slc1a-3

Overview
Nameslc1a-3 (AKN21393.1)
Smed IDSMED30003880
Length (bp)1603
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc1a-3 (SMED30003880) t-SNE clustered cells

Violin plots show distribution of expression levels for slc1a-3 (SMED30003880) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc1a-3 (SMED30003880) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc1a-3 (SMED30003880) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003880

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30003880SMESG000046414.1 SmedASXL_009860SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30003880SMESG000046414.1 SmedASXL_009860SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30003880SMESG000046414.1 dd_Smed_v4_3514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30003880 Contig53337newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30003880 Contig53337uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
glial cellSMED30003880SMESG000046414.1 dd_Smed_v6_3514_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
proximal tubuleSMED30003880SMESG000046414.1 Smed-slc1a-3smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc1a-3 vs. Ensembl Human
Match: SLC1A1 (solute carrier family 1 member 1 [Source:HGNC Symbol;Acc:HGNC:10939])

HSP 1 Score: 330.102 bits (845), Expect = 1.488e-106
Identity = 181/396 (45.71%), Postives = 263/396 (66.41%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPG-NKDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQ-------------AEIRFINKS----VKSRIGLTKYVQQPIVS-YANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI-VSNDHKMTN 1552
            K+G+  +VYY  TT  AV LG+ LVV I PG  +  G  A   +   +  V+++LDL  N+FP+N++++ FQQ              E+    +S    + + I   K  +  IV  Y++  N LGLI F + FG+V+  MG KG++LV   N L+D TM++V+II+  +P+GI FL+   +++V + + I   +G++  TVLTG+AIH  +ILP+IY +  RKNP+ F +GM++A++ A +  SSSATLPVT  CAEENN++D RIT+F+ P+GA INMDGT LYEAVAA+FIAQ+ND+ L   Q+I IS+T+T A+IGAA VP AGLVT++IVLS  GLP   V+L+   DW LDR RT +N+LGDAFG GI++ L + +L ++ VS++  + N
Sbjct:   89 KIGLRAVVYYFCTTLIAVILGIVLVVSIKPGVTQKVGEIARTGSTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEESFTAVMTTAISKNKTKEYKIVGMYSDGINVLGLIVFCLVFGLVIGKMGEKGQILVDFFNALSDATMKIVQIIMCYMPLGILFLIAGKIIEVEDWE-IFRKLGLYMATVLTGLAIHSIVILPLIYFIVVRKNPFRFAMGMAQALLTALMISSSSATLPVTFRCAEENNQVDKRITRFVLPVGATINMDGTALYEAVAAVFIAQLNDLDLGIGQIITISITATSASIGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQMDVSSEVNIVN 483          
BLAST of slc1a-3 vs. Ensembl Human
Match: SLC1A2 (solute carrier family 1 member 2 [Source:HGNC Symbol;Acc:HGNC:10940])

HSP 1 Score: 300.442 bits (768), Expect = 1.018e-94
Identity = 176/407 (43.24%), Postives = 256/407 (62.90%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGN----KDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQ----------------------AEIRFINKSVKSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI-----VSNDHKMTN 1552
            +LG   MVYY+ TT  A  LG+ LV+ IHPGN    K  G   +++    +DA    LDL  NLFP+N++++ FQQ                      A +  +N++V      TK V +  + + +  N LGLI F I FGI +  MG + +L+V   NILN++ M++V +I++  P+GI  L+   ++ + +L+++   +GM+ VTV+ G+ IH  I LP+IY V TRKNP+ F  G+ +A I A  T SS+ TLPVT  C EEN  ID R+T+F+ P+GA INMDGT LYEAVAAIFIAQ+N + L   Q++ +S+T+TLA++GAA++PSAGLVT+L++L+  GLPT  +SLL   DW LDR RTS+N++GD+FG GI+  L +++L+ I     V  D +MT 
Sbjct:  106 RLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDA---FLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTK 509          
BLAST of slc1a-3 vs. Ensembl Human
Match: SLC1A2 (solute carrier family 1 member 2 [Source:HGNC Symbol;Acc:HGNC:10940])

HSP 1 Score: 300.442 bits (768), Expect = 1.018e-94
Identity = 176/407 (43.24%), Postives = 256/407 (62.90%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGN----KDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQ----------------------AEIRFINKSVKSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI-----VSNDHKMTN 1552
            +LG   MVYY+ TT  A  LG+ LV+ IHPGN    K  G   +++    +DA    LDL  NLFP+N++++ FQQ                      A +  +N++V      TK V +  + + +  N LGLI F I FGI +  MG + +L+V   NILN++ M++V +I++  P+GI  L+   ++ + +L+++   +GM+ VTV+ G+ IH  I LP+IY V TRKNP+ F  G+ +A I A  T SS+ TLPVT  C EEN  ID R+T+F+ P+GA INMDGT LYEAVAAIFIAQ+N + L   Q++ +S+T+TLA++GAA++PSAGLVT+L++L+  GLPT  +SLL   DW LDR RTS+N++GD+FG GI+  L +++L+ I     V  D +MT 
Sbjct:  106 RLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDA---FLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTK 509          
BLAST of slc1a-3 vs. Ensembl Human
Match: SLC1A2 (solute carrier family 1 member 2 [Source:HGNC Symbol;Acc:HGNC:10940])

HSP 1 Score: 300.442 bits (768), Expect = 1.122e-94
Identity = 176/407 (43.24%), Postives = 256/407 (62.90%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGN----KDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQ----------------------AEIRFINKSVKSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI-----VSNDHKMTN 1552
            +LG   MVYY+ TT  A  LG+ LV+ IHPGN    K  G   +++    +DA    LDL  NLFP+N++++ FQQ                      A +  +N++V      TK V +  + + +  N LGLI F I FGI +  MG + +L+V   NILN++ M++V +I++  P+GI  L+   ++ + +L+++   +GM+ VTV+ G+ IH  I LP+IY V TRKNP+ F  G+ +A I A  T SS+ TLPVT  C EEN  ID R+T+F+ P+GA INMDGT LYEAVAAIFIAQ+N + L   Q++ +S+T+TLA++GAA++PSAGLVT+L++L+  GLPT  +SLL   DW LDR RTS+N++GD+FG GI+  L +++L+ I     V  D +MT 
Sbjct:  115 RLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDA---FLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTK 518          
BLAST of slc1a-3 vs. Ensembl Human
Match: SLC1A2 (solute carrier family 1 member 2 [Source:HGNC Symbol;Acc:HGNC:10940])

HSP 1 Score: 300.442 bits (768), Expect = 1.202e-94
Identity = 176/407 (43.24%), Postives = 256/407 (62.90%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGN----KDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQ----------------------AEIRFINKSVKSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI-----VSNDHKMTN 1552
            +LG   MVYY+ TT  A  LG+ LV+ IHPGN    K  G   +++    +DA    LDL  NLFP+N++++ FQQ                      A +  +N++V      TK V +  + + +  N LGLI F I FGI +  MG + +L+V   NILN++ M++V +I++  P+GI  L+   ++ + +L+++   +GM+ VTV+ G+ IH  I LP+IY V TRKNP+ F  G+ +A I A  T SS+ TLPVT  C EEN  ID R+T+F+ P+GA INMDGT LYEAVAAIFIAQ+N + L   Q++ +S+T+TLA++GAA++PSAGLVT+L++L+  GLPT  +SLL   DW LDR RTS+N++GD+FG GI+  L +++L+ I     V  D +MT 
Sbjct:  112 RLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDA---FLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTK 515          
BLAST of slc1a-3 vs. Ensembl Celegans
Match: glt-1 (Excitatory amino acid transporter [Source:UniProtKB/Swiss-Prot;Acc:Q10901])

HSP 1 Score: 316.235 bits (809), Expect = 6.173e-102
Identity = 175/381 (45.93%), Postives = 250/381 (65.62%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGN----KDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFIN---KSVKSRIGLT---------KYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLN 1519
            KLG   + YY+ TT  AV  G+ LV++IHPG+    K+ G   E    K +  V+++LDL  N+FP+N++++TFQQ + ++I    K VK+    T          YV+   V Y +  N LG+I F I  GI L+ +G +  ++V    I++ + M++V  +++  P GIF L++  +L++ +L      + M+ VTVL+G+AIH  I LP+I+ V T+KNPY+FM G+ +A I A  T SSSATLP+T  C EEN  +D R+T+F+ P+GA INMDGT LYEAVAAIFIAQIN + LS  Q++ +S+T+TLA+IGAA+VPSAGLVT+L+VL+  GLP   VSL+   DW LDR RTSIN+LGDA G GI+    + DL+
Sbjct:   78 KLGSLAVTYYMFTTAVAVVTGIFLVLVIHPGDPTIKKEIGTGTEG---KTVSTVDTLLDLLRNMFPENVVQATFQQVQTKYIKVRPKVVKNNDSATLAALNNGSLDYVKAS-VEYTSGMNVLGVIVFCIAIGISLSQLGQEAHVMVQFFVIMDKVIMKLVMTVMWYSPFGIFCLIMGKILEIHDLADTARMLAMYMVTVLSGLAIHSLISLPLIFFVTTKKNPYVFMRGLFQAWITALGTASSSATLPITFNCLEENLGVDRRVTRFVLPVGATINMDGTALYEAVAAIFIAQINGVHLSFGQVVTVSLTATLASIGAASVPSAGLVTMLLVLTAVGLPVKDVSLIVAVDWLLDRIRTSINVLGDAMGAGIVYHYSKADLD 454          
BLAST of slc1a-3 vs. Ensembl Celegans
Match: glt-1 (Excitatory amino acid transporter [Source:UniProtKB/Swiss-Prot;Acc:Q10901])

HSP 1 Score: 315.849 bits (808), Expect = 9.466e-102
Identity = 175/381 (45.93%), Postives = 250/381 (65.62%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGN----KDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFIN---KSVKSRIGLT---------KYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLN 1519
            KLG   + YY+ TT  AV  G+ LV++IHPG+    K+ G   E    K +  V+++LDL  N+FP+N++++TFQQ + ++I    K VK+    T          YV+   V Y +  N LG+I F I  GI L+ +G +  ++V    I++ + M++V  +++  P GIF L++  +L++ +L      + M+ VTVL+G+AIH  I LP+I+ V T+KNPY+FM G+ +A I A  T SSSATLP+T  C EEN  +D R+T+F+ P+GA INMDGT LYEAVAAIFIAQIN + LS  Q++ +S+T+TLA+IGAA+VPSAGLVT+L+VL+  GLP   VSL+   DW LDR RTSIN+LGDA G GI+    + DL+
Sbjct:   89 KLGSLAVTYYMFTTAVAVVTGIFLVLVIHPGDPTIKKEIGTGTEG---KTVSTVDTLLDLLRNMFPENVVQATFQQVQTKYIKVRPKVVKNNDSATLAALNNGSLDYVKAS-VEYTSGMNVLGVIVFCIAIGISLSQLGQEAHVMVQFFVIMDKVIMKLVMTVMWYSPFGIFCLIMGKILEIHDLADTARMLAMYMVTVLSGLAIHSLISLPLIFFVTTKKNPYVFMRGLFQAWITALGTASSSATLPITFNCLEENLGVDRRVTRFVLPVGATINMDGTALYEAVAAIFIAQINGVHLSFGQVVTVSLTATLASIGAASVPSAGLVTMLLVLTAVGLPVKDVSLIVAVDWLLDRIRTSINVLGDAMGAGIVYHYSKADLD 465          
BLAST of slc1a-3 vs. Ensembl Celegans
Match: glt-5 (Amino acid transporter [Source:UniProtKB/TrEMBL;Acc:O18210])

HSP 1 Score: 307.375 bits (786), Expect = 1.270e-98
Identity = 168/377 (44.56%), Postives = 249/377 (66.05%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGN----KDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKIVSNDHK 1543
            +LG   ++YY +TT  AV LG+ +V +I PG+    +  G   E E    + A +  LDLF N FP+NI+R+TF Q +  +IN++  +  G T  V      Y +  N LG+I F I  G+V++ +G + + L +L + L+ +  RMV +I++  PIGI  L+   +L+VS+L L    +G+F  TV+ G+AI  FI LP+IY + TR NPY F+ G+ +A++ A  T SS+A+LPVT  C  +   IDPR+TKF+ P+GA++NMDGT LYEA A+IFIAQ+N ++LS  Q++ +S+T+TLA+IGAA++PSAGLVT+LIVL+  GLP + +SL+   DWFLDR RTS+N++GDA G G +  +C + LN  V+   K
Sbjct:   89 RLGSRAVMYYAITTTHAVILGIIVVSIIQPGDPTIKQKMGYDKEGEAAN-VSAAQKFLDLFRNAFPENIMRATFSQVQTNYINQTHSN--GATHEVLH--TGYVDGMNVLGIIVFCIVMGLVVSRIGEEAKALANLFHALDVVITRMVMLIMWLGPIGIPSLIAQKMLEVSDLWLTARMLGLFVFTVILGLAIQAFITLPLIYFIGTRHNPYTFLKGLGQAIMTALGTSSSAASLPVTFRCLNKLG-IDPRVTKFVLPVGAMVNMDGTALYEATASIFIAQMNGLELSIGQIVTVSITATLASIGAASIPSAGLVTMLIVLTALGLPANDISLILAVDWFLDRLRTSVNVIGDALGCGFVHHICADHLNADVAEAEK 459          
BLAST of slc1a-3 vs. Ensembl Celegans
Match: glt-3 (Putative sodium-dependent excitatory amino acid transporter glt-3 [Source:UniProtKB/Swiss-Prot;Acc:Q21353])

HSP 1 Score: 284.648 bits (727), Expect = 2.804e-89
Identity = 160/372 (43.01%), Postives = 243/372 (65.32%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDF--GLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFIN------KSVKSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDL 1516
            ++G+ T++YY++TTF A   G+ LV  IHPG+ +    L         +  +++ LD   N+FP+NII++TFQQ +  ++       ++  S    ++ + +  ++Y N  N LGLI F   FGI+L+ +G +  L+++   +L+ + MR +  +++  PIGI  LV  N++ + NL      + M+ VTV+ G+ IH  + LP++Y + T+K+P+ FM GM +A+  AF T SS ATLPVT    EEN KID R+T+F+ P+GA I MDGT LYEAVA IFIAQ+++I+LS M ++ IS+T+T+A+IG+ +VP AGL T++IVL+T GLP   +SLL T DW LDR RTS+N+LGD+FG GII  L R+ L
Sbjct:   76 RIGIVTIIYYMITTFLATFTGIILVSSIHPGDPELIHELGEGTLENTALSTLDTFLDQIRNMFPENIIQATFQQVQTEYMPIKPSRVRNATSMNMTSEVLHKQTLTYTNEMNVLGLIVFCSGFGIILSILGDQARLMINFFIVLDAIIMRWISALMWCYPIGILSLVCKNIIDIDNLTETAQALAMYVVTVICGLMIHSLLTLPLLYFLVTKKSPFAFMTGMLQALATAFGTASSGATLPVTFRALEENLKIDRRVTRFVLPLGATITMDGTALYEAVAVIFIAQLHNIKLSLMDLVTISITTTVASIGSGSVP-AGLDTIVIVLTTVGLPAKDLSLLLTVDWLLDRIRTSVNVLGDSFGAGIIHHLTRSSL 446          
BLAST of slc1a-3 vs. Ensembl Celegans
Match: glt-6 (Putative sodium-dependent excitatory amino acid transporter glt-6 [Source:UniProtKB/Swiss-Prot;Acc:Q21751])

HSP 1 Score: 270.011 bits (689), Expect = 1.175e-83
Identity = 153/393 (38.93%), Postives = 242/393 (61.58%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNK-----DFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFI--------------NKSVKSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI-VSNDHK 1543
            ++G  T++YY+ T   A  LG+ LV +IHPG+      D      D N  P+D   + LDL  N+FP+NII++TF++ +  ++              N  VK  IG+TK +           N LG+I F   FGIV++ +G +  ++V    IL+ + MR V  +++  P+GI  L+  NLL++ ++  I S + ++  TV  G+ +H  I +P++Y   TR+NP     GM +A + AF T S  ATLP++M C E++  +D RI++F+ P+G+ INMDG  LYEAVA IFIAQ+N++QLS  +++ +S+T+T+A+IG  +VP AGLV++L++L+T GLP   VS+L+T DW LDR RT++N+LGDAF   ++Q L +  L++    +D+K
Sbjct:   86 QMGASTVLYYLSTAVLATILGIFLVTVIHPGDPSIKGTDISEAPSDGNVSPLD---TFLDLVRNMFPENIIQATFERMQTTYVAIRPKIASKNGTSGNIIVKRSIGMTKGM-----------NILGIIVFCTGFGIVISQLGERARIVVDFFVILDAVIMRWVVTLMWFAPLGITCLICGNLLELDDISDIASVLALYVFTVCAGLILHTIITVPLMYFFITRENPLPIFKGMIQAAVTAFGTASGGATLPMSMQCLEDHCGVDRRISRFVLPLGSTINMDGNALYEAVAVIFIAQLNNVQLSLAEVLTVSITATIASIGLGSVP-AGLVSILLILNTVGLPVRDVSMLFTVDWLLDRVRTAVNVLGDAFAASMVQHLLQKKLDQADARHDYK 463          
BLAST of slc1a-3 vs. Ensembl Fly
Match: Eaat1 (gene:FBgn0026439 transcript:FBtr0079800)

HSP 1 Score: 236.884 bits (603), Expect = 1.685e-71
Identity = 140/390 (35.90%), Postives = 230/390 (58.97%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKPIDAV---ESILDLFNNLFPDNIIRST-FQQAEIRFINKSVKSRIGLTKYVQQPIVSYA------NFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDL---NKIVSNDHKMTNL 1555
            K+    + YY +TT  AV LG+ LV  + PG     +  + E+      V   ++++DL  N+F DNII+ST FQ     + N S+           QP+ ++          N LGL+ FS+  G  +  M  KG+LL      L++  M +   +++  P+G+ FL+   ++++ ++   + ++G + +TV+ G+ +H F  + +I+ + TR+ PY ++  +S+ +  AF T SSSAT+P+T+ C + N  IDPR+T+F+ P+GA INMDGT LYEAVAA+FIAQ  ++  S   ++ +S+T+T A+IGAA +P AGLVT+++VL T GL    VSL+   DW LDR RT+IN++ DA G  ++  L +NDL   +++ +  H++  L
Sbjct:   90 KIATRAITYYFVTTISAVILGICLVTTLRPGQGAKIVETQTESIDKASKVLTPDTLMDLVRNMFTDNIIQSTMFQHRTEIYENTSISP--------AQPMENWEFKSAQREGSNVLGLVMFSVILGTTIGRMREKGQLLQDFFTTLSEAMMTITSWVIWISPLGVAFLIAAKIIEMESIAATIQSLGWYFITVMIGLFLHGFGTIAVIFFLGTRRLPYRYIAKLSQVLATAFGTGSSSATMPLTIKCLD-NMGIDPRVTRFVIPVGATINMDGTALYEAVAALFIAQYREMSYSFGTIVAVSITATAASIGAAGIPQAGLVTMVMVLDTVGLEPKDVSLIIAVDWLLDRFRTTINVMCDALGTILVNHLSKNDLASVDRLNAEPHELLEL 470          
BLAST of slc1a-3 vs. Ensembl Fly
Match: Eaat1 (gene:FBgn0026439 transcript:FBtr0079801)

HSP 1 Score: 236.884 bits (603), Expect = 1.685e-71
Identity = 140/390 (35.90%), Postives = 230/390 (58.97%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKPIDAV---ESILDLFNNLFPDNIIRST-FQQAEIRFINKSVKSRIGLTKYVQQPIVSYA------NFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDL---NKIVSNDHKMTNL 1555
            K+    + YY +TT  AV LG+ LV  + PG     +  + E+      V   ++++DL  N+F DNII+ST FQ     + N S+           QP+ ++          N LGL+ FS+  G  +  M  KG+LL      L++  M +   +++  P+G+ FL+   ++++ ++   + ++G + +TV+ G+ +H F  + +I+ + TR+ PY ++  +S+ +  AF T SSSAT+P+T+ C + N  IDPR+T+F+ P+GA INMDGT LYEAVAA+FIAQ  ++  S   ++ +S+T+T A+IGAA +P AGLVT+++VL T GL    VSL+   DW LDR RT+IN++ DA G  ++  L +NDL   +++ +  H++  L
Sbjct:   90 KIATRAITYYFVTTISAVILGICLVTTLRPGQGAKIVETQTESIDKASKVLTPDTLMDLVRNMFTDNIIQSTMFQHRTEIYENTSISP--------AQPMENWEFKSAQREGSNVLGLVMFSVILGTTIGRMREKGQLLQDFFTTLSEAMMTITSWVIWISPLGVAFLIAAKIIEMESIAATIQSLGWYFITVMIGLFLHGFGTIAVIFFLGTRRLPYRYIAKLSQVLATAFGTGSSSATMPLTIKCLD-NMGIDPRVTRFVIPVGATINMDGTALYEAVAALFIAQYREMSYSFGTIVAVSITATAASIGAAGIPQAGLVTMVMVLDTVGLEPKDVSLIIAVDWLLDRFRTTINVMCDALGTILVNHLSKNDLASVDRLNAEPHELLEL 470          
BLAST of slc1a-3 vs. Ensembl Fly
Match: Eaat1 (gene:FBgn0026439 transcript:FBtr0303876)

HSP 1 Score: 236.884 bits (603), Expect = 1.685e-71
Identity = 140/390 (35.90%), Postives = 230/390 (58.97%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKPIDAV---ESILDLFNNLFPDNIIRST-FQQAEIRFINKSVKSRIGLTKYVQQPIVSYA------NFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDL---NKIVSNDHKMTNL 1555
            K+    + YY +TT  AV LG+ LV  + PG     +  + E+      V   ++++DL  N+F DNII+ST FQ     + N S+           QP+ ++          N LGL+ FS+  G  +  M  KG+LL      L++  M +   +++  P+G+ FL+   ++++ ++   + ++G + +TV+ G+ +H F  + +I+ + TR+ PY ++  +S+ +  AF T SSSAT+P+T+ C + N  IDPR+T+F+ P+GA INMDGT LYEAVAA+FIAQ  ++  S   ++ +S+T+T A+IGAA +P AGLVT+++VL T GL    VSL+   DW LDR RT+IN++ DA G  ++  L +NDL   +++ +  H++  L
Sbjct:   90 KIATRAITYYFVTTISAVILGICLVTTLRPGQGAKIVETQTESIDKASKVLTPDTLMDLVRNMFTDNIIQSTMFQHRTEIYENTSISP--------AQPMENWEFKSAQREGSNVLGLVMFSVILGTTIGRMREKGQLLQDFFTTLSEAMMTITSWVIWISPLGVAFLIAAKIIEMESIAATIQSLGWYFITVMIGLFLHGFGTIAVIFFLGTRRLPYRYIAKLSQVLATAFGTGSSSATMPLTIKCLD-NMGIDPRVTRFVIPVGATINMDGTALYEAVAALFIAQYREMSYSFGTIVAVSITATAASIGAAGIPQAGLVTMVMVLDTVGLEPKDVSLIIAVDWLLDRFRTTINVMCDALGTILVNHLSKNDLASVDRLNAEPHELLEL 470          
BLAST of slc1a-3 vs. Ensembl Fly
Match: Eaat1 (gene:FBgn0026439 transcript:FBtr0079802)

HSP 1 Score: 236.884 bits (603), Expect = 1.685e-71
Identity = 140/390 (35.90%), Postives = 230/390 (58.97%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKPIDAV---ESILDLFNNLFPDNIIRST-FQQAEIRFINKSVKSRIGLTKYVQQPIVSYA------NFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDL---NKIVSNDHKMTNL 1555
            K+    + YY +TT  AV LG+ LV  + PG     +  + E+      V   ++++DL  N+F DNII+ST FQ     + N S+           QP+ ++          N LGL+ FS+  G  +  M  KG+LL      L++  M +   +++  P+G+ FL+   ++++ ++   + ++G + +TV+ G+ +H F  + +I+ + TR+ PY ++  +S+ +  AF T SSSAT+P+T+ C + N  IDPR+T+F+ P+GA INMDGT LYEAVAA+FIAQ  ++  S   ++ +S+T+T A+IGAA +P AGLVT+++VL T GL    VSL+   DW LDR RT+IN++ DA G  ++  L +NDL   +++ +  H++  L
Sbjct:   90 KIATRAITYYFVTTISAVILGICLVTTLRPGQGAKIVETQTESIDKASKVLTPDTLMDLVRNMFTDNIIQSTMFQHRTEIYENTSISP--------AQPMENWEFKSAQREGSNVLGLVMFSVILGTTIGRMREKGQLLQDFFTTLSEAMMTITSWVIWISPLGVAFLIAAKIIEMESIAATIQSLGWYFITVMIGLFLHGFGTIAVIFFLGTRRLPYRYIAKLSQVLATAFGTGSSSATMPLTIKCLD-NMGIDPRVTRFVIPVGATINMDGTALYEAVAALFIAQYREMSYSFGTIVAVSITATAASIGAAGIPQAGLVTMVMVLDTVGLEPKDVSLIIAVDWLLDRFRTTINVMCDALGTILVNHLSKNDLASVDRLNAEPHELLEL 470          
BLAST of slc1a-3 vs. Ensembl Fly
Match: Eaat2 (gene:FBgn0026438 transcript:FBtr0078043)

HSP 1 Score: 220.705 bits (561), Expect = 1.221e-64
Identity = 148/387 (38.24%), Postives = 240/387 (62.02%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDE--NRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINK----------------SVKSRIGLTKYVQQPIV-----SYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDL 1516
            K+ + T+VY+  T+FF   LG+ALV++IHPGN D    A+D   +R+ ++ ++S+LDL  N+FPDN+ +++ QQA   ++ K                S      L++ + + +V      Y +  N LG++FF + FG  L  +G KG+++V     + ++ M+MV  +++  P+GI  ++   +L V +L L++S +  F VTV  G+ I+ F+++  IY V  R+NP+ F  G+ +AM+ AF T S++A LP+T  C  E  K+DPRIT+F+ PIG  INMDGT LY AVA+IFIAQ++ + L   +++ + +TST A++ +A+VPSA LV LL+VL+    P   V+LL+  DWF+DR RT+ N+LGD +   +++ L R +L
Sbjct:  103 KIALRTLVYFASTSFFNAALGIALVLLIHPGNPDLH-NADDRSTDRRAVNLLDSLLDLGRNVFPDNLFQASIQQAHTVYLPKPSILHVFNETMNDTLASGSEAQRLSEDLTEDVVLVRDIQYRSGTNTLGIVFFCLVFGTFLGTIGQKGQVVVDFFAAIFEVIMKMVTCVMWLTPVGISSVIAGKILSVGDLGLVMSQLMWFIVTVAIGVFIYQFVVMQAIYFVVVRRNPFKFYAGLIQAMLTAFATASTAAALPITFRCMNEKLKVDPRITRFVLPIGCNINMDGTALYIAVASIFIAQMSGMVLGFGELLTVLLTSTAASMSSASVPSAALVLLLVVLTAIDAPVQDVTLLFAVDWFVDRIRTTNNMLGDCYTAAVVEELSRKEL 488          
BLAST of slc1a-3 vs. Ensembl Zebrafish
Match: slc1a1 (solute carrier family 1 member 1 [Source:ZFIN;Acc:ZDB-GENE-040718-414])

HSP 1 Score: 330.487 bits (846), Expect = 8.216e-107
Identity = 178/388 (45.88%), Postives = 258/388 (66.49%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKP-IDAVESILDLFNNLFPDNIIRSTFQQAEI-RFINKSVKSRIGLTKYVQQP-------------------IVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI 1525
            ++G+  +VYY+ TT  AV LG+ LV+ I PG        + E   P +  VE++LDL  N+FP+N++++ FQQ +  R   +  K  I  T     P                   + SY++  N LGLI F + FG+V+  MG +G +L+   + LN+ TMR+V+II+  +PIGIFFL+   +++V + + I   +G++ VTVL+G+AIH  I LP+IY VF RKNP+ F LGM++A++ A +  SSSATLPVT  CAEENN+ID RIT+F+ P+GA INMDGT LYEAVA+IFIAQ+N+  L+  Q++ IS+T+T+A+IGAA VP+AG+VT++IVL+  GLP   V+L+   DW LDR RT IN+LGDA+G GI+Q L + +L ++
Sbjct:   92 RIGLRAVVYYISTTIIAVILGIVLVMTIKPGVSQSADNIDREGTTPNVTTVETLLDLIRNMFPENLVQACFQQYKTQRREIEPTKPSINTTNATAFPPFTTIISTVAQNLTKDYKIVGSYSDGINVLGLIVFCVTFGLVIGKMGERGRILLEFFDALNEATMRIVQIIMCYMPIGIFFLIAAKIIEVDDWE-IFRKLGLYMVTVLSGLAIHSIIFLPLIYFVFVRKNPFTFTLGMAQALVTALMISSSSATLPVTFRCAEENNRIDKRITRFVLPVGATINMDGTALYEAVASIFIAQLNNYDLNAGQIVTISITATVASIGAAGVPNAGMVTMVIVLTAVGLPADDVTLIIAVDWLLDRFRTMINVLGDAYGAGIVQKLSKRELERM 478          
BLAST of slc1a-3 vs. Ensembl Zebrafish
Match: slc1a2a (solute carrier family 1 member 2a [Source:ZFIN;Acc:ZDB-GENE-100422-11])

HSP 1 Score: 320.087 bits (819), Expect = 1.410e-102
Identity = 169/402 (42.04%), Postives = 257/402 (63.93%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLT-AEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEI--------------RFINKSVKSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLN-----KIVSNDHKMTNL*KYFN 1570
            +LG   M+YY+ TT  A  LG+ LV++IHPGN        E +    + ++++  DL  NLFP+N++++ FQQ +               RF   + K   G  KYV +  + + +  N LG+I F + FGI +  MG K +L+V   N LN++ MR+V +I++  PIGI  L+   ++ +++L+++   +GM+ VTV+ G+ IH  I LP+IY V  RKNP+ F +G+ +A + A  T SS+ TLPVT  C EEN  ID R+T+F+ P+GA INMDGT LYEAVAAIFIAQ+N I+L   Q++ +S+T+TLA++GAA++PSAGLVT+L++L+  GLPT  +SLL   DW LDR RTS+N++GD++G GI+  L +++L+     +I  +D +M     Y+ 
Sbjct:  106 RLGTRAMIYYMSTTVIAAVLGVILVLLIHPGNPKLKANLGEGKKNDEVSSLDAFFDLIRNLFPENLVQACFQQIQTVTTKVEIAPPPPPTRFGRNATK---GAAKYVIKKSLQFKSGMNVLGIIGFFVAFGICMGKMGEKAKLMVDFFNTLNEIVMRLVGMIMWYSPIGIACLICGKIISINDLEMVAKQLGMYMVTVIVGLIIHGGIFLPLIYFVIVRKNPFKFFMGLFQAWVTALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGIELDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVIGDSYGAGIVYHLSKDELDMFDAQQIRPDDFEMAKTQSYYE 504          
BLAST of slc1a-3 vs. Ensembl Zebrafish
Match: slc1a2a (solute carrier family 1 member 2a [Source:ZFIN;Acc:ZDB-GENE-100422-11])

HSP 1 Score: 320.087 bits (819), Expect = 1.410e-102
Identity = 169/402 (42.04%), Postives = 257/402 (63.93%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLT-AEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEI--------------RFINKSVKSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLN-----KIVSNDHKMTNL*KYFN 1570
            +LG   M+YY+ TT  A  LG+ LV++IHPGN        E +    + ++++  DL  NLFP+N++++ FQQ +               RF   + K   G  KYV +  + + +  N LG+I F + FGI +  MG K +L+V   N LN++ MR+V +I++  PIGI  L+   ++ +++L+++   +GM+ VTV+ G+ IH  I LP+IY V  RKNP+ F +G+ +A + A  T SS+ TLPVT  C EEN  ID R+T+F+ P+GA INMDGT LYEAVAAIFIAQ+N I+L   Q++ +S+T+TLA++GAA++PSAGLVT+L++L+  GLPT  +SLL   DW LDR RTS+N++GD++G GI+  L +++L+     +I  +D +M     Y+ 
Sbjct:  106 RLGTRAMIYYMSTTVIAAVLGVILVLLIHPGNPKLKANLGEGKKNDEVSSLDAFFDLIRNLFPENLVQACFQQIQTVTTKVEIAPPPPPTRFGRNATK---GAAKYVIKKSLQFKSGMNVLGIIGFFVAFGICMGKMGEKAKLMVDFFNTLNEIVMRLVGMIMWYSPIGIACLICGKIISINDLEMVAKQLGMYMVTVIVGLIIHGGIFLPLIYFVIVRKNPFKFFMGLFQAWVTALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGIELDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVIGDSYGAGIVYHLSKDELDMFDAQQIRPDDFEMAKTQSYYE 504          
BLAST of slc1a-3 vs. Ensembl Zebrafish
Match: slc1a3b (solute carrier family 1 member 3b [Source:ZFIN;Acc:ZDB-GENE-090708-3])

HSP 1 Score: 313.538 bits (802), Expect = 3.623e-100
Identity = 162/379 (42.74%), Postives = 254/379 (67.02%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRF----------INKSVKSRIGLTKYVQQ----PIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLN 1519
            K+GM  ++YY+ TTF AV +G+ +V++IHPG        + +  + +   ++ LDL  N+FP N++++  QQ + ++          +N S+ +    T+ + Q    P+    N  N LGL+ FS+ FG+++  M  +G+ L    + LN+  MR+V II++  PIGI FL+   ++++ ++  +   +GM+ VTV+ G+ IH  IILP +Y V TRKNP++F+ G+ +A+I A  T SSSATLP+T  C EENNK+D R+T+F+ P+GA INMDGT LYEA+AAIFIAQ+N+++++  Q+I IS+T+T A+IGAA +P AGLVT++IVL++ GLPT  ++L+   DWFLDR RT+ N+LGD+ G GII+ L +++L 
Sbjct:  118 KMGMRAVIYYMTTTFIAVFIGIIMVLIIHPGKGSKDEFTKQQKIEQVSPADAFLDLIRNMFPPNLVQACTQQFKTQYGKRIIHVKMIVNDSIFNLTNATQEIAQEEVIPLSGTTNGVNALGLVVFSMCFGLIIGNMKEQGQALRDFFDSLNEAIMRLVAIIMWYAPIGILFLIAGKIVEMDDITAMGGQLGMYTVTVIIGLMIHGIIILPTLYFVITRKNPFIFITGLLQALITALGTSSSSATLPITFKCLEENNKVDKRVTRFVLPVGATINMDGTALYEALAAIFIAQVNNMEMNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRTTTNVLGDSIGAGIIEFLSKDELQ 496          
BLAST of slc1a-3 vs. Ensembl Zebrafish
Match: slc1a3b (solute carrier family 1 member 3b [Source:ZFIN;Acc:ZDB-GENE-090708-3])

HSP 1 Score: 313.538 bits (802), Expect = 3.623e-100
Identity = 162/379 (42.74%), Postives = 254/379 (67.02%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRF----------INKSVKSRIGLTKYVQQ----PIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLN 1519
            K+GM  ++YY+ TTF AV +G+ +V++IHPG        + +  + +   ++ LDL  N+FP N++++  QQ + ++          +N S+ +    T+ + Q    P+    N  N LGL+ FS+ FG+++  M  +G+ L    + LN+  MR+V II++  PIGI FL+   ++++ ++  +   +GM+ VTV+ G+ IH  IILP +Y V TRKNP++F+ G+ +A+I A  T SSSATLP+T  C EENNK+D R+T+F+ P+GA INMDGT LYEA+AAIFIAQ+N+++++  Q+I IS+T+T A+IGAA +P AGLVT++IVL++ GLPT  ++L+   DWFLDR RT+ N+LGD+ G GII+ L +++L 
Sbjct:  118 KMGMRAVIYYMTTTFIAVFIGIIMVLIIHPGKGSKDEFTKQQKIEQVSPADAFLDLIRNMFPPNLVQACTQQFKTQYGKRIIHVKMIVNDSIFNLTNATQEIAQEEVIPLSGTTNGVNALGLVVFSMCFGLIIGNMKEQGQALRDFFDSLNEAIMRLVAIIMWYAPIGILFLIAGKIVEMDDITAMGGQLGMYTVTVIIGLMIHGIIILPTLYFVITRKNPFIFITGLLQALITALGTSSSSATLPITFKCLEENNKVDKRVTRFVLPVGATINMDGTALYEALAAIFIAQVNNMEMNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRTTTNVLGDSIGAGIIEFLSKDELQ 496          
BLAST of slc1a-3 vs. Ensembl Xenopus
Match: SLC1A1 (solute carrier family 1 (neuronal/epithelial high affinity glutamate transporter, system Xag), member 1 [Source:NCBI gene;Acc:100498100])

HSP 1 Score: 329.331 bits (843), Expect = 1.024e-106
Identity = 175/367 (47.68%), Postives = 249/367 (67.85%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKP-IDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKSRIGLTKYVQQPIVS-YANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLN 1519
            K+G+  +VYY  TT  AV LG+ LVV I PG        +     P +  V+++LDL  N+FP+N++++ FQQ    F   S+       K  +  IV  Y +  N LGLI F + FGIV+  MG KG++LV   N LND TM++V+II++ +P+GI FL+   +++V++ + I   +G++  TVL+G+AIH  +ILP+IY +  RKNP+ F +GM++A++ A +  SSSATLPVT  CAEE N++D RIT+F+ P+GA INMDGT LYEAVAA+FIAQ+ND+ L   Q++ ISVT+T A++GAA VP AGLVT++IVLS  GLP   V+L+   DW LDR RT +N+LGDAFG GI++ L + +L 
Sbjct:   74 KIGLRAIVYYFCTTVIAVILGIVLVVSIKPGVSQSADEIDRTGSTPEVTTVDALLDLLRNMFPENLVQACFQQVRQTF-TLSLSFFFCCNKSKEYKIVGLYTDGVNVLGLIVFCLVFGIVIGKMGEKGQVLVDFFNALNDATMQIVQIIMWYMPVGILFLIAGKIIEVNDWE-IFRKLGLYMATVLSGLAIHSIVILPLIYLIIVRKNPFRFAMGMAQALLTALMISSSSATLPVTFRCAEEKNRVDKRITRFVLPVGATINMDGTALYEAVAAVFIAQLNDMNLDVGQIVTISVTATAASVGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKRELE 438          
BLAST of slc1a-3 vs. Ensembl Xenopus
Match: SLC1A1 (solute carrier family 1 (neuronal/epithelial high affinity glutamate transporter, system Xag), member 1 [Source:NCBI gene;Acc:100498100])

HSP 1 Score: 325.865 bits (834), Expect = 4.836e-105
Identity = 175/377 (46.42%), Postives = 252/377 (66.84%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKP-IDAVESILDLFNNLFPDNIIRSTFQQAEIRF----------INKSVKSRIGLTKYVQQPIVS-YANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLN 1519
            K+G+  +VYY  TT  AV LG+ LVV I PG        +     P +  V+++LDL  N+FP+N++++ FQQ    F          ++  + S    +K  +  IV  Y +  N LGLI F + FGIV+  MG KG++LV   N LND TM++V+II++ +P+GI FL+   +++V++ + I   +G++  TVL+G+AIH  +ILP+IY +  RKNP+ F +GM++A++ A +  SSSATLPVT  CAEE N++D RIT+F+ P+GA INMDGT LYEAVAA+FIAQ+ND+ L   Q++ ISVT+T A++GAA VP AGLVT++IVLS  GLP   V+L+   DW LDR RT +N+LGDAFG GI++ L + +L 
Sbjct:   89 KIGLRAIVYYFCTTVIAVILGIVLVVSIKPGVSQSADEIDRTGSTPEVTTVDALLDLLRNMFPENLVQACFQQVRQTFTLSLSFFFCCVSFGLMSHWNKSK--EYKIVGLYTDGVNVLGLIVFCLVFGIVIGKMGEKGQVLVDFFNALNDATMQIVQIIMWYMPVGILFLIAGKIIEVNDWE-IFRKLGLYMATVLSGLAIHSIVILPLIYLIIVRKNPFRFAMGMAQALLTALMISSSSATLPVTFRCAEEKNRVDKRITRFVLPVGATINMDGTALYEAVAAVFIAQLNDMNLDVGQIVTISVTATAASVGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKRELE 462          
BLAST of slc1a-3 vs. Ensembl Xenopus
Match: SLC1A1 (solute carrier family 1 (neuronal/epithelial high affinity glutamate transporter, system Xag), member 1 [Source:NCBI gene;Acc:100498100])

HSP 1 Score: 322.398 bits (825), Expect = 1.390e-103
Identity = 175/388 (45.10%), Postives = 253/388 (65.21%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKP-IDAVESILDLFNNLFPDNIIRSTFQQAEIRF----------INKSVKSRIGL-----------TKYVQQPIVS-YANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLN 1519
            K+G+  +VYY  TT  AV LG+ LVV I PG        +     P +  V+++LDL  N+FP+N++++ FQQ + +            N +V+    +            K  +  IV  Y +  N LGLI F + FGIV+  MG KG++LV   N LND TM++V+II++ +P+GI FL+   +++V++ + I   +G++  TVL+G+AIH  +ILP+IY +  RKNP+ F +GM++A++ A +  SSSATLPVT  CAEE N++D RIT+F+ P+GA INMDGT LYEAVAA+FIAQ+ND+ L   Q++ ISVT+T A++GAA VP AGLVT++IVLS  GLP   V+L+   DW LDR RT +N+LGDAFG GI++ L + +L 
Sbjct:   89 KIGLRAIVYYFCTTVIAVILGIVLVVSIKPGVSQSADEIDRTGSTPEVTTVDALLDLLRNMFPENLVQACFQQYKTKREELKPSKEPDKNSTVEGNYTIDLALLALADQQNKSKEYKIVGLYTDGVNVLGLIVFCLVFGIVIGKMGEKGQVLVDFFNALNDATMQIVQIIMWYMPVGILFLIAGKIIEVNDWE-IFRKLGLYMATVLSGLAIHSIVILPLIYLIIVRKNPFRFAMGMAQALLTALMISSSSATLPVTFRCAEEKNRVDKRITRFVLPVGATINMDGTALYEAVAAVFIAQLNDMNLDVGQIVTISVTATAASVGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKRELE 475          
BLAST of slc1a-3 vs. Ensembl Xenopus
Match: sugp1 (SURP and G-patch domain containing 1 [Source:Xenbase;Acc:XB-GENE-495007])

HSP 1 Score: 310.842 bits (795), Expect = 8.596e-99
Identity = 163/397 (41.06%), Postives = 256/397 (64.48%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVK-------------SRIGLTKYVQQ--------PIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKIVSNDHKMTN 1552
            K+G+  +VYY +TTF AV +G+ +V++IHPG             + + A ++ILDL  N+FP N++ + F+Q + ++  +  K              ++ ++  ++         PI   A   N LGL+ FS+ FG+V+  M  +G  L    + LN+  MR+V II++  PIGI FL+   +L++ +L ++   +GM+ +TV+ G+ IH  ++LP+++ + TR+NP+ F+ G+ +A+I A  T SSSATLP+T  C EENN +D R+T+F+ P+GA INMDGT LYEA+AAIFIAQ+N+ +L+  Q+I IS+T+T A+IGAA +P AGLVT++IVL++ GLPT  ++L+   DWFLDR RT+ N+LGD+ G GI++ L R++L K    D +M N
Sbjct:  130 KMGLRAVVYYTVTTFIAVFIGIVMVIIIHPGKGTKENLQSHGKIERVQATDAILDLIRNMFPPNLVEACFKQYKTQYNTRVYKVPVSTDQNYSIATEQLNISSILENMVELEEVVPIAGSAGGVNALGLVVFSMCFGLVIGNMKEQGRALKEFFDCLNEAIMRLVAIIIWYAPIGILFLISGKILEMDDLLVMGGQLGMYTITVIVGLLIHAVVVLPLLFFIVTRRNPWPFIGGLLQALITALGTSSSSATLPITFKCLEENNGVDKRVTRFVLPVGATINMDGTALYEALAAIFIAQVNNYELNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTEDITLIIAVDWFLDRLRTTTNVLGDSLGAGIVEHLSRHELKK---QDAEMGN 523          
BLAST of slc1a-3 vs. Ensembl Xenopus
Match: ENSXETT00000031325.1 (excitatory amino acid transporter 2-like [Source:NCBI gene;Acc:100496635])

HSP 1 Score: 307.375 bits (786), Expect = 3.826e-98
Identity = 181/407 (44.47%), Postives = 253/407 (62.16%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGN----KDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVK---SRIGLTK---------YVQQPIVSYANFP-----------------NXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI-VSNDHK 1543
            ++G   MVYY+ TT  A  LG+ LV+ IHPGN    K   +++++E    IDA    LDL  NLFP+N++++ FQQ  I  ++K V    S + L K          + QP  S A                    N LGLI F I FGI +  MG + +L+    NILN++ MR+V +I++  PIGI  L+   +  + +L+++   +GM+ VTV+ G+ IH  ++LP+I+   TRKNP+ F  G+ +A I A  T SS+ TLPVT  C EEN KID R+T+F+ PIGA INMDGT LYEAVAAIFIAQ+ND+ L   Q+  +S+T+TLA++GAA++PSAGLVT+L++L+  GLPT  +SLL   DW LDR RTSIN++GD+FG GII  L + +L  I   +D K
Sbjct:   46 RMGTRAMVYYMSTTILAAVLGVILVLSIHPGNPKLKKQVSISSKNEEVSSIDA---FLDLIRNLFPENLVQACFQQ--ISTVSKKVPVAPSPLELMKPENISSMFSNISQPNSSMAEMDTEPLMVTQKKLEFKSGMNVLGLIGFFIAFGISMGKMGEQAKLMADFFNILNEIIMRLVNMIMWYSPIGIASLICGKIAGIKDLEVVARQLGMYMVTVIVGLVIHGGMVLPLIFFSITRKNPFAFYGGIFQAWITALGTASSAGTLPVTFRCLEENLKIDKRVTRFVLPIGATINMDGTALYEAVAAIFIAQMNDVSLDGGQIATVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLIAVDWLLDRMRTSINVVGDSFGAGIIYHLSKEELAAIDAKHDAK 447          
BLAST of slc1a-3 vs. Ensembl Mouse
Match: Slc1a1 (solute carrier family 1 (neuronal/epithelial high affinity glutamate transporter, system Xag), member 1 [Source:MGI Symbol;Acc:MGI:105083])

HSP 1 Score: 318.161 bits (814), Expect = 3.822e-102
Identity = 179/400 (44.75%), Postives = 263/400 (65.75%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRK----PIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVK---------SRIGLT---------KYVQQPIVS-YANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI-VSNDHKMTN 1552
            K+G+  +VYY  TT  AV LG+ LVV I PG         D NR      +  ++++LDL  N+FP+N++++ FQQ + +   + VK         + + +T         K  +  IV  Y++  N LGLI F + FG+V+  MG KG++LV   N L+D TM++V+II+  +PIGI FL+   +++V + + I   +G++  TVL+G+AIH  I+LP++Y +  RKNP+ F LGM++A++ A +  SSSATLPVT  CAEE N++D RIT+F+ P+GA INMDGT LYEAVAA+FIAQ+N + LS  Q++ IS+T+T A+IGAA VP AGLVT++IVLS  GLP   V+L+   DW LDR RT +N+LGDAFG GI++ L + +L ++ VS++  + N
Sbjct:   89 KIGLRAVVYYFSTTVIAVILGIVLVVSIKPGVTQ---KVNDINRTGKTPEVSTMDAMLDLIRNMFPENLVQACFQQYKTK--REEVKPVGDPGGNATEVSVTTAMTTMSENKTKEYKIVGLYSDGINVLGLIIFCLVFGLVIGKMGEKGQILVDFFNALSDATMKIVQIIMCYMPIGILFLIAGKIIEVEDWE-IFRKLGLYMATVLSGLAIHSLIVLPLLYFIVVRKNPFRFALGMAQALLTALMISSSSATLPVTFRCAEEKNQVDKRITRFVLPVGATINMDGTALYEAVAAVFIAQLNGLDLSIGQIVTISITATAASIGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQMDVSSEVNIVN 482          
BLAST of slc1a-3 vs. Ensembl Mouse
Match: Slc1a2 (solute carrier family 1 (glial high affinity glutamate transporter), member 2 [Source:MGI Symbol;Acc:MGI:101931])

HSP 1 Score: 311.227 bits (796), Expect = 5.393e-99
Identity = 174/401 (43.39%), Postives = 255/401 (63.59%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGN----KDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQ---------------------AEIRFINKSVKSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKIVSNDHKMTN 1552
            +LG   MVYY+ TT  A  LG+ LV+ IHPGN    K  G   +++    +DA    LDL  NLFP+N++++ FQQ                     A I  +N+++      TK V +  + + +  N LGLI F I FGI +  MG + +L+V   NILN++ M++V +I++  P+GI  L+   ++ + +L+++   +GM+ +TV+ G+ IH  I LP+IY V TRKNP+ F  G+ +A I A  T SS+ TLPVT  C E+N  ID R+T+F+ P+GA INMDGT LYEAVAAIFIAQ+N + L   Q++ +S+T+TLA+IGAA++PSAGLVT+L++L+  GLPT  +SLL   DW LDR RTS+N++GD+FG GI+  L +++L+ I S  H+M  
Sbjct:  112 RLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDA---FLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMITVIVGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEDNLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIVTVSLTATLASIGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQ-HRMQE 508          
BLAST of slc1a-3 vs. Ensembl Mouse
Match: Slc1a2 (solute carrier family 1 (glial high affinity glutamate transporter), member 2 [Source:MGI Symbol;Acc:MGI:101931])

HSP 1 Score: 311.612 bits (797), Expect = 5.606e-99
Identity = 174/401 (43.39%), Postives = 255/401 (63.59%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGN----KDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQ---------------------AEIRFINKSVKSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKIVSNDHKMTN 1552
            +LG   MVYY+ TT  A  LG+ LV+ IHPGN    K  G   +++    +DA    LDL  NLFP+N++++ FQQ                     A I  +N+++      TK V +  + + +  N LGLI F I FGI +  MG + +L+V   NILN++ M++V +I++  P+GI  L+   ++ + +L+++   +GM+ +TV+ G+ IH  I LP+IY V TRKNP+ F  G+ +A I A  T SS+ TLPVT  C E+N  ID R+T+F+ P+GA INMDGT LYEAVAAIFIAQ+N + L   Q++ +S+T+TLA+IGAA++PSAGLVT+L++L+  GLPT  +SLL   DW LDR RTS+N++GD+FG GI+  L +++L+ I S  H+M  
Sbjct:  115 RLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDA---FLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMITVIVGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEDNLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIVTVSLTATLASIGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQ-HRMQE 511          
BLAST of slc1a-3 vs. Ensembl Mouse
Match: Slc1a2 (solute carrier family 1 (glial high affinity glutamate transporter), member 2 [Source:MGI Symbol;Acc:MGI:101931])

HSP 1 Score: 311.612 bits (797), Expect = 6.003e-99
Identity = 174/401 (43.39%), Postives = 255/401 (63.59%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGN----KDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQ---------------------AEIRFINKSVKSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKIVSNDHKMTN 1552
            +LG   MVYY+ TT  A  LG+ LV+ IHPGN    K  G   +++    +DA    LDL  NLFP+N++++ FQQ                     A I  +N+++      TK V +  + + +  N LGLI F I FGI +  MG + +L+V   NILN++ M++V +I++  P+GI  L+   ++ + +L+++   +GM+ +TV+ G+ IH  I LP+IY V TRKNP+ F  G+ +A I A  T SS+ TLPVT  C E+N  ID R+T+F+ P+GA INMDGT LYEAVAAIFIAQ+N + L   Q++ +S+T+TLA+IGAA++PSAGLVT+L++L+  GLPT  +SLL   DW LDR RTS+N++GD+FG GI+  L +++L+ I S  H+M  
Sbjct:  112 RLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDA---FLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMITVIVGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEDNLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIVTVSLTATLASIGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQ-HRMQE 508          
BLAST of slc1a-3 vs. Ensembl Mouse
Match: Slc1a2 (solute carrier family 1 (glial high affinity glutamate transporter), member 2 [Source:MGI Symbol;Acc:MGI:101931])

HSP 1 Score: 310.842 bits (795), Expect = 9.469e-99
Identity = 174/401 (43.39%), Postives = 255/401 (63.59%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGN----KDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQ---------------------AEIRFINKSVKSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKIVSNDHKMTN 1552
            +LG   MVYY+ TT  A  LG+ LV+ IHPGN    K  G   +++    +DA    LDL  NLFP+N++++ FQQ                     A I  +N+++      TK V +  + + +  N LGLI F I FGI +  MG + +L+V   NILN++ M++V +I++  P+GI  L+   ++ + +L+++   +GM+ +TV+ G+ IH  I LP+IY V TRKNP+ F  G+ +A I A  T SS+ TLPVT  C E+N  ID R+T+F+ P+GA INMDGT LYEAVAAIFIAQ+N + L   Q++ +S+T+TLA+IGAA++PSAGLVT+L++L+  GLPT  +SLL   DW LDR RTS+N++GD+FG GI+  L +++L+ I S  H+M  
Sbjct:  115 RLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDA---FLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMITVIVGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEDNLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILDGGQIVTVSLTATLASIGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQ-HRMQE 511          
BLAST of slc1a-3 vs. UniProt/SwissProt
Match: sp|P43005|EAA3_HUMAN (Excitatory amino acid transporter 3 OS=Homo sapiens OX=9606 GN=SLC1A1 PE=1 SV=2)

HSP 1 Score: 330.102 bits (845), Expect = 7.145e-106
Identity = 181/396 (45.71%), Postives = 263/396 (66.41%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPG-NKDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQ-------------AEIRFINKS----VKSRIGLTKYVQQPIVS-YANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI-VSNDHKMTN 1552
            K+G+  +VYY  TT  AV LG+ LVV I PG  +  G  A   +   +  V+++LDL  N+FP+N++++ FQQ              E+    +S    + + I   K  +  IV  Y++  N LGLI F + FG+V+  MG KG++LV   N L+D TM++V+II+  +P+GI FL+   +++V + + I   +G++  TVLTG+AIH  +ILP+IY +  RKNP+ F +GM++A++ A +  SSSATLPVT  CAEENN++D RIT+F+ P+GA INMDGT LYEAVAA+FIAQ+ND+ L   Q+I IS+T+T A+IGAA VP AGLVT++IVLS  GLP   V+L+   DW LDR RT +N+LGDAFG GI++ L + +L ++ VS++  + N
Sbjct:   89 KIGLRAVVYYFCTTLIAVILGIVLVVSIKPGVTQKVGEIARTGSTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEESFTAVMTTAISKNKTKEYKIVGMYSDGINVLGLIVFCLVFGLVIGKMGEKGQILVDFFNALSDATMKIVQIIMCYMPLGILFLIAGKIIEVEDWE-IFRKLGLYMATVLTGLAIHSIVILPLIYFIVVRKNPFRFAMGMAQALLTALMISSSSATLPVTFRCAEENNQVDKRITRFVLPVGATINMDGTALYEAVAAVFIAQLNDLDLGIGQIITISITATSASIGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQMDVSSEVNIVN 483          
BLAST of slc1a-3 vs. UniProt/SwissProt
Match: sp|P31597|EAA3_RABIT (Excitatory amino acid transporter 3 OS=Oryctolagus cuniculus OX=9986 GN=SLC1A1 PE=1 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 1.267e-102
Identity = 177/396 (44.70%), Postives = 262/396 (66.16%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKP-IDAVESILDLFNNLFPDNIIRSTFQQ-----AEIRFINKSVK------------SRIGLTKYVQQPIVS-YANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI-VSNDHKMTN 1552
            K+G+  ++YY  TT  AV LG+ LVV I PG        +     P +  V+++LDL  N+FP+N++++ FQQ      E+   + + K            + +   +  +  +V  Y++  N LGLI F + FG+V+  MG KG++LV   N L+D TM++V+II+  +P+GI FL+   +++V + + I   +G++ VTVL+G+AIH  +ILP+IY +  RKNP+ F +GM++A++ A +  SSSATLPVT  CAEE N++D RIT+F+ P+GA INMDGT LYEAVAA+FIAQ+ND+ LS  Q+I ISVT+T A+IGAA VP AGLVT++IVLS  GLP   V+L+   DW LDR RT +N+LGDAFG GI++ L + +L ++ VS++  + N
Sbjct:   89 KIGLRAVLYYFCTTIIAVILGIVLVVSIKPGVTQKVDEIDRTGSTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTTREEVTASDDTGKNGTEESVTAVMTTAVSENRTKEYRVVGLYSDGINVLGLIVFCLVFGLVIGKMGEKGQILVDFFNALSDATMKIVQIIMCYMPLGILFLIAGKIIEVEDWE-IFRKLGLYMVTVLSGLAIHSIVILPLIYFIVVRKNPFRFAMGMTQALLTALMISSSSATLPVTFRCAEEKNRVDKRITRFVLPVGATINMDGTALYEAVAAVFIAQLNDMDLSIGQIITISVTATAASIGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLLDRFRTVVNVLGDAFGTGIVEKLSKKELEQMDVSSEVNIVN 483          
BLAST of slc1a-3 vs. UniProt/SwissProt
Match: sp|P51907|EAA3_RAT (Excitatory amino acid transporter 3 OS=Rattus norvegicus OX=10116 GN=Slc1a1 PE=1 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 8.861e-102
Identity = 179/397 (45.09%), Postives = 261/397 (65.74%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKP-IDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVK---------SRIGLT---------KYVQQPIVS-YANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI-VSNDHKMTN 1552
            K+G+  +VYY  TT  AV LG+ LVV I PG            + P +  V+++LDL  N+FP+N++++ FQQ + +   + VK         + + +T         K  +  IV  Y++  N LGLI F + FG+V+  MG KG++LV   N L+D TM++V+II+  +PIGI FL+   +++V + + I   +G++  TVL+G+AIH  ++LP+IY +  RKNP+ F LGM++A++ A +  SSSATLPVT  CAEE N +D RIT+F+ P+GA INMDGT LYEAVAA+FIAQ+N + LS  Q+I IS+T+T A+IGAA VP AGLVT++IVLS  GLP   V+L+   DW LDR RT +N+LGDAFG GI++ L + +L ++ VS++  + N
Sbjct:   89 KIGLRAVVYYFSTTVIAVILGIVLVVSIKPGVTQKVNEINRTGKTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTK--REEVKPASDPGGNQTEVSVTTAMTTMSENKTKEYKIVGLYSDGINVLGLIIFCLVFGLVIGKMGEKGQILVDFFNALSDATMKIVQIIMCYMPIGILFLIAGKIIEVEDWE-IFRKLGLYMATVLSGLAIHSLVVLPLIYFIVVRKNPFRFALGMAQALLTALMISSSSATLPVTFRCAEEKNHVDKRITRFVLPVGATINMDGTALYEAVAAVFIAQLNGMDLSIGQIITISITATAASIGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQVDVSSEVNIVN 482          
BLAST of slc1a-3 vs. UniProt/SwissProt
Match: sp|Q95135|EAA3_BOVIN (Excitatory amino acid transporter 3 OS=Bos taurus OX=9913 GN=SLC1A1 PE=2 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 1.094e-101
Identity = 176/396 (44.44%), Postives = 256/396 (64.65%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPG-NKDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQ-----AEIRF------------INKSVKSRIGLTKYVQQPIVS-YANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI-VSNDHKMTN 1552
            K+G+  +VYY  TT  AV LG+ LVV I PG  +         N   +  V+++LDL  N+FP+N++++ FQQ      E+              +   + + I   K  +  +V  Y++  N LGLI F +  GIV+     KG++LV   N L+D TM++V+II+  +PIGI FL+   +++V + + I   +G++  TVL+G+AIH  +ILP+IY +  RKNP+ F +GM++A++ A +  SSSATLPVT  CAEE N++D RIT+F+ P+GA INMDGT LYEAVAA+FIAQ+ND+ LS  Q+I ISVT+T A+IGAA VP  GLVT++IVLS  GLP   V+L+   DW LDR RT +N+LGDAFG GI++ L + +L ++ VS++  + N
Sbjct:   89 KIGLRAVVYYFCTTLIAVILGIVLVVSIKPGVTQKVNEIDRTGNTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTTREEVELSEEPGTNSTEATVTAIMTTAISKNKTKEYKVVGMYSDGINVLGLIVFCLVLGIVIGRKWEKGQILVDFFNALSDATMKIVQIIMCYMPIGILFLIAGKIIEVEDWE-IFRKLGLYMATVLSGLAIHSIVILPLIYFIIVRKNPFQFAMGMAQALLTALMISSSSATLPVTFRCAEEKNRVDKRITRFVLPVGATINMDGTALYEAVAAVFIAQLNDLDLSVGQIITISVTATAASIGAAGVPQPGLVTMVIVLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQMDVSSEVNIVN 483          
BLAST of slc1a-3 vs. UniProt/SwissProt
Match: sp|P51906|EAA3_MOUSE (Excitatory amino acid transporter 3 OS=Mus musculus OX=10090 GN=Slc1a1 PE=1 SV=2)

HSP 1 Score: 318.161 bits (814), Expect = 2.674e-101
Identity = 179/400 (44.75%), Postives = 263/400 (65.75%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRK----PIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVK---------SRIGLT---------KYVQQPIVS-YANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI-VSNDHKMTN 1552
            K+G+  +VYY  TT  AV LG+ LVV I PG         D NR      +  ++++LDL  N+FP+N++++ FQQ + +   + VK         + + +T         K  +  IV  Y++  N LGLI F + FG+V+  MG KG++LV   N L+D TM++V+II+  +PIGI FL+   +++V + + I   +G++  TVL+G+AIH  I+LP++Y +  RKNP+ F LGM++A++ A +  SSSATLPVT  CAEE N++D RIT+F+ P+GA INMDGT LYEAVAA+FIAQ+N + LS  Q++ IS+T+T A+IGAA VP AGLVT++IVLS  GLP   V+L+   DW LDR RT +N+LGDAFG GI++ L + +L ++ VS++  + N
Sbjct:   89 KIGLRAVVYYFSTTVIAVILGIVLVVSIKPGVTQ---KVNDINRTGKTPEVSTMDAMLDLIRNMFPENLVQACFQQYKTK--REEVKPVGDPGGNATEVSVTTAMTTMSENKTKEYKIVGLYSDGINVLGLIIFCLVFGLVIGKMGEKGQILVDFFNALSDATMKIVQIIMCYMPIGILFLIAGKIIEVEDWE-IFRKLGLYMATVLSGLAIHSLIVLPLLYFIVVRKNPFRFALGMAQALLTALMISSSSATLPVTFRCAEEKNQVDKRITRFVLPVGATINMDGTALYEAVAAVFIAQLNGLDLSIGQIVTISITATAASIGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQMDVSSEVNIVN 482          
BLAST of slc1a-3 vs. TrEMBL
Match: A0A0H3YJW6 (Slc1a-3 OS=Schmidtea mediterranea OX=79327 GN=slc1a-3 PE=2 SV=1)

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 467/467 (100.00%), Postives = 467/467 (100.00%), Query Frame = 2
Query:  155 MVILRNFRRSRVGKFLQKKDNXXXXXXXXXXXXXXXXXXPMKSLDLSAKTIYCISIPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKIVSNDHKMTNL 1555
            MVILRNFRRSRVGKFLQKKDNILVICTIIAAVLAVVISIPMKSLDLSAKTIYCISIPGIILMNLLKMMILPLLVLSLLTGLTSLNISTSGKLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKSRIGLTKYVQQPIVSYANFPNFLGLIFFSIFFGIVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKIVSNDHKMTNL
Sbjct:    1 MVILRNFRRSRVGKFLQKKDNILVICTIIAAVLAVVISIPMKSLDLSAKTIYCISIPGIILMNLLKMMILPLLVLSLLTGLTSLNISTSGKLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKSRIGLTKYVQQPIVSYANFPNFLGLIFFSIFFGIVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKIVSNDHKMTNL 467          
BLAST of slc1a-3 vs. TrEMBL
Match: A0A0H3YEU5 (Amino acid transporter OS=Schmidtea mediterranea OX=79327 GN=slc1a-5 PE=2 SV=1)

HSP 1 Score: 340.117 bits (871), Expect = 9.661e-108
Identity = 182/383 (47.52%), Postives = 260/383 (67.89%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGN----KDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINK-------SVKSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKIVSNDH 1540
            K+G+Y +VYYV+TT  AV LG+ LVV IHPGN    K  G       +   D +++ LDL  NL P N+I + F+Q++  ++ K         K  I +TK V    +++    N LGL+ FSI FG++L  MG +  ++     +LN++ M++VK+I++  PIGIFFL++  +L++ +L    S++GM+ VTVL G+ IH  I L +I+ VFTRKNP+++  GM +A + A  T SSSATLP+T  C EENN +D R+T+F+ PIGA INMDGT LYEAVA+IFIAQIN I LS  Q+  IS+T+TLAAIGAA+VPSAGLVT+++VL++ GLP + ++L+   DW LDR RTSIN+LGDAFG GI+  LC+  L ++ +++ 
Sbjct:   91 KMGLYAIVYYVVTTLMAVILGIILVVAIHPGNPNIKKSLG-PGSMTKKTDTDTLDAFLDLIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKIV----INHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNE 468          
BLAST of slc1a-3 vs. TrEMBL
Match: A0A091LQP4 (Amino acid transporter (Fragment) OS=Cariama cristata OX=54380 GN=N322_09825 PE=3 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 5.264e-106
Identity = 178/390 (45.64%), Postives = 261/390 (66.92%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENR----KPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKSRIGLTK----YVQQPIVS---------------YANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI 1525
            K+G+  ++YY  TT  AV LG+ LVV I PG      TA + +R      +  V+++LDL  N+FP+N++++ FQQ + +   + V++  GL K      ++P+ +               Y++  N LGLI F + FG+V+  MG KG++LV   N LN+ TMR+V+II++ +PIGI FL+   +++V + + I   +G++  TVL+G+AIH  +ILP+IY +  RKNP+ F +GM++A++ A +  SSSATLPVT  CAEE N ID RIT+F+ P+GA INMDGT LYEAVAA+FIAQ+ND++L   Q++ ISVT+T A+IGAA VP AGLVT++IVLS  GLP   V+L+   DW LDR RT +N+LGDAFG GI++ L + +L ++
Sbjct:   15 KIGLRAVIYYFCTTVIAVILGIVLVVTIKPGVPQ---TASEIDRVGSTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTK--REKVEATTGLDKNGSTLTEEPVTTATTAEASEEYKIVGMYSDGINVLGLIVFCLVFGVVIGKMGEKGQVLVDFFNALNEATMRIVQIIMWYMPIGIVFLIAGKIIEVEDWE-IFRKLGLYMATVLSGLAIHSTVILPLIYLIIVRKNPFRFAMGMAQALLTALMISSSSATLPVTFRCAEEKNFIDKRITRFVLPVGATINMDGTALYEAVAAVFIAQLNDLELDIGQIVTISVTATAASIGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQM 398          
BLAST of slc1a-3 vs. TrEMBL
Match: A0A4W5JUS0 (Amino acid transporter OS=Hucho hucho OX=62062 PE=3 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 2.692e-105
Identity = 180/378 (47.62%), Postives = 256/378 (67.72%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKP-IDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI-VSNDHKMTN 1552
            K+G+  +VYY  TT  AV LG+ LV+ I PG        +     P +  V+++LDL  N+FP+N++++ FQQ  +  I K  K            + SY++  N LGLI F + FG+V+  MG +G +L+   + LN+ TMR+V+II+  +P+GI FL+   +++V + + I   MG++ VTVL+G+AIH  I LP+IY    RKNPY F LGM++A++ A +  SSSATLPVT  CAEEN +ID RIT+F+ P+GA INMDGT LYEAVAAIFIAQ+ND  L   Q++ IS+T+T+A+IGAA VP+AGLVT++IVL+  GLP + V+L+   DW LDR RT IN+LGDA+G GI+Q L R +L ++ V++D  +TN
Sbjct:   79 KIGLRAVVYYFSTTIIAVILGIVLVMTIKPGVSQEAEHIDRTGTTPNVTTVDTLLDLVRNMFPENLLQACFQQVSVINITKDYK-----------IVGSYSDGINVLGLIVFCVAFGLVIGKMGERGRILLEFFDALNEATMRLVQIIMCYMPVGILFLIAAKIIEVEDWE-IFRKMGLYMVTVLSGLAIHSTICLPLIYFAIVRKNPYTFTLGMAQALVTALMISSSSATLPVTFRCAEENLRIDKRITRFVLPVGATINMDGTALYEAVAAIFIAQLNDYALDVGQIVTISITATVASIGAAGVPNAGLVTMVIVLTAVGLPANDVTLIVAVDWLLDRFRTMINVLGDAYGAGIVQKLSRRELERMDVTSDVDVTN 444          
BLAST of slc1a-3 vs. TrEMBL
Match: A0A4S2L4X4 (Amino acid transporter OS=Opisthorchis felineus OX=147828 GN=CRM22_010362 PE=3 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 6.764e-105
Identity = 206/433 (47.58%), Postives = 295/433 (68.13%), Query Frame = 2
Query:  287 DLSAKTIYCISIPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLGMYTMVYYVLTTFFAVCLGMALVVMIHPGN----KDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKSRI----------------GLTKYVQQPIVS--YANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLN 1519
            D S +TIY +S PG +LMN+ KM+I+PL+V SL+ GL +L+  +SGK+G Y ++YYV+TT  A  LG+ALV+ IHPGN    K+ G     E R+P + ++S++DL  NLFP+N+I++  QQ +  ++N +   +                  L + V + IV   Y +  N LGL+ FSI FG++L  MG K  ++V   +IL+++ M MVK ++   P GIFFL+L  +L++ NLK   +++GM+ +TV++G+AIH    L ++Y VFTRKNP+ F  G+ +A I A  T SS+ATLP+T  C E N KID R+T+F+ PIGA INMDGT LYEAVA+IFIAQIN   LS +++I +S+T+TLAAIGAA+VPSAGLVT+++VL++ GLPT  +SL+   DW LDR RTS+N++GDA G GI+  LCR +L 
Sbjct:   81 DPSRRTIYLVSFPGELLMNMFKMLIIPLIVSSLVAGLANLDPKSSGKIGCYALIYYVVTTLLATVLGIALVLSIHPGNPNIRKNLG-EGTTEERRP-ETLDSVMDLLRNLFPENLIQACIQQQQSFYVNVTAHPKYLPAIRDALFNSSELADNLGEPVTEEIVKPRYMDSTNVLGLVSFSIMFGLILGQMGDKAVVMVQFFSILSEVVMHMVKAVMLYSPFGIFFLILGKVLEIENLKETATSLGMYMLTVISGLAIHCLGTLALLYFVFTRKNPFKFYRGVFQAWITALGTSSSAATLPITFRCLENNLKIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINAKDLSVVEVIVVSLTATLAAIGAASVPSAGLVTMMLVLTSVGLPTKDISLILAVDWMLDRIRTSVNVMGDAVGAGIVDHLCRKELE 511          
BLAST of slc1a-3 vs. Ensembl Cavefish
Match: slc1a1 (solute carrier family 1 member 1 [Source:NCBI gene;Acc:103039160])

HSP 1 Score: 322.013 bits (824), Expect = 1.108e-103
Identity = 180/406 (44.33%), Postives = 265/406 (65.27%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKP----IDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKSRI------------------------GLTKYVQQPIV-SYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI-VSNDHKMTN 1552
            K+G+Y +VYY  TT  AV LG+ LV  I PG      TA++ +R      +  V+++LDL  N+FP+N++++ FQQ + +   K ++  +                         LTK     IV +Y++  N LGLI F + FG+V+  MG +G +L+   + LN+ TMR+V+II+  +P+GI FL+   +++V +   I   MGM+ VTVL+G+AIH  + LP+IY +  RKNPY F LGM++A++ A +  SSSATLPVT  CAEENN++D RIT+F+ P+GA INMDGT LYEAVAAIFIAQ+N + L   Q++ IS+T+T+A+IGAA VP+AGLVT++IVL+  GLP   V+L+   DW +DR RT IN+LGDA+G GI+Q L + +L ++ +++D  + N
Sbjct:   92 KIGLYAVVYYFSTTIIAVILGIILVTTIKPGVSQ---TADNIDRAGTTPNVTTVDTLLDLIRNMFPENLVQACFQQYKTQ--RKEIEPSVSNSTNTVTTTTFPPFTTIMTTIAQNLTK--DYTIVGAYSDGINVLGLIVFCVAFGLVIGKMGERGRILLEFFDALNEATMRLVQIIMCYMPVGILFLIAAKIIEVDDWD-IFRKMGMYMVTVLSGLAIHAIVFLPLIYFILVRKNPYSFALGMAQALVTALMISSSSATLPVTFRCAEENNRVDKRITRFVLPVGATINMDGTALYEAVAAIFIAQLNGLDLDVGQIVTISITATVASIGAAGVPNAGLVTMVIVLTAVGLPASDVTLIVAVDWLIDRFRTMINVLGDAYGAGIVQKLSKRELERMDLTSDVDVAN 489          
BLAST of slc1a-3 vs. Ensembl Cavefish
Match: slc1a9 (excitatory amino acid transporter 2-like [Source:NCBI gene;Acc:103041419])

HSP 1 Score: 320.087 bits (819), Expect = 1.271e-102
Identity = 167/370 (45.14%), Postives = 241/370 (65.14%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDF-GLTAEDENR-KPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXV-LNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI 1525
            ++G   MVYY+ TT  A  LG+ LV+ IHPGN    G  A   N+ + + ++++ LDL  NLFP+N++++ FQQ ++        S I      +Q I+  +N       +        + +  MG KG+L+    NILN++ M+MV +I++  P+GI  L+   +  + +L+++   +GM+ VTV+ G+ IH  IILPII+   TRKNP++F  G+ +A I A  T SS+ TLPVT  C EEN KID R+T+F+ PIGA INMDGT LYEAVAAIFIAQ+NDI L   Q+  +S+T+TLA++GAA++PSAGLVT+L++L+  GLPT  +SLL   DW LDR RTSIN++GD+FG GI+  L R +L +I
Sbjct:  106 RMGTRAMVYYMSTTVIAAVLGVILVLGIHPGNPKLRGTQARSSNKDQEVSSLDAFLDLIRNLFPENLVQACFQQVQLSLFAPLYPSEIN-----RQFILELSNCLCLCSGLIGFFITFGIFMGKMGEKGKLMTDFFNILNEIIMKMVSMIMWYSPVGIASLICGKIAAIGDLEVVARQLGMYMVTVIVGLIIHGGIILPIIFFAVTRKNPFVFYSGIFQAWITALGTASSAGTLPVTFRCLEENLKIDKRVTRFVLPIGATINMDGTALYEAVAAIFIAQMNDIDLDGGQIATVSMTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLIAVDWLLDRMRTSINVVGDSFGAGIVDFLSRAELAQI 470          
BLAST of slc1a-3 vs. Ensembl Cavefish
Match: slc1a3b (solute carrier family 1 member 3 [Source:NCBI gene;Acc:103023054])

HSP 1 Score: 315.464 bits (807), Expect = 5.717e-101
Identity = 175/393 (44.53%), Postives = 259/393 (65.90%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGN---KDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEI----RFINKSV---KSRIGLTKYVQQ-------PIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKIVSNDHKMTN 1552
            K+GM  ++YY+ TTF AV +G+ +V++IHPG     +F    + E+  P DA    LDL  N+FP N++++  QQ +     R IN  V   +S   LT   Q+       PI    +  N LGL+ FS+ FG+++  M  +GE L    N LN+  MR+V II++  PIGI FL+   ++++ ++  +   +GM+ +TV+ G+ IH  +ILP +Y V TRKNP++F+ G+ +A+I A  T SSSATLP+T  C EENNK+D R+T+F+ P+GA INMDGT LYEA+AAIFIAQ+N++ ++  Q+I IS+T+T A+IGAA +P AGLVT++IVL++ GLPT  ++L+   DWFLDR RT+ N+LGD+ G GII+ L +++L    S D +M N
Sbjct:  118 KMGMRAVIYYMTTTFIAVFIGIIMVLIIHPGKGSKDEFTQQQKIEHVSPADA---FLDLIRNMFPPNLVQACTQQFKTQYGKRVINVKVIVNESIFNLTNATQEISREEIIPISGTTSGVNALGLVVFSMCFGLIIGNMKEEGEALREFFNSLNEAIMRLVAIIMWYAPIGILFLIAGKIVEMDDITEMGGQLGMYTITVIIGLLIHGMVILPTLYFVITRKNPFIFITGLLQALITALGTSSSSATLPITFKCLEENNKVDKRVTRFVLPVGATINMDGTALYEALAAIFIAQVNNMDMNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRTTTNVLGDSIGAGIIEFLSKDELQ---SGDVEMGN 504          
BLAST of slc1a-3 vs. Ensembl Cavefish
Match: slc1a9 (excitatory amino acid transporter 2-like [Source:NCBI gene;Acc:103041419])

HSP 1 Score: 315.464 bits (807), Expect = 1.798e-99
Identity = 176/376 (46.81%), Postives = 251/376 (66.76%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDF-GLTAEDENR-KPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKSRIGLTKYVQ-QPIV------SYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI 1525
            ++G   MVYY+ TT  A  LG+ LV+ IHPGN    G  A   N+ + + ++++ LDL  NLFP+N++++ FQQ +      +V  ++ +    Q +PI+       +    N LGLI F I FGI +  MG KG+L+    NILN++ M+MV +I++  P+GI  L+   +  + +L+++   +GM+ VTV+ G+ IH  IILPII+   TRKNP++F  G+ +A I A  T SS+ TLPVT  C EEN KID R+T+F+ PIGA INMDGT LYEAVAAIFIAQ+NDI L   Q+  +S+T+TLA++GAA++PSAGLVT+L++L+  GLPT  +SLL   DW LDR RTSIN++GD+FG GI+  L R +L +I
Sbjct:  117 RMGTRAMVYYMSTTVIAAVLGVILVLGIHPGNPKLRGTQARSSNKDQEVSSLDAFLDLIRNLFPENLVQACFQQVQ------TVLKKVAVPVDNQTEPILINKKKLEFKWGMNVLGLIGFFITFGIFMGKMGEKGKLMTDFFNILNEIIMKMVSMIMWYSPVGIASLICGKIAAIGDLEVVARQLGMYMVTVIVGLIIHGGIILPIIFFAVTRKNPFVFYSGIFQAWITALGTASSAGTLPVTFRCLEENLKIDKRVTRFVLPIGATINMDGTALYEAVAAIFIAQMNDIDLDGGQIATVSMTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLIAVDWLLDRMRTSINVVGDSFGAGIVDFLSRAELAQI 486          
BLAST of slc1a-3 vs. Ensembl Cavefish
Match: slc1a9 (excitatory amino acid transporter 2-like [Source:NCBI gene;Acc:103041419])

HSP 1 Score: 315.079 bits (806), Expect = 2.514e-99
Identity = 176/376 (46.81%), Postives = 251/376 (66.76%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDF-GLTAEDENR-KPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKSRIGLTKYVQ-QPIV------SYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI 1525
            ++G   MVYY+ TT  A  LG+ LV+ IHPGN    G  A   N+ + + ++++ LDL  NLFP+N++++ FQQ +      +V  ++ +    Q +PI+       +    N LGLI F I FGI +  MG KG+L+    NILN++ M+MV +I++  P+GI  L+   +  + +L+++   +GM+ VTV+ G+ IH  IILPII+   TRKNP++F  G+ +A I A  T SS+ TLPVT  C EEN KID R+T+F+ PIGA INMDGT LYEAVAAIFIAQ+NDI L   Q+  +S+T+TLA++GAA++PSAGLVT+L++L+  GLPT  +SLL   DW LDR RTSIN++GD+FG GI+  L R +L +I
Sbjct:  122 RMGTRAMVYYMSTTVIAAVLGVILVLGIHPGNPKLRGTQARSSNKDQEVSSLDAFLDLIRNLFPENLVQACFQQVQ------TVLKKVAVPVDNQTEPILINKKKLEFKWGMNVLGLIGFFITFGIFMGKMGEKGKLMTDFFNILNEIIMKMVSMIMWYSPVGIASLICGKIAAIGDLEVVARQLGMYMVTVIVGLIIHGGIILPIIFFAVTRKNPFVFYSGIFQAWITALGTASSAGTLPVTFRCLEENLKIDKRVTRFVLPIGATINMDGTALYEAVAAIFIAQMNDIDLDGGQIATVSMTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLIAVDWLLDRMRTSINVVGDSFGAGIVDFLSRAELAQI 491          
BLAST of slc1a-3 vs. Ensembl Sea Lamprey
Match: slc1a4 (solute carrier family 1 member 4 [Source:ZFIN;Acc:ZDB-GENE-030616-566])

HSP 1 Score: 257.299 bits (656), Expect = 5.247e-80
Identity = 148/380 (38.95%), Postives = 236/380 (62.11%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDF------GLTAEDENRKPIDAVESILDLFN-NLFPDNIIRSTFQQA----EIRFINKSVKSRIGLTKYVQQ---PIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNK 1522
            +LG   ++++++TT  A  +G+A   M+ PG          G  A  +++   +AV+S LDL + N+FP N++ + FQ      E  FI  ++ +  G  + ++Q   P+ S A+  N LGL+ F+I FGI L  +G +GE L+   N  N+ TM +V  I++  P+GI FLV + ++++ +L  ++S++G + +  + G A+H  IILP+IY   TR+NPY F+LG+   +  AF T SSSATLP+ + C EENN +D +I++F+ PIGA +NMDG  L++ VAA+FIA +N++ L   Q+  I VT+T +++GAA +P+ G++TL I+L    LPT+ +SL+   DW +DR  T IN+ GDA G GI+  L + D  K
Sbjct:   52 RLGGLAILFFLVTTLIASSVGVAFAFMLKPGAGGVKPAVYTGAVALPQSK---EAVDSFLDLASRNIFPANLVSAAFQSYATTYETVFIKMNLTTENGTMEIIKQEKVPVGSDADGMNILGLVMFAICFGIALRKLGPEGEALIGFFNSFNEATMVLVSWIMWYAPLGIMFLVASKIVEMDDLVQLISSLGKYILCCILGHAMHGGIILPLIYFACTRQNPYRFLLGIITPLTTAFGTASSSATLPLMIKCIEENNGVDKKISRFILPIGATVNMDGAALFQCVAAVFIAYMNNVTLDAGQIFTILVTATASSVGAAGIPAGGVLTLAIILEAVSLPTNDISLILAVDWLVDRTCTVINVEGDAIGAGILHVLSQRDQKK 428          
BLAST of slc1a-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010766.1 (pep scaffold:Pmarinus_7.0:GL477422:6105:14255:1 gene:ENSPMAG00000009750.1 transcript:ENSPMAT00000010766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.897 bits (494), Expect = 1.934e-57
Identity = 109/321 (33.96%), Postives = 181/321 (56.39%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGL-TAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKS-----RIGLTKYVQQPIVSYANFPNXXXXXXXXXXXX--------------------XVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVA-FVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVT 1306
            ++G   +VYY+ T+  A  LG+ LV+ IHPG+         +E  + + + ++ILDL  N+FP+N++++  QQ +     +  +S     R+ L++  + P     N  N +                              +VL  MG +   ++   +ILN++ MR++ I+++  PIGI  L+   + ++S+L +++  +GM+ +TV+ G+ IH  +ILP++Y V TRKNP  F +G+ +++  A  +   S+ TLPVT  C EEN KID R+T+F+ P+GA INMDGT LYEAVAAIFIAQ+N + L   Q++ +  T
Sbjct:   62 RMGCRALVYYMATSVTAAILGIVLVLAIHPGDPSLKPDKGHEEELQAVSSFDAILDLIRNVFPENLVQACMQQQDFGLHGRHERSGSANVRVTLSE--RSPTGREKNSTNQVTEQRGGCISAGEHVIGTATLRLVCFVIAFGVVLGKMGDEATPMLKFFSILNEIVMRLIIIVIWYSPIGIASLICGKIAELSDLHVVMRQLGMYMLTVIVGLLIHGAVILPLVYFVITRKNPLKFFVGIFQSLTDARALCGRSAGTLPVTFRCLEENLKIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVVVRYT 380          
BLAST of slc1a-3 vs. Ensembl Sea Lamprey
Match: SLC1A2 (solute carrier family 1 member 2 [Source:HGNC Symbol;Acc:HGNC:10940])

HSP 1 Score: 184.496 bits (467), Expect = 7.299e-56
Identity = 85/151 (56.29%), Postives = 115/151 (76.16%), Query Frame = 2
Query: 1103 SSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKIVSNDHKMTNL 1555
            S+ TLPVT  C EEN  ID RIT+F+ P+GA INMDGT LYEAVAAIFIAQ+N + L   Q++ +S+T+TLA++GAA++PSAGLVT+L++L+  GLPT  +SLL   DW LDR RTS+N++GD+FG GI+  L R +L+ I +  H+  +L
Sbjct:    1 SAGTLPVTFRCLEENLGIDKRITRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTSDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSRAELDAIDARAHEDPDL 151          
BLAST of slc1a-3 vs. Ensembl Sea Lamprey
Match: slc1a1 (solute carrier family 1 member 1 [Source:ZFIN;Acc:ZDB-GENE-040718-414])

HSP 1 Score: 126.716 bits (317), Expect = 9.918e-33
Identity = 83/253 (32.81%), Postives = 138/253 (54.55%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPG----NKDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKSRIGLTKYVQQPIVS---------------------YANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTG--IAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQS 1102
            K+G   + YY+ TT  AV LG+ALV++I PG      +   T    N   +D   ++LDL  N+FP+N++++ FQQ   R     +   + +      P+ +                     Y++  N LGLI F + FG V+  MG  GE+L +  + LN+ TMR+V II++ +PIGIFFLV   +++V + + I   +G++  TVL+G  +AIH  ++LP+IY +  R+NP+ ++ G++ A+  A +  S
Sbjct:   89 KIGGLAVAYYLSTTVLAVLLGIALVLLIKPGVSQSTDEIDRTGSTPNATTVD---TLLDLVRNMFPENLVQACFQQYRTR--RSEIDPEVVIVNSTASPVTTTLSMALSTNVTVIKEFRLTGEYSSGINVLGLIVFCVAFGSVIRRMGPSGEILAAFFDALNEATMRIVAIIMWYMPIGIFFLVAGKIMEVDDWE-IFRKLGLYMATVLSGSSLAIHSLVVLPLIYFIVVRRNPFSYIAGLTHAITTALMISS 335          
BLAST of slc1a-3 vs. Ensembl Sea Lamprey
Match: SLC1A2 (solute carrier family 1 member 2 [Source:HGNC Symbol;Acc:HGNC:10940])

HSP 1 Score: 109.383 bits (272), Expect = 1.473e-27
Identity = 77/235 (32.77%), Postives = 125/235 (53.19%), Query Frame = 2
Query:  482 LGMALVVMIHPGN----KDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQ---------AEIRFINKSVKSRIGLTK---------YVQQPIVSY--ANFPNXXXXXXXXXXXX--XVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSS 1108
            LG+ LV+ IHPGN    K  G    +E    +DA    LDL  NLFP+N++++ FQQ         A +    ++V    G++           +  P++S   AN P++        F    I++  MG + +L+V   +ILN++ MR+V +I++  P GI  L+   +  + +L+++   +GM+ +TV+ G+ IH  IILP+IY   TRKNP+ F +G+ +A I A  T S S
Sbjct:    1 LGVILVLAIHPGNPKLKKQLGKGQLNEEVSSLDA---FLDLIRNLFPENLVQACFQQVWTISSIRSAMVLCAPRAVAVGNGVSADLPAAHREMRITLPLMSLIPANTPSYWATRLIGFFIAFGIIMGKMGDQAKLMVEFFSILNEIIMRLVIMIMWYSPFGIASLICGKISDIKDLEVVARQLGMYMITVIVGLIIHGAIILPLIYFSITRKNPFKFFVGIFQAWITALGTASRS 232          
BLAST of slc1a-3 vs. Ensembl Nematostella
Match: EDO37906 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SED2])

HSP 1 Score: 270.396 bits (690), Expect = 2.542e-85
Identity = 156/369 (42.28%), Postives = 230/369 (62.33%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAE-DENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKSRIGLTKYVQQPIVSYANFP---------NXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSL 1501
            K+G  T++YY+ TT  AV LG+A+V +I PG  D       +++  P   ++S LDL  +LFP+NI+ +TF Q E R  N  +     +T             P         N LG++ FSI FGIVL  MG +G  L S    LN++ M+M+ I+++  PIGI  L+  NL+++ ++      +GMF  T L  + IH  +ILP++Y + TR+NP+ +M  +  A++ AF T SSSATLP T+ C EE N +D RI +F+ P+GA +NMDGT LYE V  ++IAQ+N I+L   +++   +T+T AAIGAA +PSAGLVT+LIVL   GLPT  ++L+++ DWF+DR RT +NI GDA+G G+++ L
Sbjct:   30 KIGRRTVLYYLCTTLIAVLLGIAMVSIIQPGKGDKPKGERIEQSAGPRRNLDSFLDLIRSLFPNNIVEATFMQMEYRIRNAKINGTHNITTLRNTIYGPSETIPDGYSRTWGLNVLGIVMFSIVFGIVLGRMGERGAPLKSFFETLNEVIMQMITIVMWLSPIGICSLIAKNLVQMGDIPSAFKALGMFIGTSLAALLIHGLVILPLVYFICTRRNPFKYMFNLVDALVTAFGTDSSSATLPTTIRCCEEENHVDKRIVRFVLPLGATVNMDGTALYEGVCCLWIAQMNGIELGPGEIVTTVLTATAAAIGAAGIPSAGLVTMLIVLQAVGLPTDDIALIWSVDWFIDRFRTMVNITGDAYGAGVVEHL 398          
BLAST of slc1a-3 vs. Ensembl Nematostella
Match: EDO39457 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9W7])

HSP 1 Score: 261.922 bits (668), Expect = 3.355e-81
Identity = 148/403 (36.72%), Postives = 238/403 (59.06%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGN--KDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQ---------AEIRFINKSV------KSRIGLTKYVQQPIVSYANFP----------------------NXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDL 1516
            ++   T VYY+ TT  AV +G+ LV  + PG+  K  G   +    +P+DAV   LDL  + FP NII + F Q         A++ ++N++V      ++ +   + +     +Y   P                      N LGL+ FS+ FG VL  MG +G  L +L   LN++ ++M+ ++++  PIG+  L+   +  + ++   LS +G++  TV+ G+  H   ILP+++ + TR+NP  F+ GM  A++ AF T SS+ATLP T+ C E+ N++D RI++F+ P+G+ +NMDGT LYE VAA+FIAQI+ I+L    +    +T+T A+IGA+ +P AGLVT+++VL+   LPT  + L+ + DWF+DR RT++N+LGDA G GI++ L R+DL
Sbjct:   84 RVSRRTFVYYLATTLLAVIIGVVLVTFMKPGSYGKPEGKGLKPSFYRPLDAV---LDLIRSCFPSNIITAAFMQQRTHYTSTAAKVSYVNRTVNVHNMSQAELNSMRILSNGTHNYTTTPQAIRAASNTVPDGSKADSGENANILGLLVFSLVFGAVLGRMGERGVPLKALFESLNEVILKMLALVMWFAPIGVCSLIAAQMASMEDIMGSLSMLGLYMATVIAGLLAHALFILPLLFIIATRRNPLTFICGMRDALLTAFGTSSSTATLPCTIRCLEDRNRVDARISRFVLPLGSTVNMDGTALYEVVAAVFIAQIHGIELGLDDLAITCLTATAASIGASGIPQAGLVTMVMVLTAVNLPTEDIGLILSVDWFIDRIRTTVNVLGDAIGAGIVEHLSRDDL 483          
BLAST of slc1a-3 vs. Ensembl Nematostella
Match: EDO33620 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRP9])

HSP 1 Score: 240.35 bits (612), Expect = 1.229e-72
Identity = 148/399 (37.09%), Postives = 225/399 (56.39%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKPID--AVESILDLFNNLFPDNIIRSTFQQAEIRFINK--------------SVKSRIGLT-------------KYVQQPI------VSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDL 1516
            K+G   +++Y LTT  A  LG+ LV+ I PG     +   ++  +P+    ++S LDL  +LFP+NI+ + F Q + ++                 S+ SR+  T             K V  P          ++  N LG+  F + FGI+L+ MG+K E L +    LND  MR+V II++  PIGI  +V   + ++ ++  +LS +G F +TV++ I IH   +LP++Y V TRKNPY FMLGM  A++ AF   SSSATLP T+ CAEE   +D RI KF+ P+GA +NMDG  L+E+   IFIAQIN + +    +    + +   ++GAA +PSAG +  +IVL + GLP   ++L+   +W LDR RT++N+ GDA G GI+  + + DL
Sbjct:  103 KIGRRVLLFYFLTTISAAILGLILVLAIRPGRV---VKPVEKQGQPVSYRTMDSFLDLLRSLFPNNIVEACFIQYKTKYAYDPGKYMSYNTTENITSITSRVTTTIISNGTHNITTVVKEVYPPSNLIPSGRQASSGTNVLGIAMFCLVFGIILSRMGAKAEPLRAFFCSLNDAVMRLVMIIMWLSPIGICSIVAAKVGEMGDIVGVLSMVGYFMLTVISSILIHGLFVLPLMYFVMTRKNPYKFMLGMGDALVTAFGISSSSATLPTTIRCAEETG-VDERIAKFVLPLGATVNMDGGALFESCVVIFIAQINGVPMEAAFLFNTVLMAAAISVGAAGIPSAGFIYPVIVLQSVGLPVEDLALVLPIEWLLDRFRTTVNVWGDAVGAGIVNHMSKADL 497          
BLAST of slc1a-3 vs. Ensembl Nematostella
Match: EDO32707 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUA1])

HSP 1 Score: 230.335 bits (586), Expect = 2.468e-71
Identity = 139/326 (42.64%), Postives = 200/326 (61.35%), Query Frame = 2
Query:  590 LFNNLFPDNIIRSTFQQAE----------IRFINKSVKSRIGLTKYVQQPI--VSYANFP------NXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRND 1513
            L   +FP NI  +TF Q            I+  +    +   + + V +    +    FP      N LGL+ FSI  G +L+ MG KG  L      LND+ MRMV ++++  P+GI  L+ + +  + ++ L L  +GMF +T + GI +H  I LPIIY V T+KNP+ FM GMS A++  + T SS+ATLP T+ CAEENN +D RIT+F+ P+GA +NMDGT LYE V AI+IAQIN+I L+  Q++  S+T+T AAIGAA VPSAGL+T++IV     +P   + L++  DWF+DR R   NI+GD++G GI+Q L + +
Sbjct:    1 LHRQVFPPNIAEATFNQVSTNTIKQVFFTIKIFSNGTHNLTTIRQLVHRAYDQIPGGTFPTPGSSMNVLGLVMFSIVLGAMLSKMGDKGLPLKCFFQALNDVVMRMVTLVMWYSPVGICSLIASKVAGMGDIALSLKLLGMFMLTSILGILLHTLITLPIIYYVMTKKNPFKFMKGMSDALVTVWGTASSAATLPTTIRCAEENNGLDSRITRFVLPLGATVNMDGTALYEGVGAIWIAQINNIPLTAGQIVTTSLTATAAAIGAAAVPSAGLITMVIVCQAINVPPDDIGLIFAVDWFIDRFRGLPNIMGDSYGAGIVQHLSKEE 326          
BLAST of slc1a-3 vs. Ensembl Nematostella
Match: EDO28941 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T521])

HSP 1 Score: 145.976 bits (367), Expect = 1.629e-41
Identity = 75/138 (54.35%), Postives = 104/138 (75.36%), Query Frame = 2
Query: 1103 SSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDL 1516
            S+ATLP T+ CAEENN +D RIT+F+ P+GA +NMDGT LYE V AI+IAQIN+I L+  Q++  S+T+T AAIGAA VPSAGL+T++IV     +P   + L++  DWF+DR R   NI+GD++G GI+Q L +++L
Sbjct:   16 SAATLPTTIRCAEENNGLDSRITRFVLPLGATVNMDGTALYEGVGAIWIAQINNIPLTAGQIVTTSLTATAAAIGAAAVPSAGLITMVIVCQAINVPPDDIGLIFAVDWFIDRFRGLPNIMGDSYGAGIVQHLSKDEL 153          
BLAST of slc1a-3 vs. Ensembl Medaka
Match: slc1a1 (solute carrier family 1 member 1 [Source:NCBI gene;Acc:101172361])

HSP 1 Score: 314.694 bits (805), Expect = 2.940e-101
Identity = 171/385 (44.42%), Postives = 250/385 (64.94%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKP-IDAVESILDLFNNLFPDNIIRSTFQQAEIRFIN-KSVKSRIGLTKYVQ----------------QPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI 1525
            K+G+  + YY+ TT  AV LG+ LV+ I PG        +     P +   +++LDL  N+FP+N++++ FQQ + +    + VK    +T                    Q   SY++  N LGLI F + FG+V+  MG KG +L+   + LN+ TM++V+II+  +P+GI FL+   +++V + + I   MG++ VTVL+G+ IH  + LP+IY +  RKNPY F LGM++AM+ A +  SSSATLP+T  CAEENN+ID RIT+F+ P+GA INMDGT LYEAVAAIFIAQIN+  L    ++ IS+T+T+A+IGAA VP+AGLVT++IVL+  GLP   V+L+   DW LDR RT +N+LGDA+G GI+Q L + +L ++
Sbjct:   57 KIGLRAVTYYLSTTIIAVILGIILVMTIKPGVSQEPEEIDRSGTTPNVTTADTLLDLLRNMFPENLVQACFQQYKTKRQEIEPVKGPDNMTTAAPLTTTIMAVVKNITKEYQITGSYSDGINVLGLIVFCVAFGLVIGKMGEKGRILLEFFDALNEATMKLVQIIMCYMPVGILFLIAAKIIEVEDWE-IFKKMGLYMVTVLSGLLIHATVCLPLIYFIIVRKNPYTFTLGMAQAMVTALMISSSSATLPITFRCAEENNRIDKRITRFVLPVGATINMDGTALYEAVAAIFIAQINNYSLDVGHIVTISITATVASIGAAGVPNAGLVTMVIVLTAVGLPAGDVTLIVAVDWLLDRFRTMVNVLGDAYGAGIVQKLSKLELERM 440          
BLAST of slc1a-3 vs. Ensembl Medaka
Match: SLC1A3 (solute carrier family 1 member 3 [Source:NCBI gene;Acc:101170607])

HSP 1 Score: 314.694 bits (805), Expect = 8.005e-101
Identity = 171/396 (43.18%), Postives = 260/396 (65.66%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGN---KDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSV-----------------KSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKIVSNDHKMTN 1552
            K+GM  ++YY+ TT  AV +G+ +V++IHPG     +FG     E   P DA    LDL  N+FP N++++  QQ + ++  ++V                 +  + +T+    PI    N  N LGL+ FS+ FG+++  M  +G+LL    + LN+  M++V II++  PIGI FL+   ++++ +L  +   +GM+ +TV+ G+ IH  +ILP++Y V TR+NP++F+ G+ +A++ A  T SSSATLPVT  C EENNKID RIT+F+ P+GA INMDGT LYEA+AAIFIAQ+N+++++  Q+I IS+T+T A+IGAA +P AGLVT++IVL++ GLPT  ++L+   DWFLDR RT+ N+LGD+ G GII+ L R++L    S D +M N
Sbjct:  104 KMGMRAVIYYMTTTIIAVFIGILIVLIIHPGKGSKAEFGKQQTIEQISPADA---FLDLIRNMFPPNLVQACTQQFKTKYGKRTVHLTVTINDTFFNSTNNTQEVMEITREEMIPIPGQVNGLNALGLVVFSMCFGLIIGNMKEQGQLLREFFDGLNEAIMQLVAIIMWYAPIGILFLIAGKIVEMDDLTQMGGQLGMYTITVIIGLMIHAVLILPMLYFVITRQNPFVFIAGLLQALVTALGTSSSSATLPVTFKCLEENNKIDKRITRFVLPVGATINMDGTALYEALAAIFIAQVNNMEMNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRTTTNVLGDSIGAGIIEFLSRHELR---SKDVEMGN 493          
BLAST of slc1a-3 vs. Ensembl Medaka
Match: slc1a2b (solute carrier family 1 member 2 [Source:NCBI gene;Acc:101170755])

HSP 1 Score: 311.227 bits (796), Expect = 1.620e-99
Identity = 162/383 (42.30%), Postives = 248/383 (64.75%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLT-AEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQ-----AEIRFINKSVKSRIGL----------TKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI 1525
            +LG   MVYY+ TT  A  LG+ LV++IHPGN        E E  + + ++++  DL  NLFP+N++++ FQQ      ++  I + V +   +           +Y+ +  + + +  N LGLI F I FGI +  MG +  L++   NILN++ M++V +I++  P GI  L+   ++ + +L+++   +GM+ +TV+ G+ IH  I LP IY   TRKNP+ F LG+ +A I A  T SS+ TLPVT  C EEN  ID R+T+F+ P+GA INMDGT LYEAVAAIFIAQ+N + L   Q++ +S+T+TLA++GAA++PSAGLVT+L++L+  GLPT  +SLL   DW LDR RTS+N++GD++G GI+  L + +L+++
Sbjct:  106 RLGTRAMVYYMTTTVIAAVLGVILVLLIHPGNPKLKENLGEGEKNEDVSSLDAFFDLIRNLFPENLVQACFQQIQTVTKKVEVIEEEVNTTTSMGGLLVNITHEPQYIVKKSLQFKSGMNVLGLIGFFIAFGICMGKMGERARLMIEFFNILNEIVMKLVIMIMWYSPFGIACLICGKIISIKDLEVVARQLGMYMITVIIGLIIHGVIFLPSIYFAITRKNPFTFFLGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVHLDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVGDSYGAGIVYHLSKAELDEL 488          
BLAST of slc1a-3 vs. Ensembl Medaka
Match: slc1a2b (solute carrier family 1 member 2 [Source:NCBI gene;Acc:101170755])

HSP 1 Score: 311.227 bits (796), Expect = 1.787e-99
Identity = 162/383 (42.30%), Postives = 248/383 (64.75%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLT-AEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQ-----AEIRFINKSVKSRIGL----------TKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKI 1525
            +LG   MVYY+ TT  A  LG+ LV++IHPGN        E E  + + ++++  DL  NLFP+N++++ FQQ      ++  I + V +   +           +Y+ +  + + +  N LGLI F I FGI +  MG +  L++   NILN++ M++V +I++  P GI  L+   ++ + +L+++   +GM+ +TV+ G+ IH  I LP IY   TRKNP+ F LG+ +A I A  T SS+ TLPVT  C EEN  ID R+T+F+ P+GA INMDGT LYEAVAAIFIAQ+N + L   Q++ +S+T+TLA++GAA++PSAGLVT+L++L+  GLPT  +SLL   DW LDR RTS+N++GD++G GI+  L + +L+++
Sbjct:  111 RLGTRAMVYYMTTTVIAAVLGVILVLLIHPGNPKLKENLGEGEKNEDVSSLDAFFDLIRNLFPENLVQACFQQIQTVTKKVEVIEEEVNTTTSMGGLLVNITHEPQYIVKKSLQFKSGMNVLGLIGFFIAFGICMGKMGERARLMIEFFNILNEIVMKLVIMIMWYSPFGIACLICGKIISIKDLEVVARQLGMYMITVIIGLIIHGVIFLPSIYFAITRKNPFTFFLGIFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVHLDPGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVGDSYGAGIVYHLSKAELDEL 493          
BLAST of slc1a-3 vs. Ensembl Medaka
Match: slc1a2a (excitatory amino acid transporter 2-like [Source:NCBI gene;Acc:101160301])

HSP 1 Score: 307.375 bits (786), Expect = 5.587e-98
Identity = 163/394 (41.37%), Postives = 258/394 (65.48%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGN----KDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSV---KSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLN-----KIVSNDHKMTNL*KYFN 1570
            +LG   MVYY+ TT  A  LG+ LV++IHPGN     + GL  +++    + +V++  DL  NLFP+N++++ FQQ +       V   ++R    ++  +  + + +  N LGLI F + FG+++  MG K +L++   N+LN++ M++V  I++  P GI  L+   ++ +++L+++   +GM+ VTV+ G+ IH  I LP+IY V  +KNP+ F +G+ +A + A  T SS+ TLPVT  C EEN  ID R+T+F+ P+GA INMDGT LYEAVAAIFIAQ+N I L   Q+I +S+T+TLA++GAA++PSAGLVT+L++L+  GLPT  +SLL   DW LDR RTS+N++GD++G GI+  L +++L+     ++  +D +M     +F 
Sbjct:  106 RLGTRAMVYYMSTTVIAAVLGVILVLLIHPGNPKLRANLGLGKKNDE---VSSVDAFFDLIRNLFPENLVQACFQQIQTVITKVQVPTNRTR-APPQFTIKRSLQFKSGMNVLGLIGFFVAFGVIMGKMGEKAKLMLEFFNVLNEIVMKLVGAIMWYSPFGIACLICGKIISIADLEVVARQLGMYMVTVIVGLIIHGGIFLPLIYFVIVKKNPFTFFMGIFQAWVTALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGIDLDWGQIITVSMTATLASVGAASIPSAGLVTMLLILTAVGLPTQDISLLVAVDWLLDRFRTSVNVVGDSYGAGIVYHLSKDELDMFDAQQVRMDDFEMAKTQSFFE 495          
BLAST of slc1a-3 vs. Planmine SMEST
Match: SMESG000046414.1 (SMESG000046414.1)

HSP 1 Score: 414.075 bits (1063), Expect = 4.832e-144
Identity = 222/223 (99.55%), Postives = 222/223 (99.55%), Query Frame = 2
Query:  434 MYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQS 1102
            MYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKSRIGLTKYVQQPIVSYANFPNFLGLIFFSIFFGIVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPY FMLGMSRAMIVAFVTQS
Sbjct:    1 MYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKSRIGLTKYVQQPIVSYANFPNFLGLIFFSIFFGIVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYSFMLGMSRAMIVAFVTQS 223          
BLAST of slc1a-3 vs. Planmine SMEST
Match: SMESG000046414.1 (SMESG000046414.1)

HSP 1 Score: 406.757 bits (1044), Expect = 2.840e-141
Identity = 219/220 (99.55%), Postives = 219/220 (99.55%), Query Frame = 2
Query:  443 MVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQS 1102
            MVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKSRIGLTKYVQQPIVSYANFPNFLGLIFFSIFFGIVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPY FMLGMSRAMIVAFVTQS
Sbjct:    1 MVYYVLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKSRIGLTKYVQQPIVSYANFPNFLGLIFFSIFFGIVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYSFMLGMSRAMIVAFVTQS 220          
BLAST of slc1a-3 vs. Planmine SMEST
Match: SMESG000064126.1 (SMESG000064126.1)

HSP 1 Score: 339.732 bits (870), Expect = 2.960e-111
Identity = 182/383 (47.52%), Postives = 260/383 (67.89%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGN----KDFGLTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINK-------SVKSRIGLTKYVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNKIVSNDH 1540
            K+G+Y +VYYV+TT  AV LG+ LVV IHPGN    K  G       +   D +++ LDL  NL P N+I + F+Q++  ++ K         K  I +TK V    +++    N LGL+ FSI FG++L  MG +  ++     +LN++ M++VK+I++  PIGIFFL++  +L++ +L    S++GM+ VTVL G+ IH  I L +I+ VFTRKNP+++  GM +A + A  T SSSATLP+T  C EENN +D R+T+F+ PIGA INMDGT LYEAVA+IFIAQIN I LS  Q+  IS+T+TLAAIGAA+VPSAGLVT+++VL++ GLP + ++L+   DW LDR RTSIN+LGDAFG GI+  LC+  L ++ +++ 
Sbjct:   91 KMGLYAIVYYVVTTLMAVILGIILVVAIHPGNPNIKKSLG-PGSMTKKTDTDTLDAFLDLIRNLLPVNLIEACFRQSQTNYVTKLEHFYENGTKVFINVTKMV----INHQESTNVLGLVSFSIAFGLILGQMGKEARIMFEFFGVLNEVVMKLVKLIMWYSPIGIFFLIVGKILEIKDLANTASSLGMYMVTVLLGLTIHGCITLNLIFFVFTRKNPFVYFHGMLQAWVTALGTASSSATLPITFKCLEENNGVDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINGIYLSFGQIFTISITATLAAIGAASVPSAGLVTMILVLTSVGLPINDITLILAVDWLLDRVRTSINVLGDAFGAGIVDHLCKKQLEELPTDNE 468          
BLAST of slc1a-3 vs. Planmine SMEST
Match: SMESG000022787.1 (SMESG000022787.1)

HSP 1 Score: 317.005 bits (811), Expect = 4.456e-101
Identity = 173/386 (44.82%), Postives = 251/386 (65.03%), Query Frame = 2
Query:  425 KLGMYTMVYYVLTTFFAVCLGMALVVMIHPGNKDFG--LTAEDENRKPIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSV--------------KSRIGLTK----YVQQPIVSYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRNDLNK 1522
            ++G + ++YY  TT  AV LG+ LVV+IHPGN D    L      R+    ++S LDL  N+FP NII++  QQ   +++NK+               K+  GLT       +       +  N LG++ FS++FG+VL+ MG K  ++V    +LN++ M+MVK+I++  PIGIF LV+  +L++ +L+   + +GM+ +TV+TG+ IH    L +IY V  RK+P  F  G+ +A I A  T SS+ATLP+T  C EE   ID R+T+F+ PIGA INMDGT LYEAVA+IFIAQIN  +L  +Q+  +S+T+TLAAIGAA+VPSAGLVT+++VL++ GLPT  +SL+ T DW LDR RTSIN+LGDA+G  ++  LC+  L++
Sbjct:  126 QIGKWALIYYFSTTMMAVVLGIILVVLIHPGNADIKKQLGQGTNKRRAPSTLDSFLDLLRNIFPPNIIQAAMQQISSKYVNKTKAVTDRMLKDMLSQNKTTEGLTTNSTITYEVTATELTDSTNVLGIVAFSMWFGLVLSQMGEKALIMVQFFALLNEVVMKMVKVIMWYSPIGIFSLVIGKVLQIESLEETAAALGMYMLTVITGLFIHACFTLTLIYVVICRKSPIGFFKGIFQAWITALGTASSAATLPITFRCLEEKIGIDKRVTRFVLPIGATINMDGTALYEAVASIFIAQINARKLEPIQIFTVSITATLAAIGAASVPSAGLVTMIMVLTSVGLPTDDISLILTVDWLLDRLRTSINVLGDAYGAAVVHHLCKKTLDE 511          
BLAST of slc1a-3 vs. Planmine SMEST
Match: SMESG000064127.1 (SMESG000064127.1)

HSP 1 Score: 301.212 bits (770), Expect = 1.051e-97
Identity = 169/364 (46.43%), Postives = 249/364 (68.41%), Query Frame = 2
Query:  443 MVYYVLTTFFAVCLGMALVVMIHPGN---KDFGLTAEDENRK-PIDAVESILDLFNNLFPDNIIRSTFQQAEIRFINKSVKSRI-GLTKYVQQPIV--SYANFPNXXXXXXXXXXXXXVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVLTNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLFMLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIINMDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGLVTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLCRND 1513
            M YY+ TT  AV +G+ LVV IHPG+   KD  L      RK P   +++ LDL  N+FP N+I S F+QA   ++++  K  + G  K V    +   Y +  N LGL+ FSI FG+V+  +G + ++L+ + +ILN   M++V +I++  P GI FL++  ++++ +L+  + ++G + +TVL G+ IH  I+L ++Y +  RKNP L+  GM +A+I A  T SSSATLPVT+ C EE N+ID RI++ + PIGA INMDGT LYEAVA+IFIAQIN I L+  Q++ IS+T+TLAA+GAA++PS GL+T++IVL++ GLP   +SLL + DW LDR RT++N+LGDA+G GI+ SLC+ D
Sbjct:    1 MTYYLFTTLMAVIIGIILVVSIHPGDPTVKD-NLEPSKPGRKIPPKTLDAFLDLIRNIFPVNLISSCFRQASTFYVSEVEKILLNGTLKDVNITNIRHGYQDATNILGLLSFSIVFGLVIGNIGKEADVLIKIFHILNIAIMKIVNMIMWYSPFGIMFLIMGKIIEIRDLRTTVQSLGWYMLTVLLGLLIHAGIVLNLLYFIIVRKNPALYFRGMLQAVITALGTSSSSATLPVTIKCVEEINQIDKRISRLVLPIGATINMDGTALYEAVASIFIAQINAIPLNFGQILTISITATLAAVGAASIPSGGLITMIIVLTSVGLPIDDISLLISVDWLLDRFRTAVNVLGDAYGAGIVGSLCQVD 363          
The following BLAST results are available for this feature:
BLAST of slc1a-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC1A11.488e-10645.71solute carrier family 1 member 1 [Source:HGNC Symb... [more]
SLC1A21.018e-9443.24solute carrier family 1 member 2 [Source:HGNC Symb... [more]
SLC1A21.018e-9443.24solute carrier family 1 member 2 [Source:HGNC Symb... [more]
SLC1A21.122e-9443.24solute carrier family 1 member 2 [Source:HGNC Symb... [more]
SLC1A21.202e-9443.24solute carrier family 1 member 2 [Source:HGNC Symb... [more]
back to top
BLAST of slc1a-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glt-16.173e-10245.93Excitatory amino acid transporter [Source:UniProt... [more]
glt-19.466e-10245.93Excitatory amino acid transporter [Source:UniProt... [more]
glt-51.270e-9844.56Amino acid transporter [Source:UniProtKB/TrEMBL;A... [more]
glt-32.804e-8943.01Putative sodium-dependent excitatory amino acid tr... [more]
glt-61.175e-8338.93Putative sodium-dependent excitatory amino acid tr... [more]
back to top
BLAST of slc1a-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eaat11.685e-7135.90gene:FBgn0026439 transcript:FBtr0079800[more]
Eaat11.685e-7135.90gene:FBgn0026439 transcript:FBtr0079801[more]
Eaat11.685e-7135.90gene:FBgn0026439 transcript:FBtr0303876[more]
Eaat11.685e-7135.90gene:FBgn0026439 transcript:FBtr0079802[more]
Eaat21.221e-6438.24gene:FBgn0026438 transcript:FBtr0078043[more]
back to top
BLAST of slc1a-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc1a18.216e-10745.88solute carrier family 1 member 1 [Source:ZFIN;Acc:... [more]
slc1a2a1.410e-10242.04solute carrier family 1 member 2a [Source:ZFIN;Acc... [more]
slc1a2a1.410e-10242.04solute carrier family 1 member 2a [Source:ZFIN;Acc... [more]
slc1a3b3.623e-10042.74solute carrier family 1 member 3b [Source:ZFIN;Acc... [more]
slc1a3b3.623e-10042.74solute carrier family 1 member 3b [Source:ZFIN;Acc... [more]
back to top
BLAST of slc1a-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC1A11.024e-10647.68solute carrier family 1 (neuronal/epithelial high ... [more]
SLC1A14.836e-10546.42solute carrier family 1 (neuronal/epithelial high ... [more]
SLC1A11.390e-10345.10solute carrier family 1 (neuronal/epithelial high ... [more]
sugp18.596e-9941.06SURP and G-patch domain containing 1 [Source:Xenba... [more]
ENSXETT00000031325.13.826e-9844.47excitatory amino acid transporter 2-like [Source:N... [more]
back to top
BLAST of slc1a-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc1a13.822e-10244.75solute carrier family 1 (neuronal/epithelial high ... [more]
Slc1a25.393e-9943.39solute carrier family 1 (glial high affinity gluta... [more]
Slc1a25.606e-9943.39solute carrier family 1 (glial high affinity gluta... [more]
Slc1a26.003e-9943.39solute carrier family 1 (glial high affinity gluta... [more]
Slc1a29.469e-9943.39solute carrier family 1 (glial high affinity gluta... [more]
back to top
BLAST of slc1a-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P43005|EAA3_HUMAN7.145e-10645.71Excitatory amino acid transporter 3 OS=Homo sapien... [more]
sp|P31597|EAA3_RABIT1.267e-10244.70Excitatory amino acid transporter 3 OS=Oryctolagus... [more]
sp|P51907|EAA3_RAT8.861e-10245.09Excitatory amino acid transporter 3 OS=Rattus norv... [more]
sp|Q95135|EAA3_BOVIN1.094e-10144.44Excitatory amino acid transporter 3 OS=Bos taurus ... [more]
sp|P51906|EAA3_MOUSE2.674e-10144.75Excitatory amino acid transporter 3 OS=Mus musculu... [more]
back to top
BLAST of slc1a-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJW60.000e+0100.00Slc1a-3 OS=Schmidtea mediterranea OX=79327 GN=slc1... [more]
A0A0H3YEU59.661e-10847.52Amino acid transporter OS=Schmidtea mediterranea O... [more]
A0A091LQP45.264e-10645.64Amino acid transporter (Fragment) OS=Cariama crist... [more]
A0A4W5JUS02.692e-10547.62Amino acid transporter OS=Hucho hucho OX=62062 PE=... [more]
A0A4S2L4X46.764e-10547.58Amino acid transporter OS=Opisthorchis felineus OX... [more]
back to top
BLAST of slc1a-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc1a11.108e-10344.33solute carrier family 1 member 1 [Source:NCBI gene... [more]
slc1a91.271e-10245.14excitatory amino acid transporter 2-like [Source:N... [more]
slc1a3b5.717e-10144.53solute carrier family 1 member 3 [Source:NCBI gene... [more]
slc1a91.798e-9946.81excitatory amino acid transporter 2-like [Source:N... [more]
slc1a92.514e-9946.81excitatory amino acid transporter 2-like [Source:N... [more]
back to top
BLAST of slc1a-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc1a45.247e-8038.95solute carrier family 1 member 4 [Source:ZFIN;Acc:... [more]
ENSPMAT00000010766.11.934e-5733.96pep scaffold:Pmarinus_7.0:GL477422:6105:14255:1 ge... [more]
SLC1A27.299e-5656.29solute carrier family 1 member 2 [Source:HGNC Symb... [more]
slc1a19.918e-3332.81solute carrier family 1 member 1 [Source:ZFIN;Acc:... [more]
SLC1A21.473e-2732.77solute carrier family 1 member 2 [Source:HGNC Symb... [more]
back to top
BLAST of slc1a-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc1a-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO379062.542e-8542.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394573.355e-8136.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336201.229e-7237.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327072.468e-7142.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289411.629e-4154.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc1a-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc1a12.940e-10144.42solute carrier family 1 member 1 [Source:NCBI gene... [more]
SLC1A38.005e-10143.18solute carrier family 1 member 3 [Source:NCBI gene... [more]
slc1a2b1.620e-9942.30solute carrier family 1 member 2 [Source:NCBI gene... [more]
slc1a2b1.787e-9942.30solute carrier family 1 member 2 [Source:NCBI gene... [more]
slc1a2a5.587e-9841.37excitatory amino acid transporter 2-like [Source:N... [more]
back to top
BLAST of slc1a-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046414.14.832e-14499.55SMESG000046414.1[more]
SMESG000046414.12.840e-14199.55SMESG000046414.1[more]
SMESG000064126.12.960e-11147.52SMESG000064126.1[more]
SMESG000022787.14.456e-10144.82SMESG000022787.1[more]
SMESG000064127.11.051e-9746.43SMESG000064127.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30003880
GenBankAKN21393.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003880 ID=SMED30003880|Name=slc1a-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1603bp
TGATAACGCAAATGATGTTTACGTTAAATCGGTACAATGATTGATAACTG
TGCGAAATTCGGATTTGCATATCTTAATGACTTCGAACCCAAAGATTGAT
GTAAATTTAACAAATATTTAACTTTGAGATTTTACAAACCGGTTCACAGT
TAAAATGGTGATTTTAAGGAATTTCAGAAGAAGTAGGGTTGGAAAATTCC
TTCAAAAGAAAGATAACATTCTAGTAATTTGCACTATCATAGCTGCGGTT
TTGGCAGTTGTTATTTCGATTCCAATGAAATCTTTGGATTTGTCTGCAAA
AACCATTTATTGCATTTCTATTCCGGGAATAATACTGATGAACCTGTTGA
AAATGATGATTTTGCCATTGTTAGTATTGAGTTTGTTAACGGGTCTCACA
TCGTTAAATATCTCAACAAGTGGGAAATTAGGAATGTATACGATGGTTTA
TTACGTTTTAACTACTTTTTTTGCCGTTTGTTTGGGAATGGCGTTAGTCG
TCATGATTCATCCGGGAAATAAAGATTTTGGCTTAACAGCCGAAGATGAA
AACAGAAAGCCGATTGATGCTGTGGAGTCAATTTTAGATTTATTTAATAA
TTTGTTTCCGGACAACATCATCCGATCAACTTTTCAACAAGCGGAGATTC
GTTTTATTAATAAATCAGTCAAAAGTAGAATAGGTTTGACAAAATATGTG
CAACAGCCGATTGTGTCATATGCCAACTTCCCAAACTTTTTAGGATTAAT
ATTTTTCTCAATTTTCTTTGGAATTGTCCTTAATGCCATGGGGTCCAAGG
GAGAATTGCTTGTATCTTTGATTAATATTTTAAATGACTTAACGATGAGA
ATGGTCAAAATTATTTTATATAATATTCCGATAGGTATTTTCTTTCTCGT
TCTAACAAATTTATTGAAAGTCTCCAACTTGAAACTTATTCTGTCAACGA
TGGGAATGTTTGCAGTGACCGTTTTGACTGGGATCGCAATTCATATGTTC
ATAATTTTACCCATTATTTATGCAGTTTTTACAAGAAAAAATCCCTATTT
ATTCATGTTAGGAATGTCAAGAGCAATGATAGTAGCATTTGTTACTCAAT
CTAGTTCTGCGACGCTGCCTGTCACCATGACCTGTGCTGAGGAAAATAAC
AAAATTGATCCAAGAATAACTAAATTTATGTTTCCAATCGGAGCAATAAT
CAACATGGACGGAACTGGTTTGTATGAAGCAGTGGCCGCAATTTTCATAG
CCCAAATAAATGATATACAGCTCTCAACAATGCAAATGATTCGCATCAGT
GTTACTTCAACATTAGCAGCAATCGGGGCTGCGACGGTTCCAAGTGCAGG
ATTAGTAACATTATTAATTGTACTGTCAACTGCTGGTCTACCTACTCATC
AAGTGAGCCTCCTGTATACGTTCGACTGGTTTCTTGATAGGTGTCGGACT
TCAATAAATATTCTCGGTGACGCTTTCGGTGGAGGAATAATCCAGAGTTT
GTGTAGAAATGATTTAAACAAAATTGTTTCAAACGACCACAAAATGACAA
ATTTGTAAAAATATTTCAATAAACAATTAAAATTTATATTTTCGTCAAAA
AAG
back to top

protein sequence of SMED30003880-orf-1

>SMED30003880-orf-1 ID=SMED30003880-orf-1|Name=SMED30003880-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=468bp
MVILRNFRRSRVGKFLQKKDNILVICTIIAAVLAVVISIPMKSLDLSAKT
IYCISIPGIILMNLLKMMILPLLVLSLLTGLTSLNISTSGKLGMYTMVYY
VLTTFFAVCLGMALVVMIHPGNKDFGLTAEDENRKPIDAVESILDLFNNL
FPDNIIRSTFQQAEIRFINKSVKSRIGLTKYVQQPIVSYANFPNFLGLIF
FSIFFGIVLNAMGSKGELLVSLINILNDLTMRMVKIILYNIPIGIFFLVL
TNLLKVSNLKLILSTMGMFAVTVLTGIAIHMFIILPIIYAVFTRKNPYLF
MLGMSRAMIVAFVTQSSSATLPVTMTCAEENNKIDPRITKFMFPIGAIIN
MDGTGLYEAVAAIFIAQINDIQLSTMQMIRISVTSTLAAIGAATVPSAGL
VTLLIVLSTAGLPTHQVSLLYTFDWFLDRCRTSINILGDAFGGGIIQSLC
RNDLNKIVSNDHKMTNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000087proximal tubule
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR036458Na:dicarbo_symporter_sf
IPR001991Na-dicarboxylate_symporter
IPR001024PLAT/LH2_dom
Vocabulary: molecular function
TermDefinition
GO:0015293symporter activity
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00173EDTRNSPORTcoord: 274..293
score: 43.24
coord: 93..118
score: 45.32
coord: 64..84
score: 54.57
coord: 341..367
score: 75.58
coord: 190..212
score: 43.13
coord: 376..395
score: 49.46
coord: 403..423
score: 39.9
coord: 237..256
score: 31.35
coord: 21..41
score: 24.07
NoneNo IPR availablePANTHERPTHR11958SODIUM/DICARBOXYLATE SYMPORTER-RELATEDcoord: 19..462
NoneNo IPR availableTMHMMTMhelixcoord: 385..407
NoneNo IPR availableTMHMMTMhelixcoord: 186..208
NoneNo IPR availableTMHMMTMhelixcoord: 343..365
NoneNo IPR availableTMHMMTMhelixcoord: 21..41
NoneNo IPR availableTMHMMTMhelixcoord: 98..120
NoneNo IPR availableTMHMMTMhelixcoord: 269..291
NoneNo IPR availableTMHMMTMhelixcoord: 56..78
NoneNo IPR availableTMHMMTMhelixcoord: 236..254
IPR001991Sodium:dicarboxylate symporterPFAMPF00375SDFcoord: 23..447
e-value: 1.7E-110
score: 369.7
IPR036458Sodium:dicarboxylate symporter superfamilySUPERFAMILYSSF118215Proton glutamate symport proteincoord: 23..447