDEGWW+G   DG  GMFP+NYV I
Sbjct:  183 PAEDT---GVTATALYDYQQADDNEITFDPDDIITNIEQIDEGWWRGTGPDGRHGMFPANYVEI 243          
BLAST of Drebrin-like protein vs. Ensembl Nematostella
Match: EDO38147 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDP5])

HSP 1 Score: 59.6918 bits (143), Expect = 3.570e-11
Identity = 24/51 (47.06%), Postives = 37/51 (72.55%), Query Frame = 1
Query: 1993 VVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYV 2145
            V+A+Y Y++ +DDE++F E   IY + + D+GW++G T DG  G+FP NYV
Sbjct:   47 VIALYDYNATRDDELTFAENTIIYVIKKNDDGWYEGVTTDGLTGLFPGNYV 97          
BLAST of Drebrin-like protein vs. Ensembl Nematostella
Match: EDO38710 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC74])

HSP 1 Score: 59.6918 bits (143), Expect = 4.238e-10
Identity = 46/136 (33.82%), Postives = 74/136 (54.41%), Query Frame = 1
Query: 1747 FEYECQDSDEIDFXXXXXXXXXXXXXXXXXXXCNKSGKRGMFPSNYVELITTNDEPI-DINDENYSPANQQNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            FEYE  + DE+  ++ +II DI + D GW    + +GK+G+FP N+V+ I  N E        +Y          D++      V ++ Y +   DE+S   G  I  + ++++GWW+G T DG KG+FPSN+V +
Sbjct:    1 FEYEAAEPDELSLQIDDIIEDIVDEDVGWAR-GDLNGKKGLFPVNFVDFIENNAELAKSAGKASYKRKLLSFSSTDSIAGRKACV-LFDYEAENADELSLVTGIEINVIREVEDGWWEG-TVDGRKGVFPSNFVKL 133          

HSP 2 Score: 51.9878 bits (123), Expect = 1.813e-7
Identity = 56/177 (31.64%), Postives = 85/177 (48.02%), Query Frame = 1
Query: 1636 DFKEKNN--ASQNNKIDTKSVHLENQDTKTPKTKSAKAVFEYECQDSDEIDFXXXXXXXXXXXXXXXXXXXCNKSGKRGMFPSNYVELITTNDEPIDINDENYSPANQQNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQ--IDE-GWWQGETKDGDKGMFPSNYVMI 2151
            DF E N   A    K   K   L    T +   + A  +F+YE +++DE+    G  I  I E+++GWW      G++G+FPSN+V+L   ++ P     +      +Q P E+ V   L     Y Y    +DE+  + G+ I  V +   D  GW +GE  DG  G+FP N+V I
Sbjct:   47 DFIENNAELAKSAGKASYKRKLLSFSSTDSIAGRKACVLFDYEAENADELSLVTGIEINVIREVEDGWWE-GTVDGRKGVFPSNFVKLKPIDETPTKTKRQ----PEKQPPAEEPV---LRAKVTYDYEQQNEDELELKVGDIITIVKKEVFDTPGWMEGEL-DGKTGLFPDNFVEI 214          
BLAST of Drebrin-like protein vs. Ensembl Nematostella
Match: LASP3 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI32])

HSP 1 Score: 56.225 bits (134), Expect = 7.387e-9
Identity = 33/99 (33.33%), Postives = 49/99 (49.49%), Query Frame = 1
Query: 1861 RGMFPSNYVELITTNDEPIDINDEN-YSPANQQNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETK-DGDKGMFPSNYVMI 2151
            +G+  +   EL  ++  P D      Y PA  Q   + +   S   + +Y Y++  DDE+S  EG+ I +   IDEGW  G  K  G  GM P+NYV +
Sbjct:  129 QGLAATVQEELSKSHQRPCDDQPAAPYQPAPLQQVPQPSSSNSAQYLVMYDYNAADDDEVSMVEGDIIVDAEIIDEGWMVGRVKRTGQSGMLPANYVQL 227          
BLAST of Drebrin-like protein vs. Ensembl Nematostella
Match: EDO50032 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF47])

HSP 1 Score: 58.151 bits (139), Expect = 8.753e-9
Identity = 27/74 (36.49%), Postives = 45/74 (60.81%), Query Frame = 1
Query: 1933 NYSPANQQNP---DEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYV 2145
             Y    +  P   DE +    ++ VA+Y Y +  +DEI+F+  + I ++ +ID+GWW G T +G +G+FP+NYV
Sbjct:  458 QYQTGTKHTPISEDEASGATGVSAVALYDYQAAGEDEITFDPDDIITDIEKIDDGWWMG-TCNGQRGLFPANYV 530          
BLAST of Drebrin-like protein vs. Ensembl Medaka
Match: dbnlb (drebrin like [Source:NCBI gene;Acc:101155522])

HSP 1 Score: 105.916 bits (263), Expect = 4.630e-24
Identity = 53/147 (36.05%), Postives = 83/147 (56.46%), Query Frame = 1
Query:   61 MDLDLSTNGSSI----KECIGKLSSGKISWMILGYSGNRT-LHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNE 486
            M ++LS NG ++    KE + + S+   +W +  Y GN   + + E GD  LE++ +E +  ++MY F  V DPN+ L K + I+W G G     K     H  ++ +  K  HVTI AR  +D++ + +MQKVA ASG+NY+ H E
Sbjct:    1 MSVNLSKNGPALTAAYKEVVDEKSN--TNWALFTYEGNSNDIRLAEKGDGGLEELVEELNSGKVMYAFCRVQDPNSGLPKYVLINWTGEGVNDARKGMCANHVLSMANFLKGAHVTINARAEEDVEPEAIMQKVAKASGANYNFHKE 145          

HSP 2 Score: 68.9366 bits (167), Expect = 6.365e-12
Identity = 30/71 (42.25%), Postives = 43/71 (60.56%), Query Frame = 1
Query: 1939 SPANQQNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            SP++  N   D+ ++ +   A+Y Y +  D EISF+  E I  +  IDEGWW+G   DG  GMFP+NYV +
Sbjct:  319 SPSDSCNVTADSSDRGICARALYDYQAADDTEISFDPDEIITAIEMIDEGWWRGFGPDGHFGMFPANYVEL 389          
BLAST of Drebrin-like protein vs. Ensembl Medaka
Match: si:dkey-40c11.2 (drebrin-like protein A [Source:NCBI gene;Acc:101166140])

HSP 1 Score: 74.7146 bits (182), Expect = 2.169e-13
Identity = 30/64 (46.88%), Postives = 46/64 (71.88%), Query Frame = 1
Query: 1954 QNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYV 2145
            +N  ED+VE+ + V A+Y Y +  + EISFE G+ I +V  +D+ WW+G +KDG +G+FP+NYV
Sbjct:  684 ENGQEDSVEQHMCVRALYDYQAEDETEISFEPGDIIRDVETVDKAWWRGWSKDGRQGLFPANYV 747          

HSP 2 Score: 50.0618 bits (118), Expect = 9.754e-6
Identity = 32/146 (21.92%), Postives = 64/146 (43.84%), Query Frame = 1
Query:  136 WMILGYSG-NRTLHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEV---MQKVAAASGSNYSVHNEKQQIYETKPVVKSQCNTANAIQEER 561
            W +  Y G    L + ++G   + ++ ++FH S+  YG  ++    +   +   I W G       +T+   H  A+++ FK  H  I+A    D+  ++V   + K  A + S ++  + +    E + +V +     NA  E R
Sbjct:   31 WALFAYEGATNKLKLADSGVGGVTELAEKFHISKPQYGLVNIGQTESGAAQIAMICWMGQKVDDYWRTECASHIPAIKNFFKEAHAFISAEKADDVTEEKVQAELSKAQAQTPSQWARRSSRST--EKEDIVGTNYRKTNAAMEMR 174          
BLAST of Drebrin-like protein vs. Ensembl Medaka
Match: cttn (cortactin [Source:NCBI gene;Acc:101157843])

HSP 1 Score: 61.6178 bits (148), Expect = 1.555e-9
Identity = 27/56 (48.21%), Postives = 38/56 (67.86%), Query Frame = 1
Query: 1984 SLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
             +T VA+Y Y +  DDEISF+  + I N+  IDEGWW+G  + G  G+FP+NYV +
Sbjct:  441 GVTAVALYDYQAAGDDEISFDPDDIITNIEMIDEGWWRGVCR-GAYGLFPANYVEV 495          
BLAST of Drebrin-like protein vs. Ensembl Medaka
Match: lasp1 (LIM and SH3 protein 1 [Source:NCBI gene;Acc:101156576])

HSP 1 Score: 57.7658 bits (138), Expect = 7.021e-9
Identity = 26/50 (52.00%), Postives = 34/50 (68.00%), Query Frame = 1
Query: 1999 AVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGET-KDGDKGMFPSNYV 2145
            AVY Y +  DDE+SF +G+ I +V QIDEGW  G   + G +GM P+NYV
Sbjct:  182 AVYDYSAADDDEVSFMDGDVIEDVQQIDEGWMYGRVQRTGQQGMLPANYV 231          
BLAST of Drebrin-like protein vs. Ensembl Medaka
Match: ENSORLT00000037489.1 (pep primary_assembly:ASM223467v1:21:4274531:4280546:-1 gene:ENSORLG00000029464.1 transcript:ENSORLT00000037489.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 1.506e-8
Identity = 26/53 (49.06%), Postives = 34/53 (64.15%), Query Frame = 1
Query: 1990 TVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGET-KDGDKGMFPSNYV 2145
            TV A+Y Y +   DE+SF++G+ I NV  IDEGW  G   + G  GM P+NYV
Sbjct:  226 TVRAMYDYTAADSDEVSFKDGDVIVNVQSIDEGWMYGTVQRTGKTGMLPANYV 278          
BLAST of Drebrin-like protein vs. Planmine SMEST
Match: SMESG000073128.1 (SMESG000073128.1)

HSP 1 Score: 1325.46 bits (3429), Expect = 0.000e+0
Identity = 692/698 (99.14%), Postives = 695/698 (99.57%), Query Frame = 1
Query:   61 MDLDLSTNGSSIKECIGKLSSGKISWMILGYSGNRTLHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKPVVKSQCNTANAIQEERRKELASLGNMKNEFSDNRKNNSPQVNISNKPVVFSKPGVTKVGTNYEKINPEKEFKSLNLHQKSTYETQARIQSENNTAEKAREERQKELSKLANRTYIDEGFQQVGTNYTKINPIAEIQKLKRQSVSNESESPIRSPSANYTKCDALDEITRLRRESVNNDDGSVFTTSTYKKINPVSELQELRKSHQIADKIETTSSSSYKKINPIEEIKNLRAKSELISNEPTPVTSSYKKINPAEEIMSVRAKIPSISNSSETKASVLHNRFEEKKPIQRQNSRGEQKSARSTFQKLHKSIDDPHFDVGHHSPPSNPSVLXXXXXXXXXXXXIGNFSEKNISGSNNKVTLLXXXXXXXXXXXXXDFKEKNNASQNNKIDTKSVHLENQDTKTPKTKSAKAVFEYECQDSDEIDFXXXXXXXXXXXXXXXXXXXCNKSGKRGMFPSNYVELITTNDEPIDINDENYSPANQQNPDEDNVEKSLTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMIP 2154
            MDLDLSTNGSSIKECIGKLSSGKISWMILGYSGNRTLHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKPVVKSQCNTANAIQEERRKELASLGNMK EFSDNRKNNSPQVNISNKPVVFSKPGVTKVGTNYEKINPEKEFKSLNLHQKSTYETQARIQSENNTAEKAREERQKELSKLANRTYIDEGFQQVGTNYTKINPIAEIQKLKRQSVSNESESPIRSPSANYTKCDALDEITRLRRESVNNDDGSVFTTSTYKKINPVSELQELRKSHQIADKIETTSSSSYKKINP+EEIKNLRAKSELISNEPTPVTSSYKKINPAEEIMSVRAKIPSISNSSETKASVLHNRFEEKKPIQRQNSRGEQKSARSTFQKLHKSIDDPHFDVGHHSPPSNPSVLKEEKFENKKHEEIGNFSEKNISGSNNKVTLLKEEKIENKN+ETKDFKEKNNASQNNKIDTKSVHLENQDTKTPKTKSAKAVFEYECQDSDEIDFEVGEIITDIEEIDEGWWIGCNKSGKRGMFPSNYVELI TNDEPIDINDENYSPANQQNPDEDN EKSLTVVAVYSYH+LQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMIP
Sbjct:    1 MDLDLSTNGSSIKECIGKLSSGKISWMILGYSGNRTLHIVETGDNSLEDMFDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTAVRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETKPVVKSQCNTANAIQEERRKELASLGNMKKEFSDNRKNNSPQVNISNKPVVFSKPGVTKVGTNYEKINPEKEFKSLNLHQKSTYETQARIQSENNTAEKAREERQKELSKLANRTYIDEGFQQVGTNYTKINPIAEIQKLKRQSVSNESESPIRSPSANYTKCDALDEITRLRRESVNNDDGSVFTTSTYKKINPVSELQELRKSHQIADKIETTSSSSYKKINPVEEIKNLRAKSELISNEPTPVTSSYKKINPAEEIMSVRAKIPSISNSSETKASVLHNRFEEKKPIQRQNSRGEQKSARSTFQKLHKSIDDPHFDVGHHSPPSNPSVLKEEKFENKKHEEIGNFSEKNISGSNNKVTLLKEEKIENKNDETKDFKEKNNASQNNKIDTKSVHLENQDTKTPKTKSAKAVFEYECQDSDEIDFEVGEIITDIEEIDEGWWIGCNKSGKRGMFPSNYVELIATNDEPIDINDENYSPANQQNPDEDNAEKSLTVVAVYSYHALQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMIP 698          
BLAST of Drebrin-like protein vs. Planmine SMEST
Match: SMESG000001129.1 (SMESG000001129.1)

HSP 1 Score: 62.3882 bits (150), Expect = 3.845e-10
Identity = 45/128 (35.16%), Postives = 65/128 (50.78%), Query Frame = 1
Query: 1855 GKRGMFPSNYVELITTNDEPIDINDENYSPANQQNPD-EDNV-------------------EKS---------LTVVAVYSYHSLQDDEISFEEGE--HIYNVNQIDEGWWQGETKDGDKGMFPSNYV 2145
            GK G+FP N+V++I T+ +    N  N    N  NP+ EDN+                   EKS         L V A++SY +   DEI+ E G+   + N N ID+GWW+G  + G+ G+FPSN+V
Sbjct:   42 GKEGVFPDNFVKVIKTDFK----NTSN--KENGTNPNVEDNLNTKTKLKTHSSDQKTKTTKEKSHINNSLNEPLIVEAIFSYKAENPDEITIEVGDIIKVLNKNLIDDGWWKGIKRTGEIGIFPSNFV 163          
BLAST of Drebrin-like protein vs. Planmine SMEST
Match: SMESG000055438.1 (SMESG000055438.1)

HSP 1 Score: 60.077 bits (144), Expect = 4.445e-9
Identity = 25/51 (49.02%), Postives = 36/51 (70.59%), Query Frame = 1
Query: 1993 VVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYV 2145
            V+ +Y Y   +DDE+SF+EGE IY V + ++GWW+G   +G  G+FP NYV
Sbjct:  453 VITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEG-VMNGRTGLFPGNYV 502          
BLAST of Drebrin-like protein vs. Planmine SMEST
Match: SMESG000038704.1 (SMESG000038704.1)

HSP 1 Score: 58.5362 bits (140), Expect = 4.938e-9
Identity = 36/113 (31.86%), Postives = 58/113 (51.33%), Query Frame = 1
Query: 1873 PSNYVELITTNDEPIDINDEN---------------YSPANQQNPDEDNVEKS-----LTVVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 2151
            P   VE +T + E ++IN+ N                    + +  E+NV ++     +  VA++ +   ++DEI+F  GE I N+ +ID  WW GE  +G +GMFPSNYV +
Sbjct:  158 PEAQVEHVTRDVEQLEINEPNRNDDSNEHEQQHIPIVEKEEKHHDKEENVVQAVGNEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGEL-NGRRGMFPSNYVQV 269          
BLAST of Drebrin-like protein vs. Planmine SMEST
Match: SMESG000055438.1 (SMESG000055438.1)

HSP 1 Score: 56.225 bits (134), Expect = 6.295e-8
Identity = 24/51 (47.06%), Postives = 35/51 (68.63%), Query Frame = 1
Query: 1993 VVAVYSYHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYV 2145
            V+ ++ Y   +DDE+SF+EGE IY V +  +GWW+G   +G  G+FP NYV
Sbjct:  453 VITLHKYEQNKDDELSFQEGELIYVVKKNIDGWWEG-VMNGRTGLFPGNYV 502          
The following BLAST results are available for this feature:
BLAST of Drebrin-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DBNL1.234e-2534.68drebrin like [Source:HGNC Symbol;Acc:HGNC:2696][more]
DBNL1.374e-2534.68drebrin like [Source:HGNC Symbol;Acc:HGNC:2696][more]
DBNL1.407e-2534.68drebrin like [Source:HGNC Symbol;Acc:HGNC:2696][more]
DBNL2.546e-1832.37drebrin like [Source:HGNC Symbol;Acc:HGNC:2696][more]
DBNL7.547e-1331.19drebrin like [Source:HGNC Symbol;Acc:HGNC:2696][more]
back to top
BLAST of Drebrin-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dbn-11.413e-1126.42DreBriN 1/DreBriN-like (Where Drebrin is from Deve... [more]
cdap-23.115e-845.28CD2AP homolog [Source:UniProtKB/TrEMBL;Acc:Q6A573... [more]
nck-15.970e-739.22NCK (Non-Catalytic region of tyrosine Kinase) adap... [more]
nck-15.970e-739.22NCK (Non-Catalytic region of tyrosine Kinase) adap... [more]
nck-15.970e-739.22NCK (Non-Catalytic region of tyrosine Kinase) adap... [more]
back to top
BLAST of Drebrin-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abp13.805e-1734.11gene:FBgn0036372 transcript:FBtr0075819[more]
Abi4.275e-949.02gene:FBgn0020510 transcript:FBtr0307076[more]
Abi4.275e-949.02gene:FBgn0020510 transcript:FBtr0337096[more]
Abi4.284e-949.02gene:FBgn0020510 transcript:FBtr0337097[more]
Abi4.284e-949.02gene:FBgn0020510 transcript:FBtr0082910[more]
back to top
BLAST of Drebrin-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dbnlb1.790e-2736.05drebrin-like b [Source:ZFIN;Acc:ZDB-GENE-050522-29... [more]
dbnlb1.817e-2736.05drebrin-like b [Source:ZFIN;Acc:ZDB-GENE-050522-29... [more]
dbnla7.617e-2734.21drebrin-like a [Source:ZFIN;Acc:ZDB-GENE-040704-42... [more]
si:dkey-40c11.26.688e-1248.21si:dkey-40c11.2 [Source:ZFIN;Acc:ZDB-GENE-060526-3... [more]
si:dkey-40c11.21.461e-1146.67si:dkey-40c11.2 [Source:ZFIN;Acc:ZDB-GENE-060526-3... [more]
back to top
BLAST of Drebrin-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ap2s11.738e-2333.14adaptor related protein complex 2 subunit sigma 1 ... [more]
ap2s13.225e-2334.48adaptor related protein complex 2 subunit sigma 1 ... [more]
ap2s13.645e-2333.14adaptor related protein complex 2 subunit sigma 1 ... [more]
ap2s13.649e-2333.14adaptor related protein complex 2 subunit sigma 1 ... [more]
ap2s15.096e-2333.14adaptor related protein complex 2 subunit sigma 1 ... [more]
back to top
BLAST of Drebrin-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dbnl2.084e-2034.68drebrin-like [Source:MGI Symbol;Acc:MGI:700006][more]
Dbnl2.164e-2034.68drebrin-like [Source:MGI Symbol;Acc:MGI:700006][more]
Dbnl2.183e-2034.68drebrin-like [Source:MGI Symbol;Acc:MGI:700006][more]
Itsn12.023e-1035.35intersectin 1 (SH3 domain protein 1A) [Source:MGI ... [more]
Itsn12.095e-1035.35intersectin 1 (SH3 domain protein 1A) [Source:MGI ... [more]
back to top
BLAST of Drebrin-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6H7G2|DBNL_BOVIN1.149e-2535.84Drebrin-like protein OS=Bos taurus OX=9913 GN=DBNL... [more]
sp|Q9UJU6|DBNL_HUMAN6.597e-2534.68Drebrin-like protein OS=Homo sapiens OX=9606 GN=DB... [more]
sp|Q7ZXQ9|DBNLA_XENLA1.647e-2333.14Drebrin-like protein A OS=Xenopus laevis OX=8355 G... [more]
sp|Q6GM14|DBNLB_XENLA2.897e-2333.72Drebrin-like protein B OS=Xenopus laevis OX=8355 G... [more]
sp|Q62418|DBNL_MOUSE1.458e-1934.68Drebrin-like protein OS=Mus musculus OX=10090 GN=D... [more]
back to top
BLAST of Drebrin-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EQZ36.565e-4932.32Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HZC21.570e-4832.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FKM72.807e-4831.55Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GK844.552e-3730.00Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GWD91.696e-2932.92Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Drebrin-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dbnlb2.061e-2634.86drebrin like [Source:NCBI gene;Acc:103021432][more]
dbnlb2.588e-2634.86drebrin like [Source:NCBI gene;Acc:103021432][more]
dbnlb2.733e-2634.86drebrin like [Source:NCBI gene;Acc:103021432][more]
dbnlb2.876e-2634.86drebrin like [Source:NCBI gene;Acc:103021432][more]
dbnlb3.180e-2634.86drebrin like [Source:NCBI gene;Acc:103021432][more]
back to top
BLAST of Drebrin-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004122.16.838e-1632.08pep scaffold:Pmarinus_7.0:GL479870:143934:164000:1... [more]
DBNL1.362e-1352.94drebrin like [Source:HGNC Symbol;Acc:HGNC:2696][more]
cttn7.484e-1151.85cortactin [Source:ZFIN;Acc:ZDB-GENE-040715-3][more]
nebl3.903e-1041.43nebulette [Source:ZFIN;Acc:ZDB-GENE-050320-151][more]
ABI11.271e-954.90abl interactor 1 [Source:HGNC Symbol;Acc:HGNC:1132... [more]
back to top
BLAST of Drebrin-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ABP11.192e-1229.05Actin-binding protein of the cortical actin cytosk... [more]
BZZ11.849e-730.22SH3 domain protein implicated in regulating actin ... [more]
back to top
BLAST of Drebrin-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO312902.742e-1635.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381473.570e-1147.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387104.238e-1033.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
LASP37.387e-933.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500328.753e-936.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Drebrin-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dbnlb4.630e-2436.05drebrin like [Source:NCBI gene;Acc:101155522][more]
si:dkey-40c11.22.169e-1346.88drebrin-like protein A [Source:NCBI gene;Acc:10116... [more]
cttn1.555e-948.21cortactin [Source:NCBI gene;Acc:101157843][more]
lasp17.021e-952.00LIM and SH3 protein 1 [Source:NCBI gene;Acc:101156... [more]
ENSORLT00000037489.11.506e-849.06pep primary_assembly:ASM223467v1:21:4274531:428054... [more]
back to top
BLAST of Drebrin-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073128.10.000e+099.14SMESG000073128.1[more]
SMESG000001129.13.845e-1035.16SMESG000001129.1[more]
SMESG000055438.14.445e-949.02SMESG000055438.1[more]
SMESG000038704.14.938e-931.86SMESG000038704.1[more]
SMESG000055438.16.295e-847.06SMESG000055438.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003885 ID=SMED30003885|Name=Drebrin-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2193bp
AATTGAATATAATTTTCGTTTTTGTGAATTCTTTAAGTTTAATTCTTGAT
AATATTAAAAATGGACCTAGATCTATCAACAAATGGTTCATCAATTAAAG
AATGTATTGGAAAATTGAGTTCAGGAAAAATATCATGGATGATATTAGGA
TATTCTGGTAATCGTACGCTACACATCGTAGAGACTGGAGATAATTCATT
GGAGGATATGTTCGATGAATTTCATGGAAGTGAGATAATGTACGGATTTG
CATCCGTTATCGATCCAAATACAAAATTAAAAAAAAATATTTATATACAT
TGGCAAGGATCTGGTGCACAACAAGTAATGAAAACAAAATCTGTACAGCA
TTCTACTGCCGTTAGAGATTTATTCAAGCCAATTCACGTTACTATCACTG
CTCGAGATCCTCAAGATCTTGATCTTAAAGAAGTAATGCAGAAAGTAGCT
GCGGCTTCGGGATCAAATTATAGTGTTCATAACGAAAAGCAACAAATATA
TGAGACAAAGCCAGTTGTAAAGAGCCAATGCAACACAGCCAATGCTATCC
AGGAGGAACGTAGAAAAGAACTTGCTTCGTTAGGTAATATGAAAAACGAG
TTTTCTGATAATCGAAAGAATAATTCACCTCAAGTTAATATTTCCAATAA
ACCTGTCGTATTCAGTAAACCCGGTGTTACGAAAGTTGGAACGAATTATG
AAAAAATAAATCCAGAAAAAGAATTCAAATCACTGAATTTACATCAAAAA
TCGACGTACGAAACACAAGCTAGGATTCAAAGTGAAAATAATACTGCAGA
AAAAGCTAGGGAAGAACGGCAGAAGGAATTATCAAAGTTAGCCAATCGAA
CTTATATTGACGAAGGGTTTCAACAAGTGGGAACAAATTATACTAAAATT
AATCCAATAGCAGAAATTCAGAAATTGAAAAGACAAAGTGTAAGCAATGA
ATCAGAAAGTCCTATTAGATCCCCTAGTGCTAATTATACAAAATGTGATG
CATTAGATGAAATCACCAGATTAAGAAGAGAAAGTGTGAATAATGATGAC
GGTTCTGTATTTACAACTTCAACGTATAAAAAAATTAATCCCGTCTCGGA
ATTGCAAGAGTTGCGGAAATCTCATCAAATTGCCGACAAAATTGAAACGA
CTTCATCAAGTTCGTACAAAAAAATAAATCCTATCGAAGAAATTAAAAAT
TTGAGAGCTAAAAGTGAATTAATTTCCAATGAACCGACTCCAGTCACCAG
TAGTTATAAGAAAATAAACCCGGCTGAAGAGATTATGTCGGTTAGAGCAA
AAATCCCTAGTATTTCTAATAGTTCTGAGACAAAAGCTTCTGTTTTACAT
AACAGATTTGAAGAAAAAAAACCCATTCAGCGACAAAACTCTAGGGGTGA
GCAAAAATCTGCTAGAAGCACATTTCAAAAACTACATAAATCGATAGATG
ACCCTCATTTTGATGTTGGACACCATTCACCTCCATCTAATCCTTCGGTA
TTAAAAGAGGAAAAATTCGAAAATAAAAAACACGAAGAAATTGGAAATTT
CAGCGAAAAAAATATTAGCGGATCCAATAATAAGGTGACATTGCTAAAGG
AAGAAAAAATTGAAAATAAAAATAATGAAACAAAAGATTTTAAAGAAAAA
AATAACGCTTCACAAAATAATAAAATCGACACAAAATCAGTTCATTTAGA
AAATCAAGATACAAAAACGCCAAAAACTAAAAGTGCTAAAGCTGTTTTTG
AATATGAATGCCAAGATTCTGATGAAATTGATTTTGAAGTTGGAGAAATT
ATTACCGATATTGAAGAAATTGATGAAGGCTGGTGGATTGGATGTAATAA
ATCAGGCAAAAGAGGAATGTTTCCTTCAAATTACGTGGAACTAATAACGA
CCAATGATGAGCCAATCGACATCAATGATGAGAATTATTCACCTGCAAAT
CAGCAAAATCCCGATGAAGACAATGTCGAGAAATCCTTGACAGTAGTGGC
AGTCTACAGCTATCATTCTTTACAAGATGATGAGATTTCATTCGAGGAAG
GCGAGCATATTTACAATGTCAATCAAATCGACGAGGGCTGGTGGCAAGGC
GAAACCAAGGACGGCGATAAAGGAATGTTTCCTTCGAATTATGTTATGAT
TCCATAATTCAATTGGGTTTTTTTTTACACTTTTCAATAAATC
back to top

protein sequence of SMED30003885-orf-1

>SMED30003885-orf-1 ID=SMED30003885-orf-1|Name=SMED30003885-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=699bp
MDLDLSTNGSSIKECIGKLSSGKISWMILGYSGNRTLHIVETGDNSLEDM
FDEFHGSEIMYGFASVIDPNTKLKKNIYIHWQGSGAQQVMKTKSVQHSTA
VRDLFKPIHVTITARDPQDLDLKEVMQKVAAASGSNYSVHNEKQQIYETK
PVVKSQCNTANAIQEERRKELASLGNMKNEFSDNRKNNSPQVNISNKPVV
FSKPGVTKVGTNYEKINPEKEFKSLNLHQKSTYETQARIQSENNTAEKAR
EERQKELSKLANRTYIDEGFQQVGTNYTKINPIAEIQKLKRQSVSNESES
PIRSPSANYTKCDALDEITRLRRESVNNDDGSVFTTSTYKKINPVSELQE
LRKSHQIADKIETTSSSSYKKINPIEEIKNLRAKSELISNEPTPVTSSYK
KINPAEEIMSVRAKIPSISNSSETKASVLHNRFEEKKPIQRQNSRGEQKS
ARSTFQKLHKSIDDPHFDVGHHSPPSNPSVLKEEKFENKKHEEIGNFSEK
NISGSNNKVTLLKEEKIENKNNETKDFKEKNNASQNNKIDTKSVHLENQD
TKTPKTKSAKAVFEYECQDSDEIDFEVGEIITDIEEIDEGWWIGCNKSGK
RGMFPSNYVELITTNDEPIDINDENYSPANQQNPDEDNVEKSLTVVAVYS
YHSLQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMIP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000120progenitor cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036028SH3-like_dom_sf
IPR001452SH3_domain
IPR002108ADF-H
IPR029006ADF-H/Gelsolin-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003779actin binding
GO:0051015actin filament binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0006898receptor-mediated endocytosis
GO:0007416synapse assembly
GO:0048812neuron projection morphogenesis
GO:0097178ruffle assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 517..537
NoneNo IPR availableCOILSCoilCoilcoord: 239..263
NoneNo IPR availablePRINTSPR00499P67PHOXcoord: 665..681
score: 29.41
coord: 645..665
score: 40.48
coord: 572..591
score: 22.5
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 541..617
e-value: 1.1E-20
score: 74.8
coord: 627..698
e-value: 1.5E-21
score: 77.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 430..455
NoneNo IPR availablePANTHERPTHR10829:SF25DREBRIN-LIKE PROTEINcoord: 636..696
coord: 1..284
coord: 555..612
NoneNo IPR availablePANTHERPTHR10829CORTACTIN AND DREBRINcoord: 555..612
NoneNo IPR availablePANTHERPTHR10829CORTACTIN AND DREBRINcoord: 636..696
coord: 1..284
NoneNo IPR availableCDDcd11819SH3_Cortactin_likecoord: 644..695
e-value: 1.46308E-21
score: 86.213
NoneNo IPR availableCDDcd11819SH3_Cortactin_likecoord: 559..611
e-value: 2.40277E-23
score: 91.2206
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 2..140
IPR001452SH3 domainPRINTSPR00452SH3DOMAINcoord: 643..653
score: 36.96
coord: 686..698
score: 42.23
coord: 674..683
score: 36.03
coord: 657..672
score: 30.59
IPR001452SH3 domainSMARTSM00326SH3_2coord: 643..698
e-value: 5.4E-18
score: 75.8
coord: 557..613
e-value: 1.8E-18
score: 77.3
IPR001452SH3 domainPFAMPF14604SH3_9coord: 561..610
e-value: 1.9E-13
score: 50.1
IPR001452SH3 domainPFAMPF00018SH3_1coord: 646..692
e-value: 8.4E-13
score: 47.7
IPR001452SH3 domainPROSITEPS50002SH3coord: 640..698
score: 26.352
IPR001452SH3 domainPROSITEPS50002SH3coord: 554..614
score: 26.555
IPR002108Actin-depolymerising factor homology domainSMARTSM00102adf_2coord: 10..130
e-value: 0.0015
score: 19.1
IPR002108Actin-depolymerising factor homology domainPFAMPF00241Cofilin_ADFcoord: 16..128
e-value: 1.5E-14
score: 53.8
IPR002108Actin-depolymerising factor homology domainPROSITEPS51263ADF_Hcoord: 4..130
score: 17.763
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 1..130
e-value: 1.9E-32
score: 113.6
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 557..632
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 631..696