SMED30003876

Overview
NameSMED30003876
Smed IDSMED30003876
Length (bp)3186
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30003876 (SMED30003876) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30003876 (SMED30003876) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30003876 (SMED30003876) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30003876 (SMED30003876) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003876

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30003876SMESG000079921.1 SMESG000079899.1 SMESG000079877.1 SMESG000000911.1 SMESG000000908.1 SmedASXL_017638SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30003876SMESG000079921.1 SMESG000079899.1 SMESG000079877.1 SMESG000000911.1 SMESG000000908.1 dd_Smed_v4_13944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30003876SMESG000079921.1 SMESG000079899.1 SMESG000079877.1 SMESG000000911.1 SMESG000000908.1 dd_Smed_v6_13944_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30003876 vs. Ensembl Human
Match: STIL (STIL centriolar assembly protein [Source:HGNC Symbol;Acc:HGNC:10879])

HSP 1 Score: 93.9745 bits (232), Expect = 9.688e-19
Identity = 100/422 (23.70%), Postives = 186/422 (44.08%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNY-QSHNKFEIIIDRI-------EC----NLASYLSDNLLIC---SDDICIPLKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCPNFN--WIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQL-YSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSEEKDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSFVTKLSLAKAND--------------KALTTLLQAFKQYISEHCSNLLNNDFIPRQINDHRQVNMN-DFTGLEVPDVSLLIN 1217
            LW+     + + +     +   ++++ + ++LA ++  Q  +N  SC L+G     +      + +DR        EC      AS   D L+ C   + ++C       S+  +++S DD+  ++K +  H+  + S L   K++SLR++    +S L    F+  W  + L     +   +P+  I +  +AL  +L   L  S  +  + YGYLTMD + KL  LL SD +V   PLVG+W+ G +H     V+  C+++I       ++      F++V ++    EP ++Y+  +P       D  +    F+L +  + L+  FK+ +    N    +LS    N               K  +  L + K  I +H S + + DF PR I     V+         VP++SL+++
Sbjct:   33 LWNPTPTGDFIYLHLSYYRNPKLVVTEKTIRLAYRHAKQNKKNS-SCFLLGSLTADEDEEGVTLTVDRFDPGREVPECLEITPTASLPGDFLIPCKVHTQELC-------SREMIVHSVDDFSSALKALQCHICSKDS-LDCGKLLSLRVHITSRES-LDSVEFDLHWAAVTLAN---NFKCTPVKPIPIIPTALARNLSSNLNISQVQGTYKYGYLTMDETRKLLLLLESDPKVYSLPLVGIWLSGITHIYSPQVWACCLRYIFNSSVQERVFSESGNFIIVLYSMTHKEP-EFYEC-FPC------DGKIPDFRFQLLTSKETLH-LFKNVEPPDKNPIRCELSAESQNAETEFFSKASKNFSIKRSSQKLSSGKMPIHDHDSGVEDEDFSPRPIPSPHPVSQKISKIQPSVPELSLVLD 432          
BLAST of SMED30003876 vs. Ensembl Human
Match: STIL (STIL centriolar assembly protein [Source:HGNC Symbol;Acc:HGNC:10879])

HSP 1 Score: 93.9745 bits (232), Expect = 1.158e-18
Identity = 100/422 (23.70%), Postives = 186/422 (44.08%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNY-QSHNKFEIIIDRI-------EC----NLASYLSDNLLIC---SDDICIPLKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCPNFN--WIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQL-YSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSEEKDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSFVTKLSLAKAND--------------KALTTLLQAFKQYISEHCSNLLNNDFIPRQINDHRQVNMN-DFTGLEVPDVSLLIN 1217
            LW+     + + +     +   ++++ + ++LA ++  Q  +N  SC L+G     +      + +DR        EC      AS   D L+ C   + ++C       S+  +++S DD+  ++K +  H+  + S L   K++SLR++    +S L    F+  W  + L     +   +P+  I +  +AL  +L   L  S  +  + YGYLTMD + KL  LL SD +V   PLVG+W+ G +H     V+  C+++I       ++      F++V ++    EP ++Y+  +P       D  +    F+L +  + L+  FK+ +    N    +LS    N               K  +  L + K  I +H S + + DF PR I     V+         VP++SL+++
Sbjct:   33 LWNPTPTGDFIYLHLSYYRNPKLVVTEKTIRLAYRHAKQNKKNS-SCFLLGSLTADEDEEGVTLTVDRFDPGREVPECLEITPTASLPGDFLIPCKVHTQELC-------SREMIVHSVDDFSSALKALQCHICSKDS-LDCGKLLSLRVHITSRES-LDSVEFDLHWAAVTLAN---NFKCTPVKPIPIIPTALARNLSSNLNISQVQGTYKYGYLTMDETRKLLLLLESDPKVYSLPLVGIWLSGITHIYSPQVWACCLRYIFNSSVQERVFSESGNFIIVLYSMTHKEP-EFYEC-FPC------DGKIPDFRFQLLTSKETLH-LFKNVEPPDKNPIRCELSAESQNAETEFFSKASKNFSIKRSSQKLSSGKMPIHDHDSGVEDEDFSPRPIPSPHPVSQKISKIQPSVPELSLVLD 432          
BLAST of SMED30003876 vs. Ensembl Human
Match: STIL (STIL centriolar assembly protein [Source:HGNC Symbol;Acc:HGNC:10879])

HSP 1 Score: 93.9745 bits (232), Expect = 1.191e-18
Identity = 100/422 (23.70%), Postives = 186/422 (44.08%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNY-QSHNKFEIIIDRI-------EC----NLASYLSDNLLIC---SDDICIPLKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCPNFN--WIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQL-YSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSEEKDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSFVTKLSLAKAND--------------KALTTLLQAFKQYISEHCSNLLNNDFIPRQINDHRQVNMN-DFTGLEVPDVSLLIN 1217
            LW+     + + +     +   ++++ + ++LA ++  Q  +N  SC L+G     +      + +DR        EC      AS   D L+ C   + ++C       S+  +++S DD+  ++K +  H+  + S L   K++SLR++    +S L    F+  W  + L     +   +P+  I +  +AL  +L   L  S  +  + YGYLTMD + KL  LL SD +V   PLVG+W+ G +H     V+  C+++I       ++      F++V ++    EP ++Y+  +P       D  +    F+L +  + L+  FK+ +    N    +LS    N               K  +  L + K  I +H S + + DF PR I     V+         VP++SL+++
Sbjct:   33 LWNPTPTGDFIYLHLSYYRNPKLVVTEKTIRLAYRHAKQNKKNS-SCFLLGSLTADEDEEGVTLTVDRFDPGREVPECLEITPTASLPGDFLIPCKVHTQELC-------SREMIVHSVDDFSSALKALQCHICSKDS-LDCGKLLSLRVHITSRES-LDSVEFDLHWAAVTLAN---NFKCTPVKPIPIIPTALARNLSSNLNISQVQGTYKYGYLTMDETRKLLLLLESDPKVYSLPLVGIWLSGITHIYSPQVWACCLRYIFNSSVQERVFSESGNFIIVLYSMTHKEP-EFYEC-FPC------DGKIPDFRFQLLTSKETLH-LFKNVEPPDKNPIRCELSAESQNAETEFFSKASKNFSIKRSSQKLSSGKMPIHDHDSGVEDEDFSPRPIPSPHPVSQKISKIQPSVPELSLVLD 432          
BLAST of SMED30003876 vs. Ensembl Human
Match: STIL (STIL centriolar assembly protein [Source:HGNC Symbol;Acc:HGNC:10879])

HSP 1 Score: 67.0106 bits (162), Expect = 1.639e-10
Identity = 90/420 (21.43%), Postives = 164/420 (39.05%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNY-QSHNKFEIIIDRI-------EC----NLASYLSDNLLIC---SDDICIPLKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCPNFNWIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQL-YSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSEEKDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSFVTKLSLAKAND--------------KALTTLLQAFKQYISEHCSNLLNNDFIPRQINDHRQVNMN-DFTGLEVPDVSLLIN 1217
            LW+     + + +     +   ++++ + ++LA ++  Q  +N  SC L+G     +      + +DR        EC      AS   D L+ C   + ++C       S+  +++S DD+  ++K +  H+  + S                    L C                              AL  +L   L  S  +  + YGYLTMD + KL  LL SD +V   PLVG+W+ G +H     V+  C+++I       ++      F++V ++    EP ++Y+  +P       D  +    F+L +  + L+  FK+ +    N    +LS    N               K  +  L + K  I +H S + + DF PR I     V+         VP++SL+++
Sbjct:   33 LWNPTPTGDFIYLHLSYYRNPKLVVTEKTIRLAYRHAKQNKKNS-SCFLLGSLTADEDEEGVTLTVDRFDPGREVPECLEITPTASLPGDFLIPCKVHTQELC-------SREMIVHSVDDFSSALKALQCHICSKDS--------------------LDC------------------------------ALARNLSSNLNISQVQGTYKYGYLTMDETRKLLLLLESDPKVYSLPLVGIWLSGITHIYSPQVWACCLRYIFNSSVQERVFSESGNFIIVLYSMTHKEP-EFYEC-FPC------DGKIPDFRFQLLTSKETLH-LFKNVEPPDKNPIRCELSAESQNAETEFFSKASKNFSIKRSSQKLSSGKMPIHDHDSGVEDEDFSPRPIPSPHPVSQKISKIQPSVPELSLVLD 385          
BLAST of SMED30003876 vs. Ensembl Human
Match: STIL (STIL centriolar assembly protein [Source:HGNC Symbol;Acc:HGNC:10879])

HSP 1 Score: 66.6254 bits (161), Expect = 2.491e-10
Identity = 90/420 (21.43%), Postives = 164/420 (39.05%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNY-QSHNKFEIIIDRI-------EC----NLASYLSDNLLIC---SDDICIPLKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCPNFNWIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQL-YSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSEEKDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSFVTKLSLAKAND--------------KALTTLLQAFKQYISEHCSNLLNNDFIPRQINDHRQVNMN-DFTGLEVPDVSLLIN 1217
            LW+     + + +     +   ++++ + ++LA ++  Q  +N  SC L+G     +      + +DR        EC      AS   D L+ C   + ++C       S+  +++S DD+  ++K +  H+  + S                    L C                              AL  +L   L  S  +  + YGYLTMD + KL  LL SD +V   PLVG+W+ G +H     V+  C+++I       ++      F++V ++    EP ++Y+  +P       D  +    F+L +  + L+  FK+ +    N    +LS    N               K  +  L + K  I +H S + + DF PR I     V+         VP++SL+++
Sbjct:   33 LWNPTPTGDFIYLHLSYYRNPKLVVTEKTIRLAYRHAKQNKKNS-SCFLLGSLTADEDEEGVTLTVDRFDPGREVPECLEITPTASLPGDFLIPCKVHTQELC-------SREMIVHSVDDFSSALKALQCHICSKDS--------------------LDC------------------------------ALARNLSSNLNISQVQGTYKYGYLTMDETRKLLLLLESDPKVYSLPLVGIWLSGITHIYSPQVWACCLRYIFNSSVQERVFSESGNFIIVLYSMTHKEP-EFYEC-FPC------DGKIPDFRFQLLTSKETLH-LFKNVEPPDKNPIRCELSAESQNAETEFFSKASKNFSIKRSSQKLSSGKMPIHDHDSGVEDEDFSPRPIPSPHPVSQKISKIQPSVPELSLVLD 385          
BLAST of SMED30003876 vs. Ensembl Zebrafish
Match: stil (STIL centriolar assembly protein [Source:NCBI gene;Acc:192317])

HSP 1 Score: 88.9669 bits (219), Expect = 2.568e-17
Identity = 97/415 (23.37%), Postives = 175/415 (42.17%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNYQS-HNKFEIIIDRIECN---LASYLSDNLLICSDDICIP--LKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCP--------NFNWIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQLYSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSE-------EKDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSFVTKLSLAKANDKALTTLLQAF--KQYISEHCSNLLNNDFIPR-QINDHRQVNMNDFTGLEVPDVSLLINDT 1223
            LWD +   E++++ F   +   + +  + L+LA ++  Q ++    C L+G     S      I +DR +               +   DI +P   +   + S  ++S +D  +S K +L+H       L +SK+++LR       ++L C         N +W  + L      L   PI  + +  +AL  +L      T   N   G+LTMD + KL  +L SD +    PLVG+W+ G +H  + LV+  C++++     L+K+      FL+V ++    +P ++Y  K  TG  +        ++S   + N +   G           Q+Q+   F   LS +      L     A   K  IS+H S + + D  PR   N H            VP++S++++ +
Sbjct:   47 LWDPSANGEVVSLHFSYYRNPRLFLVEKALRLAHRHARQTNKPRFFCFLLGTLAVDSDEEGVTITLDRFDPGREQTGCLGKAPTALLPGDILVPCVFEAQHAASSTVHSSEDLNISFK-MLQHFCCSKELLELSKLLTLR-------AQLSCSENMDRLTFNLSWAAVTLA---CTLDAVPIRAVPIIPTALARNLSSPAGVTQ--NSKRGFLTMDQTRKLLLILESDPKAYTLPLVGIWLSGVTHIHNPLVWAWCLRYLHSSSLLDKVLSEGGTFLVVLYSLTHRDP-EFYQCKPSTGQQQLSFQLLTSRESLTLYKNVEPSEGRPLQFELSSENQNQETVLFEEVLSQSVLTGTTLGAASAAPQNKLSISDHDSGVEDEDLSPRPSPNPHPVSQQTKRVHPLVPELSMVLDGS 447          
BLAST of SMED30003876 vs. Ensembl Zebrafish
Match: stil (STIL centriolar assembly protein [Source:NCBI gene;Acc:192317])

HSP 1 Score: 88.1965 bits (217), Expect = 3.797e-17
Identity = 97/415 (23.37%), Postives = 174/415 (41.93%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNYQS-HNKFEIIIDRIECN---LASYLSDNLLICSDDICIP--LKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCP--------NFNWIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQLYSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSE-------EKDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSFVTKLSLAKANDKALTTLLQAF--KQYISEHCSNLLNNDFIPR-QINDHRQVNMNDFTGLEVPDVSLLINDT 1223
            LWD +   E++++ F   +   + +  + L+LA ++  Q ++    C L+G     S      I +DR +               +   DI +P   +   + S  ++S +D  +S K +L+H       L +SK+++LR       ++L C         N +W  + L      L   PI  + +  +AL  +L      T   N   G+LTMD + KL  +L SD +    PLVG+W+ G +H  + LV+  C++++      +K+      FL+V ++    +P ++Y  K  TG  +        +DS   + N +   G           Q+Q+   F   LS +      L     A   K  IS+H S + + D  PR   N H            VP++S++++ +
Sbjct:   47 LWDPSANGEVVSLHFSYYRNPRLFLVEKALRLAHRHARQTNKPRFFCFLLGTLAVDSDEEGVTITLDRFDPGREQTGCLGKAPTALLPGDILVPCVFEAQHAASSTVHSSEDLNISFK-MLQHFCCSKELLELSKLLTLR-------AQLSCSENMDRLTFNLSWAAVTLA---CTLDAVPIRAVPIIPTALARNLSSPAGVTQ--NSKRGFLTMDQTRKLLLILESDPKAYTLPLVGIWLSGVTHIHNPLVWAWCLRYLHSSSLQDKVLSEGGTFLVVLYSLTHRDP-EFYQCKPSTGQQQLSFQLLTSRDSLTLYKNVEPSEGRPLQFELSSENQNQETVLFEEVLSQSVLTGTTLGAASAAPQNKLSISDHDSGVEDEDLSPRPSPNPHPVSQQTKRVHPLVPELSMVLDGS 447          
BLAST of SMED30003876 vs. Ensembl Zebrafish
Match: stil (STIL centriolar assembly protein [Source:NCBI gene;Acc:192317])

HSP 1 Score: 88.1965 bits (217), Expect = 3.797e-17
Identity = 97/415 (23.37%), Postives = 174/415 (41.93%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNYQS-HNKFEIIIDRIECN---LASYLSDNLLICSDDICIP--LKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCP--------NFNWIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQLYSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSE-------EKDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSFVTKLSLAKANDKALTTLLQAF--KQYISEHCSNLLNNDFIPR-QINDHRQVNMNDFTGLEVPDVSLLINDT 1223
            LWD +   E++++ F   +   + +  + L+LA ++  Q ++    C L+G     S      I +DR +               +   DI +P   +   + S  ++S +D  +S K +L+H       L +SK+++LR       ++L C         N +W  + L      L   PI  + +  +AL  +L      T   N   G+LTMD + KL  +L SD +    PLVG+W+ G +H  + LV+  C++++      +K+      FL+V ++    +P ++Y  K  TG  +        +DS   + N +   G           Q+Q+   F   LS +      L     A   K  IS+H S + + D  PR   N H            VP++S++++ +
Sbjct:   47 LWDPSANGEVVSLHFSYYRNPRLFLVEKALRLAHRHARQTNKPRFFCFLLGTLAVDSDEEGVTITLDRFDPGREQTGCLGKAPTALLPGDILVPCVFEAQHAASSTVHSSEDLNISFK-MLQHFCCSKELLELSKLLTLR-------AQLSCSENMDRLTFNLSWAAVTLA---CTLDAVPIRAVPIIPTALARNLSSPAGVTQ--NSKRGFLTMDQTRKLLLILESDPKAYTLPLVGIWLSGVTHIHNPLVWAWCLRYLHSSSLQDKVLSEGGTFLVVLYSLTHRDP-EFYQCKPSTGQQQLSFQLLTSRDSLTLYKNVEPSEGRPLQFELSSENQNQETVLFEEVLSQSVLTGTTLGAASAAPQNKLSISDHDSGVEDEDLSPRPSPNPHPVSQQTKRVHPLVPELSMVLDGS 447          
BLAST of SMED30003876 vs. Ensembl Zebrafish
Match: stil (STIL centriolar assembly protein [Source:NCBI gene;Acc:192317])

HSP 1 Score: 88.1965 bits (217), Expect = 3.797e-17
Identity = 97/415 (23.37%), Postives = 174/415 (41.93%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNYQS-HNKFEIIIDRIECN---LASYLSDNLLICSDDICIP--LKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCP--------NFNWIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQLYSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSE-------EKDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSFVTKLSLAKANDKALTTLLQAF--KQYISEHCSNLLNNDFIPR-QINDHRQVNMNDFTGLEVPDVSLLINDT 1223
            LWD +   E++++ F   +   + +  + L+LA ++  Q ++    C L+G     S      I +DR +               +   DI +P   +   + S  ++S +D  +S K +L+H       L +SK+++LR       ++L C         N +W  + L      L   PI  + +  +AL  +L      T   N   G+LTMD + KL  +L SD +    PLVG+W+ G +H  + LV+  C++++      +K+      FL+V ++    +P ++Y  K  TG  +        +DS   + N +   G           Q+Q+   F   LS +      L     A   K  IS+H S + + D  PR   N H            VP++S++++ +
Sbjct:   47 LWDPSANGEVVSLHFSYYRNPRLFLVEKALRLAHRHARQTNKPRFFCFLLGTLAVDSDEEGVTITLDRFDPGREQTGCLGKAPTALLPGDILVPCVFEAQHAASSTVHSSEDLNISFK-MLQHFCCSKELLELSKLLTLR-------AQLSCSENMDRLTFNLSWAAVTLA---CTLDAVPIRAVPIIPTALARNLSSPAGVTQ--NSKRGFLTMDQTRKLLLILESDPKAYTLPLVGIWLSGVTHIHNPLVWAWCLRYLHSSSLQDKVLSEGGTFLVVLYSLTHRDP-EFYQCKPSTGQQQLSFQLLTSRDSLTLYKNVEPSEGRPLQFELSSENQNQETVLFEEVLSQSVLTGTTLGAASAAPQNKLSISDHDSGVEDEDLSPRPSPNPHPVSQQTKRVHPLVPELSMVLDGS 447          
BLAST of SMED30003876 vs. Ensembl Zebrafish
Match: stil (STIL centriolar assembly protein [Source:NCBI gene;Acc:192317])

HSP 1 Score: 88.1965 bits (217), Expect = 4.414e-17
Identity = 97/415 (23.37%), Postives = 174/415 (41.93%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNYQS-HNKFEIIIDRIECN---LASYLSDNLLICSDDICIP--LKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCP--------NFNWIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQLYSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSE-------EKDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSFVTKLSLAKANDKALTTLLQAF--KQYISEHCSNLLNNDFIPR-QINDHRQVNMNDFTGLEVPDVSLLINDT 1223
            LWD +   E++++ F   +   + +  + L+LA ++  Q ++    C L+G     S      I +DR +               +   DI +P   +   + S  ++S +D  +S K +L+H       L +SK+++LR       ++L C         N +W  + L      L   PI  + +  +AL  +L      T   N   G+LTMD + KL  +L SD +    PLVG+W+ G +H  + LV+  C++++      +K+      FL+V ++    +P ++Y  K  TG  +        +DS   + N +   G           Q+Q+   F   LS +      L     A   K  IS+H S + + D  PR   N H            VP++S++++ +
Sbjct:   47 LWDPSANGEVVSLHFSYYRNPRLFLVEKALRLAHRHARQTNKPRFFCFLLGTLAVDSDEEGVTITLDRFDPGREQTGCLGKAPTALLPGDILVPCVFEAQHAASSTVHSSEDLNISFK-MLQHFCCSKELLELSKLLTLR-------AQLSCSENMDRLTFNLSWAAVTLA---CTLDAVPIRAVPIIPTALARNLSSPAGVTQ--NSKRGFLTMDQTRKLLLILESDPKAYTLPLVGIWLSGVTHIHNPLVWAWCLRYLHSSSLQDKVLSEGGTFLVVLYSLTHRDP-EFYQCKPSTGQQQLSFQLLTSRDSLTLYKNVEPSEGRPLQFELSSENQNQETVLFEEVLSQSVLTGTTLGAASAAPQNKLSISDHDSGVEDEDLSPRPSPNPHPVSQQTKRVHPLVPELSMVLDGS 447          
BLAST of SMED30003876 vs. Ensembl Xenopus
Match: stil (STIL, centriolar assembly protein [Source:NCBI gene;Acc:100036624])

HSP 1 Score: 80.1073 bits (196), Expect = 1.581e-14
Identity = 65/294 (22.11%), Postives = 135/294 (45.92%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNY-QSHNKFEIIIDRIECNLASYLSDNLLICS----DDICIPLKCFKSKSD---LIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDS--KLHCPNFNWIKLKLIYPDLHLTVSPINKILVFRSALVSSLED-----QLYSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYD 887
            LWD   + + + +     +   +L+S + L+L+ ++  +  +   SC L+G  +  +      +IIDR +            + +     D  +P      K     ++++ +D+  S   +  HL  + + L +SK++++R +  + ++   LH  +  W  + +         +PI  + +  +AL  +L       QL  T+++    GYLTMD + KL  +L SD +V + PLVG+W+ G +H     V+  C+++I       ++      FL+V ++    EP ++Y+
Sbjct:   46 LWDTAPMGDGIGLHVSYYRNPRLLVSEKALRLSYRHA-KTGRKPFSCFLLGTFSVDEDEEGVTLIIDRFDPGREKTGGGGGKVPTAQLPGDFVLPCTITLGKGSNNVIVHTPEDFTSSFMSLESHLHSKEA-LDLSKLLTMRAHITYTENMDNLHF-DLRWAAVVVAN---TFESTPIKPVPIIPTALARNLGSHNNIAQLQGTHKS----GYLTMDQTRKLLLVLESDPKVYMLPLVGIWLSGVTHIHSPQVWAACLRYIFSSSIHERVLSESGSFLIVLYSLTHKEP-EFYE 328          
BLAST of SMED30003876 vs. Ensembl Mouse
Match: Stil (Scl/Tal1 interrupting locus [Source:MGI Symbol;Acc:MGI:107477])

HSP 1 Score: 82.4185 bits (202), Expect = 2.314e-15
Identity = 98/422 (23.22%), Postives = 187/422 (44.31%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNY-QSHNKFEIIIDRI-------EC----NLASYLSDNLLICSDDICIPLKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCPNFN--WIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQL-YSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSEEKDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSFVTKLSL----AKANDKALTTL------------LQAFKQYISEHCSNLLNNDFIPRQINDHRQVNMN-DFTGLEVPDVSLLIND 1220
            LW+   I E + +     ++  ++++ + ++LA ++  Q  +N V C L+G     +      + IDR        EC      AS   D L+ C     + ++   S+  ++++ DD+  ++K +  H+  +   L   K++ LR      +S L   +FN  W  + L          P+  I +  +AL  +L   L  S  +  + +GY+TMD + KL  LL SD +V   PLVG+W+ G  H     V+  C++++       ++      F++V ++    EP ++Y+      P E +   L+   F+L +  + L+  F + +    N    +LS     A+A  + L+ +            L   K  I++H ++L + DF PR I     V+         VP++SL++++
Sbjct:   22 LWNPMPIGECIYLHLSYYRKPKLMVTEKAIRLAYRHAKQNKKN-VPCFLLGSLTVDEDEEGVTLTIDRFDPGREIPECLERTPTASLPGDFLIPCR----VHIQGLGSRDVIVHNADDFSSALKALQYHVCSKDF-LDCGKLLCLRAQITPRES-LDGVDFNLQWTAVTLAN---SFKCVPVKPIPIIPTALARNLSSNLNISQVQGTYKHGYITMDETRKLLLLLQSDPKVSSLPLVGIWLAGIIHVYSPQVWACCLRYMFSSSIQERVFSESGNFIIVLYSLTHKEP-EFYECL----PCESRTPDLQ---FQLLTNKETLH-LFNNVEPSGKNPIHFELSAESQDAEAEAEVLSKISKTLPVKRSSQKLSPGKIPINKHDTDLEDEDFSPRPIPSPHPVSQKISKVQPSVPELSLVLDN 424          
BLAST of SMED30003876 vs. Ensembl Mouse
Match: Stil (Scl/Tal1 interrupting locus [Source:MGI Symbol;Acc:MGI:107477])

HSP 1 Score: 81.6481 bits (200), Expect = 2.816e-15
Identity = 93/396 (23.48%), Postives = 175/396 (44.19%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNY-QSHNKFEIIIDRI-------EC----NLASYLSDNLLICSDDICIPLKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCPNFN--WIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQL-YSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSEEKDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSFVTKLSL----AKANDKALTTL------------LQAFKQYISEHCSNLLNNDFIPRQI 1145
            LW+   I E + +     ++  ++++ + ++LA ++  Q  +N V C L+G     +      + IDR        EC      AS   D L+ C     + ++   S+  ++++ DD+  ++K +  H+  +   L   K++ LR      +S L   +FN  W  + L          P+  I +  +AL  +L   L  S  +  + +GY+TMD + KL  LL SD +V   PLVG+W+ G  H     V+  C++++       ++      F++V ++    EP ++Y+      P E +   L+   F+L +  + L+  F + +    N    +LS     A+A  + L+ +            L   K  I++H ++L + DF PR I
Sbjct:   22 LWNPMPIGECIYLHLSYYRKPKLMVTEKAIRLAYRHAKQNKKN-VPCFLLGSLTVDEDEEGVTLTIDRFDPGREIPECLERTPTASLPGDFLIPCR----VHIQGLGSRDVIVHNADDFSSALKALQYHVCSKDF-LDCGKLLCLRAQITPRES-LDGVDFNLQWTAVTLAN---SFKCVPVKPIPIIPTALARNLSSNLNISQVQGTYKHGYITMDETRKLLLLLQSDPKVSSLPLVGIWLAGIIHVYSPQVWACCLRYMFSSSIQERVFSESGNFIIVLYSLTHKEP-EFYECL----PCESRTPDLQ---FQLLTNKETLH-LFNNVEPSGKNPIHFELSAESQDAEAEAEVLSKISKTLPVKRSSQKLSPGKIPINKHDTDLEDEDFSPRPI 398          
BLAST of SMED30003876 vs. Ensembl Mouse
Match: Stil (Scl/Tal1 interrupting locus [Source:MGI Symbol;Acc:MGI:107477])

HSP 1 Score: 78.5666 bits (192), Expect = 1.067e-14
Identity = 74/311 (23.79%), Postives = 140/311 (45.02%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNY-QSHNKFEIIIDRI-------EC----NLASYLSDNLLICSDDICIPLKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCPNFN--WIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQL-YSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSEEKDSFLKF 938
            LW+   I E + +     ++  ++++ + ++LA ++  Q  +N V C L+G     +      + IDR        EC      AS   D L+ C     + ++   S+  ++++ DD+  ++K +  H+  +   L   K++ LR      +S L   +FN  W  + L          P+  I +  +AL  +L   L  S  +  + +GY+TMD + KL  LL SD +V   PLVG+W+ G  H     V+  C++++       ++      F++V ++    EP ++Y+      P E +   L+F
Sbjct:   22 LWNPMPIGECIYLHLSYYRKPKLMVTEKAIRLAYRHAKQNKKN-VPCFLLGSLTVDEDEEGVTLTIDRFDPGREIPECLERTPTASLPGDFLIPCR----VHIQGLGSRDVIVHNADDFSSALKALQYHVCSKDF-LDCGKLLCLRAQITPRES-LDGVDFNLQWTAVTLAN---SFKCVPVKPIPIIPTALARNLSSNLNISQVQGTYKHGYITMDETRKLLLLLQSDPKVSSLPLVGIWLAGIIHVYSPQVWACCLRYMFSSSIQERVFSESGNFIIVLYSLTHKEP-EFYECL----PCESRTPDLQF 317          
BLAST of SMED30003876 vs. UniProt/SwissProt
Match: sp|Q15468|STIL_HUMAN (SCL-interrupting locus protein OS=Homo sapiens OX=9606 GN=STIL PE=1 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 5.560e-18
Identity = 100/422 (23.70%), Postives = 186/422 (44.08%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNY-QSHNKFEIIIDRI-------EC----NLASYLSDNLLIC---SDDICIPLKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCPNFN--WIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQL-YSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSEEKDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSFVTKLSLAKAND--------------KALTTLLQAFKQYISEHCSNLLNNDFIPRQINDHRQVNMN-DFTGLEVPDVSLLIN 1217
            LW+     + + +     +   ++++ + ++LA ++  Q  +N  SC L+G     +      + +DR        EC      AS   D L+ C   + ++C       S+  +++S DD+  ++K +  H+  + S L   K++SLR++    +S L    F+  W  + L     +   +P+  I +  +AL  +L   L  S  +  + YGYLTMD + KL  LL SD +V   PLVG+W+ G +H     V+  C+++I       ++      F++V ++    EP ++Y+  +P       D  +    F+L +  + L+  FK+ +    N    +LS    N               K  +  L + K  I +H S + + DF PR I     V+         VP++SL+++
Sbjct:   33 LWNPTPTGDFIYLHLSYYRNPKLVVTEKTIRLAYRHAKQNKKNS-SCFLLGSLTADEDEEGVTLTVDRFDPGREVPECLEITPTASLPGDFLIPCKVHTQELC-------SREMIVHSVDDFSSALKALQCHICSKDS-LDCGKLLSLRVHITSRES-LDSVEFDLHWAAVTLAN---NFKCTPVKPIPIIPTALARNLSSNLNISQVQGTYKYGYLTMDETRKLLLLLESDPKVYSLPLVGIWLSGITHIYSPQVWACCLRYIFNSSVQERVFSESGNFIIVLYSMTHKEP-EFYEC-FPC------DGKIPDFRFQLLTSKETLH-LFKNVEPPDKNPIRCELSAESQNAETEFFSKASKNFSIKRSSQKLSSGKMPIHDHDSGVEDEDFSPRPIPSPHPVSQKISKIQPSVPELSLVLD 432          
BLAST of SMED30003876 vs. UniProt/SwissProt
Match: sp|Q8JGS1|STIL_DANRE (SCL-interrupting locus protein homolog OS=Danio rerio OX=7955 GN=stil PE=1 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 2.867e-16
Identity = 97/415 (23.37%), Postives = 174/415 (41.93%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNYQS-HNKFEIIIDRIECN---LASYLSDNLLICSDDICIP--LKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCP--------NFNWIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQLYSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSE-------EKDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSFVTKLSLAKANDKALTTLLQAF--KQYISEHCSNLLNNDFIPR-QINDHRQVNMNDFTGLEVPDVSLLINDT 1223
            LWD +   E++++ F   +   + +  + L+LA ++  Q ++    C L+G     S      I +DR +               +   DI +P   +   + S  ++S +D  +S K +L+H       L +SK+++LR       ++L C         N +W  + L      L   PI  + +  +AL  +L      T   N   G+LTMD + KL  +L SD +    PLVG+W+ G +H  + LV+  C++++      +K+      FL+V ++    +P ++Y  K  TG  +        +DS   + N +   G           Q+Q+   F   LS +      L     A   K  IS+H S + + D  PR   N H            VP++S++++ +
Sbjct:   47 LWDPSANGEVVSLHFSYYRNPRLFLVEKALRLAHRHARQTNKPRFFCFLLGTLAVDSDEEGVTITLDRFDPGREQTGCLGKAPTALLPGDILVPCVFEAQHAASSTVHSSEDLNISFK-MLQHFCCSKELLELSKLLTLR-------AQLSCSENMDRLTFNLSWAAVTLA---CTLDAVPIRAVPIIPTALARNLSSPAGVTQ--NSKRGFLTMDQTRKLLLILESDPKAYTLPLVGIWLSGVTHIHNPLVWAWCLRYLHSSSLQDKVLSEGGTFLVVLYSLTHRDP-EFYQCKPSTGQQQLSFQLLTSRDSLTLYKNVEPSEGRPLQFELSSENQNQETVLFEEVLSQSVLTGTTLGAASAAPQNKLSISDHDSGVEDEDLSPRPSPNPHPVSQQTKRVHPLVPELSMVLDGS 447          
BLAST of SMED30003876 vs. UniProt/SwissProt
Match: sp|Q4V7H1|STIL_XENLA (SCL-interrupting locus protein homolog OS=Xenopus laevis OX=8355 GN=stil PE=2 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 1.945e-14
Identity = 64/294 (21.77%), Postives = 137/294 (46.60%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNY-QSHNKFEIIIDRIECNLASYLSDNLLICS----DDICIPLKCFKSKSD---LIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDS--KLHCPNFNWIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQ-----LYSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYD 887
            LWD   + +   + F   +   +L+S + L+L+S++  +  +   SC L+G  +  +      + +DR +       S +  + +     D  IP      K     ++++ +D+  S   +  HL  + + L ++K++++R +  + ++   LH  + +W  + +         +PI  + +  +AL  +L        L  T+++    GYLTMD + KL  +L SD +V + PLVG+W+ G +H     V+  C+++I       ++      FL++ ++    EP ++Y+
Sbjct:   46 LWDPAPMGDPFGLHFSYYRNPRLLVSEKALRLSSRHA-KTGRKPFSCFLLGTFSVDEDEEGVTLTVDRFDPGREKTGSGSSKVPTAQLPGDFIIPCTISIGKGSNNVIVHTPEDFTSSFMSLQSHLHGKEA-LDLAKLLAMRAHITYTENMDNLHF-DLHWAAVTVAN---TFESTPIKPVPIIPTALARNLGSHNNIAHLQGTHKS----GYLTMDQTRKLLLVLESDPKVYMLPLVGIWLSGITHIHSPQVWAACLRYIFSSSIHERVLSESGSFLIILYSLTHKEP-EFYE 328          
BLAST of SMED30003876 vs. UniProt/SwissProt
Match: sp|Q60988|STIL_MOUSE (SCL-interrupting locus protein homolog OS=Mus musculus OX=10090 GN=Stil PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.088e-14
Identity = 95/422 (22.51%), Postives = 184/422 (43.60%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNY-QSHNKFEIIIDRI-------EC----NLASYLSDNLLICSDDICIPLKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCPNFN--WIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQL-YSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSEEKDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSFVTKLSLAKANDKALTTLLQAFKQY----------------ISEHCSNLLNNDFIPRQINDHRQVNMN-DFTGLEVPDVSLLIND 1220
            LW+   I E + +     ++  ++++ + ++LA ++  Q  +N V C L+G     +      + IDR        EC      AS   D L+ C     + ++   S+  ++++ DD+  ++K +  H+  +   L   K++ LR      +S L   +FN  W  + L          P+  I +  +AL  +L   L  S  +  + +GY+TMD + KL  LL SD +V   PLVG+W+ G  H     V+  C++++       ++      F++V ++    EP ++Y+      P E +   L+   F+L +  + L+  F + +    N    +LS    + +A   +L    +                 I++H ++L + DF PR I     V+         VP++SL++++
Sbjct:   22 LWNPMPIGECIYLHLSYYRKPKLMVTEKAIRLAYRHAKQNKKN-VPCFLLGSLTVDEDEEGVTLTIDRFDPGREIPECLERTPTASLPGDFLIPCR----VHIQGLGSRDVIVHNADDFSSALKALQYHVCSKDF-LDCGKLLCLRAQITPRES-LDGVDFNLQWTAVTLAN---SFKCVPVKPIPIIPTALARNLSSNLNISQVQGTYKHGYITMDETRKLLLLLQSDPKVSSLPLVGIWLAGIIHVYSPQVWACCLRYMFSSSIQERVFSESGNFIIVLYSLTHKEP-EFYECL----PCESRTPDLQ---FQLLTNKETLH-LFNNVEPSGKNPIHFELSAESQDAEAEAEVLSKISKTLPVKRSSQKVSPGKIPINKHDTDLEDEDFSPRPIPSPHPVSQKISKVQPSVPELSLVLDN 424          
BLAST of SMED30003876 vs. TrEMBL
Match: A0A4W5P6A8 (Scl/tal1 interrupting locus OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 7.205e-19
Identity = 101/415 (24.34%), Postives = 198/415 (47.71%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNYQS-HNKFEIIIDRIECNLASYLSDNLL---ICSDDICIPLKCFKSKS-----DLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFN---DSKLHCPNFNWIKLKLIYPDLHLTVSPINKILVFRSALV------SSLEDQLYSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSEEKDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSFVTKLSLAKANDKA--LTTLLQAFKQYISEHCSNLLNNDFIPR-QINDH---RQVNMNDFTGLEVPDVSLLINDT 1223
            LWD     +++++     +   +L+  +V++LA ++  + ++   SC L+G  +  S      + +DR +       S   +   +   DI + L  F ++       +++S +D+ +S K +L+H       L +SK++ LR + G +   DS   C     ++   + P   L   PI  +L+  +AL       +SL   L+S+  A+   G+LTMD S KL  +L SD      PLVG+W+ G +H S+ LV+  C++++      +K+      FL+V ++    EP ++Y ++  +G  +++D     + F+L +  + L  Y K+ +    ++   +LS    N +A     L+   +  I++H S + + D  PR   N H   +QV+        VP++SL+++ +
Sbjct:   22 LWDPTPNGDVISLHLSYYRNPRLLLVEKVIRLAHRHSRESNKPQFSCYLLGTISVDSDEEGVTLTLDRFDLGREQPGSSEKVPTALVPGDILV-LCVFGTQGVAAADTMVHSAEDFHISFK-MLQHCCSTRESLDLSKLLVLRAHLGCSQQADSLGFC-----LRWAAVTPGNTLDAVPIRPVLIIPTALARNLSGPTSLTQPLHSS--ASHKRGFLTMDQSRKLLLILESDPMAYTLPLVGLWLSGVNHISNPLVWAWCLRYLFSSSLQDKVTSEGGAFLVVLYSLTHREP-EFYQVQPCSG--QQQD-----MTFQLLTSTESLTLY-KNVEVSDGHTLQFELSAESQNSEAEFFRELVSRNRLSINDHDSGVEDEDLSPRPSPNPHPLTQQVSSTKRVHPSVPELSLVMDGS 418          
BLAST of SMED30003876 vs. TrEMBL
Match: A0A210QBV6 (SCL-interrupting locus protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08135 PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 2.241e-18
Identity = 91/412 (22.09%), Postives = 181/412 (43.93%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNY-QSHNKFEIIIDRIECNLASYLSDNLLICSDDICIPLKCFK-SKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGF---NDSKLHCPNFNWIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQLYSTN-EANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSEEKDSFLKFINFKLQSGID----------------DLNRYFKSTQDQKINSFVTKLSLAKANDKALTTLLQAFKQYISEHCSNLLNNDFIPRQINDHRQVNMNDFTGLEVPDVSLLIND 1220
            LWDH  I+  + +     ++  + +  +V++ A +++    Q    C L+G  +  +     +  +DR +       S    +   D+ +PL+    +K +   S DDY + + ++LK        L +  ++ ++ +  F    D  +H   F+ I +   +        PI  + +  +AL  +L   +  ++ +     GYLTMDH+ K+  +L SD +V   PLVG+WV G S      V+  C++++      ++IC PP PFLLV ++   ++P ++Y+I   +G S+        ++F L +G +                DLN      + +  +  + + S + ++DK  +T             S  ++++  PR I    +  +     + VP+VSLL  +
Sbjct:   61 LWDHKCIDTPVQLHISYYRKPKLCVLERVIRFAQRHLQSTGQQECLCSLVGSLSIDEDGEGVKFTLDRFDPG-GGLTSSVGALTPGDMAVPLQIMGNTKKERESSIDDYLIGL-QVLKQRCCAKESLDVGSLLLVKGWCNFYSTGDKSVHHLEFDIITMGTEF-----KAVPITPVPIVPTALSKNLSGPMSLSHLQGEPKTGYLTMDHTRKVLLVLESDPKVFNLPLVGIWVSGVSFVYSPFVWAACLRYLHNSSITDRICSPPEPFLLVLYSPVHSKP-EFYEISTASGTSK--------MDFDLLTGYEVISISKSNNPNATFDVDLNSVKTGHKRELFDGALHRFSESSSSDKPAST-------------SAPVSDEITPRNIPAPHRSKLPAMMSM-VPEVSLLFGE 442          
BLAST of SMED30003876 vs. TrEMBL
Match: A0A1S3JVN6 (SCL-interrupting locus protein homolog OS=Lingula unguis OX=7574 GN=LOC106176550 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.788e-18
Identity = 91/404 (22.52%), Postives = 167/404 (41.34%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNYQSHNKFEIIIDRIECNLASYLS-DNLLICSDDICIPLKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVI----SLRIYAGFNDSKLHCPNFNWIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQL-YSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSEEKDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSFVTKLSLAKANDKALTTLLQAFKQYISEHCSNLLNNDFI--------PRQINDHRQVNMNDFTGLEVPDVSLLIND 1220
            LWDH      + I     +   ++ISS+ L+LA +     S+    C+L G  +  +       ++R +       S       + DI +PL   KS S    S DDY  ++ ++L+H       + + + +    SL       + +++    + + L       HL  +P+  + +  +AL  +L      S  +     GYLTMDH+ KL  +L SD +V   PLVG+W+ G     +  V+  C++++       ++CKPP PFLLV ++   ++P ++Y++    G           + F+L S + +++     + +  ++  + K+     N   +     A +Q     C      D +        PR                 VPDVSL+ +D
Sbjct:   26 LWDHTSTGPAVVIHMTYYRDIRLIISSKALQLARRCAADSSKMEFLCLLQGSLSVDTDGGITANLERFDMGKMEQGSLSPTSTMAGDITVPLIVMKSGSKPQLSSDDYFKAL-QMLQHTVTSGCKIQLDQYVVAFASLVPKPSTRNGEVYDMGISVVSL-----SNHLKATPVKNVPIVPTALSKNLAGPASLSDMQGEPKAGYLTMDHTRKLLLILESDPKVYTLPLVGIWLSGIPLVYNPFVWAACLRYLHNAHIQERVCKPPEPFLLVLYSPLHSQP-EFYEVTAVNGGGR--------LTFQLYSAVQNIDLSKTGSSEAVVDVDLCKVQGGGQN---MEVFQAAVQQLTETRCETPKAKDHVIVTVEDSTPRATPSPHTAKTTSIQ-PSVPDVSLIFDD 410          
BLAST of SMED30003876 vs. TrEMBL
Match: A0A0L8I3H6 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22036562mg PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 2.165e-16
Identity = 106/421 (25.18%), Postives = 187/421 (44.42%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNYQSHN---KFEIIIDRIEC-NLASYLSDNLLICSDDICIPLKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGF-----NDSKLHCPNFNWIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQL-YSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLN-KICKPPFPFLLVRF--TGNKNEPLKYYDIKW--PTGPSEEKDSFLKFINFKL---QSGID-DLNRYFKSTQDQKINSFVTKLSLAKANDKALTTLLQAFKQYISEHCSNLLNNDFIPRQINDHRQVNMNDFTGLEVPDVSLLINDTSSISTLKNFHN 1256
            LWD       +N+     ++F + +SS+ L +    +  CS  + + +L+      S N   KF I++D ++  NL S  ++  L  S  +    KC        +  +DY  ++K +L     + S + I    S  +   F     N S  +C     ++  +          PIN + +  +AL  +L   +  S  +     GY+TMDH+ KL  +L SD +V   PL+G+WV G     +  V+ +C+++ L   SLN ++C PP  F+L+ +   GNK   +++Y+         + E D+F      +L   Q G++ DL+      +  +I+S       A+ NDK+ +    +            +N++ IPR I    Q  + +     VP+VSL+ NDTS  S  +  H+
Sbjct:   17 LWDRASQGPAVNVDISSFRKFQICLSSKALYI---LLQHCSGLVENQLLLLSGYIHSDNDGSKFSILVDPLDVSNLTSERNEKSLQISVLVSKSNKCG-------FIPEDYNRAVKNVLTRCGSKDS-IGIGSFFS--VLGKFFVQTENGSSAYC-----VEFDVFTSAAKFEAVPINPVTIMTTALAKNLASPMSLSRLQGKAKSGYVTMDHTRKLVLMLESDPKVSTLPLIGIWVSGVDCVKNPYVWASCLRY-LYNNSLNQRVCLPPHRFMLLLYCLQGNK---IEFYECGLLNEKEKTHEMDAFCGSKTVRLDFDQDGLEVDLSLLKYGIKKNRIDSVA-----ARVNDKSKSKPSSS-----------CVNDEIIPRTIPTPHQSKIPE-ARFSVPEVSLIFNDTSQASLQRKCHD 398          
BLAST of SMED30003876 vs. TrEMBL
Match: A0A4W5RVW7 (Scl/tal1 interrupting locus OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 3.216e-16
Identity = 91/417 (21.82%), Postives = 180/417 (43.17%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNYQS-HNKFEIIIDRIECNLASYLSDNLL---ICSDDICIP----LKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIY---AGFNDSKLHCPNFNWIKLKLIYPDLHLTVSPINKILVFRSALV------SSLEDQLYSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSEE--------KDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSFVTKLSLAKANDKALTTLLQAFKQYISEHCSNLLNNDFIPR-QINDHRQVNMNDFTGLEVPDVSLLINDT 1223
            LWD     +++++     +   +L+  + L+LA ++  Q ++   SC L+G     S      + +DR +       S   +   +   D+ +P     +   +   +++S + + +S K +L+H       L +SK+++LR +   +   DS   C     ++     P   L   P+  + +  +AL       +SL   L+S+  A+   G+LTMD + KL  LL SD +    PLVGVW+ G +H  +  V+  C++++      +K+      FL+V ++    EP ++Y ++  +G  ++         +S   + N ++  G          TQ+++   F   +S       A        +  IS+H S + + D  PR   N H            VP++SL+++ +
Sbjct:   56 LWDPRPNGDVVSLHLSYYRNPRLLLVEKTLRLAHRHARQSNKPEFSCYLLGTIAVDSDEEGVTLTLDRFDPGRGQPGSSGKVPTALMPGDVLVPCVLETQGVSATDTMVHSAEGFHISFK-MLQHCCSSRESLDLSKLLALRAHLSCSQQGDSLGFC-----LRWAATTPGNTLDAVPVRPVPIIPTALARNLSSPASLTQPLHSS--ASRKQGFLTMDQTRKLLLLLESDPKAYTLPLVGVWLSGVTHIYNPQVWAWCLRYLFSSSLHDKVMSEGGAFLVVLYSLTHREP-EFYQVQPCSGQQQDMTFQLLTSTESLTLYKNVEVSEGRTLKFELSAETQNREAEFFRELVSRVSLTSPASVAASPQDRLSISDHDSGVEDEDLSPRPSPNPHPLTQQTKQIHPSVPELSLVMDGS 463          
BLAST of SMED30003876 vs. Ensembl Cavefish
Match: stil (STIL centriolar assembly protein [Source:NCBI gene;Acc:103039161])

HSP 1 Score: 79.337 bits (194), Expect = 1.833e-14
Identity = 95/420 (22.62%), Postives = 173/420 (41.19%), Query Frame = 3
Query:   48 YLWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNYQS-HNKFEIIIDRIECNLASYLSDN---LLICSDDICIPLKCFKSKS---DLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCP--------NFNWIKLKLIYPDLHLTVSPINKILVFRSAL---VSSLEDQLYSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSE-------EKDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSF--VTKLSLAKANDKALTTLLQAFKQYISEHCSNLLNNDFIPR-QINDHRQVNMNDFTGLEVPDVSLLINDT 1223
            +LWD     +++++     +   +L+  + L+LA ++  Q      SC  IG            + +DR +               +   D+ +P   F++++     +YS DD+ +S K +L+H       L +SK++ LR       ++L C           NW  L L      L   P+  + +  +AL   +SSL       + A    G+LTMD + KL  +L SD +V   PLVGVW+ G +H  + LV+  C++++      +++      FL+V ++    EP ++Y  K   G  +         ++   + N +   G   L       Q ++   F  V   S    N +A ++     K   S+H S + + D  PR   N H            VP++S++ + +
Sbjct:   46 HLWDPTPNGDLVHVHLSLYRNPRLLLLEKALRLAHRHARQSKMLQFSCFFIGTLAVDGDEEGVTLTLDRFDPGREQPGCPGKAPTALLPGDVLVPC-LFEAQTVADSTVYSADDFDVSFK-MLQHCCSSRETLELSKLLGLR-------ARLSCLENMDRLSFGLNWAGLTLAN---SLEAVPVRAVPIIPTALARNLSSLVSIAQPLHSAGRKRGFLTMDQTRKLLLILESDPKVYTLPLVGVWLSGVTHIHNPLVWAWCLRYLYSSSLQDRVMSENDAFLVVLYSLTHREP-EFYQCKLRGGMMDMSFHLLTSTETVTLYKNVEPSEGRSLLFELGTDHQSREAELFKEVLSRSAQPRNTRAASSATAQNKLSSSDHDSGVEDEDLSPRPSPNPHPVSQQARQVHPSVPELSMVADGS 452          
BLAST of SMED30003876 vs. Ensembl Cavefish
Match: stil (STIL centriolar assembly protein [Source:NCBI gene;Acc:103039161])

HSP 1 Score: 78.9518 bits (193), Expect = 2.221e-14
Identity = 95/420 (22.62%), Postives = 173/420 (41.19%), Query Frame = 3
Query:   48 YLWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNYQS-HNKFEIIIDRIECNLASYLSDN---LLICSDDICIPLKCFKSKS---DLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCP--------NFNWIKLKLIYPDLHLTVSPINKILVFRSAL---VSSLEDQLYSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSE-------EKDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSF--VTKLSLAKANDKALTTLLQAFKQYISEHCSNLLNNDFIPR-QINDHRQVNMNDFTGLEVPDVSLLINDT 1223
            +LWD     +++++     +   +L+  + L+LA ++  Q      SC  IG            + +DR +               +   D+ +P   F++++     +YS DD+ +S K +L+H       L +SK++ LR       ++L C           NW  L L      L   P+  + +  +AL   +SSL       + A    G+LTMD + KL  +L SD +V   PLVGVW+ G +H  + LV+  C++++      +++      FL+V ++    EP ++Y  K   G  +         ++   + N +   G   L       Q ++   F  V   S    N +A ++     K   S+H S + + D  PR   N H            VP++S++ + +
Sbjct:    2 HLWDPTPNGDLVHVHLSLYRNPRLLLLEKALRLAHRHARQSKMLQFSCFFIGTLAVDGDEEGVTLTLDRFDPGREQPGCPGKAPTALLPGDVLVPC-LFEAQTVADSTVYSADDFDVSFK-MLQHCCSSRETLELSKLLGLR-------ARLSCLENMDRLSFGLNWAGLTLAN---SLEAVPVRAVPIIPTALARNLSSLVSIAQPLHSAGRKRGFLTMDQTRKLLLILESDPKVYTLPLVGVWLSGVTHIHNPLVWAWCLRYLYSSSLQDRVMSENDAFLVVLYSLTHREP-EFYQCKLRGGMMDMSFHLLTSTETVTLYKNVEPSEGRSLLFELGTDHQSREAELFKEVLSRSAQPRNTRAASSATAQNKLSSSDHDSGVEDEDLSPRPSPNPHPVSQQARQVHPSVPELSMVADGS 408          
BLAST of SMED30003876 vs. Ensembl Cavefish
Match: stil (STIL centriolar assembly protein [Source:NCBI gene;Acc:103039161])

HSP 1 Score: 78.9518 bits (193), Expect = 2.593e-14
Identity = 78/312 (25.00%), Postives = 133/312 (42.63%), Query Frame = 3
Query:  351 IYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCP--------NFNWIKLKLIYPDLHLTVSPINKILVFRSAL---VSSLEDQLYSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSE-------EKDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSF--VTKLSLAKANDKALTTLLQAFKQYISEHCSNLLNNDFIPR-QINDHRQVNMNDFTGLEVPDVSLLINDT 1223
            +YS DD+ +S K +L+H       L +SK++ LR       ++L C           NW  L L      L   P+  + +  +AL   +SSL       + A    G+LTMD + KL  +L SD +V   PLVGVW+ G +H  + LV+  C++++      +++      FL+V ++    EP ++Y  K   G  +         ++   + N +   G   L       Q ++   F  V   S    N +A ++     K   S+H S + + D  PR   N H            VP++S++ + +
Sbjct:  117 VYSADDFDVSFK-MLQHCCSSRETLELSKLLGLR-------ARLSCLENMDRLSFGLNWAGLTLAN---SLEAVPVRAVPIIPTALARNLSSLVSIAQPLHSAGRKRGFLTMDQTRKLLLILESDPKVYTLPLVGVWLSGVTHIHNPLVWAWCLRYLYSSSLQDRVMSENDAFLVVLYSLTHREP-EFYQCKLRGGMMDMSFHLLTSTETVTLYKNVEPSEGRSLLFELGTDHQSREAELFKEVLSRSAQPRNTRAASSATAQNKLSSSDHDSGVEDEDLSPRPSPNPHPVSQQARQVHPSVPELSMVADGS 416          
BLAST of SMED30003876 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004901.1 (pep scaffold:Pmarinus_7.0:GL476392:242919:257821:-1 gene:ENSPMAG00000004432.1 transcript:ENSPMAT00000004901.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 1.757e-10
Identity = 58/262 (22.14%), Postives = 106/262 (40.46%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNYQS-HNKFEIIIDRIECNL-----------ASYLSDNLLICSDDICIPLKCFKSKSDLIYSEDDYKLSIKEI--LKHLEEESSP--LSISKVISLRIYAGFNDSKLHCPNFNWIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQL-YSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKF 785
            LWD     + + +     +   +LI  + L+LA ++ NQ      S  LIG     +      + +DR +               + L  + LI    +C+      S    ++S DD+  + K +  L    E S P  L +++ +     +G     L       +  + +        +P+  + +  +AL  +L      +  +A    G+LTMD + KL  +L SD +    PLVG+WV G  H ++  V+  C++F
Sbjct:   48 LWDPTPQGKPVCLHMAQFRNPRLLILEKTLRLAHRHANQFGGKPQSAFLIGSLTIDNDEEGITVTVDRFDPGRETPGGPGTVMPTALLPGDFLI---SMCVGPARAGSDKTAMHSRDDFLAAFKSLDKLASSREASDPGRLLLARAVLEGAPSGPGALALSLSLAAVVVARTVL------AAPVRPLPIIPTALARNLAGPASIARVQAACKSGFLTMDQTRKLLLILESDPKAQSLPLVGIWVSGVMHVANPHVWACCLRF 300          
BLAST of SMED30003876 vs. Ensembl Nematostella
Match: EDO33988 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQL9])

HSP 1 Score: 80.8777 bits (198), Expect = 2.209e-15
Identity = 99/431 (22.97%), Postives = 181/431 (42.00%), Query Frame = 3
Query:   51 LWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNYQSHNK-FEIIIDRIE-----------CNLASYLSDNLLICSDDICIPLKCFK----SKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRI----YAGFNDSKLHCPNFNWIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQLY-STNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSEE---------------------KDSFLKFINFKLQSGIDDLNRYFKSTQDQKINSFVTKLSLAKANDKALTTLLQAFKQYISEHCSN--LLNNDFIPR-QINDHRQVNMNDFTGLEVPDVSL 1208
            LWD     +   +     +   V+++ Q L+LA +++NQ S +  +  LIG  +  S  +   + IDR +              A Y     ++  D + IP++  K    +++ + +S++++  ++  +   +  E + L+++  IS +     ++G ++  L+  +F  + +     +  +   P+  + +  +AL  +L   L  S        G+LTMD++ KL  LL SD +    PL+GVWV G        V+  C+KF+  K    ++   P  FLLV ++     P     I W   P E+                      D F + + F L    D+ NR      DQ + S+         N+K  ++  +  +Q ++   SN  L +   IPR   + H Q   N     EVP+VSL
Sbjct:   54 LWDRRPQGDHELLHLYSRRNMRVMVNEQTLRLAVRHLNQ-SASPFNSFLIGSLSVDSREEGLALHIDRFDPGREIAERDGSAKGAKYKVPTTIVPGDQV-IPIRFIKGLIGAENSVTHSKEEFDRALMVLHSRITGEDA-LTLTNFISFKACCHAHSGDDEVILNL-HFGAVTM-----ETGILAIPVTPVPIIPTALARNLAGPLRLSEVHGVPKCGFLTMDNTRKLLLLLESDPKAFSLPLIGVWVSGSFTVHHPFVWACCIKFLNCKSIKERVVAAPNTFLLVHYS-----PANAAPIFWECAPQEQSSTGPFELYSCYENLHFEVPFSDKFSEPLRFDLLPCGDNTNRNLF---DQAVISW---------NNKRQSSNCET-QQPVTHETSNSYLQDGSLIPRPSPSPHPQARQNPLFVPEVPEVSL 457          
BLAST of SMED30003876 vs. Ensembl Medaka
Match: ENSORLT00000017608.2 (STIL centriolar assembly protein [Source:NCBI gene;Acc:101156077])

HSP 1 Score: 88.9669 bits (219), Expect = 2.182e-17
Identity = 85/412 (20.63%), Postives = 177/412 (42.96%), Query Frame = 3
Query:   39 NQNYLWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNYQS-HNKFEIIIDRIECNLASYLSDNLL---ICSDDICIPLKCFKSKSD-----LIYSEDDYKLSIKEILKHLEEESSPLSISKVISLR---IYAGFNDSKLHCPNFNWIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQLYSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSEEKDSFLKFINFKL-QSGIDDLNRYFKSTQDQKINSFVTKLSLAKANDKALTTLLQAFKQYISEHCSNLLNNDFIPR-QINDHRQVNMNDFTGLEVPDVSLLINDTSSI 1232
            +++ LWD     E LN+    +++  +++  + L+LA ++    ++  +   L+G  +  +      + +DR +           +   +   D+ +P   F  + +     +I+SE ++    K +L+H       L +S+++ +R   I +  +D+ +   + +W+    + P + + + P+  + +  +AL+ SL         ++   G+LTMD + KL  LL SD +    PLVG+W+ G +H  +  V+V  ++F+      +++      FLLV F      P  +      TGP  E        +  L Q  +    R  +     +++S   ++  A A     ++   A    +S+  S + + D  PR   N H            VP++SLL++ + S 
Sbjct:   41 SRSALWDGTPAGEKLNLQLCSHRKLHLVLQEKTLRLAQRHARHSNKPSLHFFLLGSVSVDADEEGITVTLDRFDPGRDQGGGSGPVPSTVLPGDVAVPC-LFSDRPEPMPEAVIHSETEFHQCFK-VLQHAVSCRQTLDLSQLLKIRARIICSHQSDAAVF--SLSWLA---VCPAMSVDIQPVRPLPIIPTALLRSLTGAGRPAQHSSHQRGFLTMDQTRKLVLLLESDPKASSLPLVGLWMSGITHVYNPQVWVCSLRFMFGASLQDRVLSESGCFLLVVFGSTHRAPQFFQCRGSRTGPQLECQILTSTQSVTLYQQVVPADGRVLRCELGSEVHSRQAEVFRA-AQRSFSSSPPPAAGLSVSDQDSGVEDEDLSPRPSPNPHLPAPQTRRVQPSVPELSLLVDGSFSF 444          
BLAST of SMED30003876 vs. Planmine SMEST
Match: SMESG000000908.1 (SMESG000000908.1)

HSP 1 Score: 1169.45 bits (3024), Expect = 0.000e+0
Identity = 650/679 (95.73%), Postives = 655/679 (96.47%), Query Frame = 3
Query: 1107 SNLLNNDFIPRQINDHRQVNMNDFTGLEVPDVSLLINDTSSISTLKNFHNEEKLNYNDMETKNLPASLISRITVHSNEESDEATPRHILPKPHVLSKNHNISNKEKLFQPCXXXXXXXXXXXXXXXXXXXXXSNPYLIYPANMFVTKTDPLPNFYXXXXXXXXXXEKSKNPHKSSANKSVNIAEITKKSTSKTEPVMGNETKSKVDKSVIVDITNQTQQIPKRILQLDREEDLATLENLVQQIINQRHQNKCTMMSTGTNTSIIIPDKKLKVIEVSTDLPSFIEMNLCEHCKTAVNKHSVNESILSNGINRERNDTVNDKCNAEITQNDSDTLSALELEDNVKLXXXXXXXXXXXXXXXXLLKNLESFVDQARNKSFHQIENENPGDEIEVMEGSKINYLEKAVLNLRELDVNKDFETQYWETLKLTESQRSNEHVNGNNSQLFSDKCSLDVTILQHKINYXXXXXXXXXXXXXXXXXDVSRGKISNNEQSAFIEELALKYLSKASSQLRKLQSLTSVSQANFIANPSGANTNTNNFSIATQEYLRRHNLDTNSNAGNHNNENYFSSIRLPNGDSLPKNKLLVSSTPAPHGQPFLEKCFIKKPNFNATGNNSDYSYVRILDGLKQQPSILPVLNQDYSLEFWPHKDSNSENRDFKKSISSEEIINVLDVDKLKQLPKYL 3143
            S+LLNNDFIPRQINDHRQVNMNDFTGLEVPDVSLLINDTSSISTLKNFHNEEK+NYNDMETKNLPASLISRITVHSNEESDEATPRHILPKPHVLSKNHNISNKEKLFQPCYPQMPYFPQQIYPYPPILHQPSNPYLIYPANMF                      K + PHKSSANKSVNIAEITKKSTSKTEPVMGNETKSKVDKSVIVDITNQTQQIPKRILQLDREEDLATLENLVQQIINQRHQNKCTMMSTGTNTSIIIPDKKLKVIEVSTDLPSFIEMNLCEHCKTAV+KHSVNESILSNGINRERNDTVNDKCNAEITQNDSDTLSALELEDNVKLSEESENSSDESENFDELLKNLESFVDQARNKSFHQIENENPGDEIEVMEGSKINYLEKAVLNLRELDVNKDFETQYWETLKLTESQRSNEHVNGNNSQLFSDKCSLDVTILQHKINYVSLFLNSSFSVSTLNSTDVSRGKISN+EQSAFIEELALKYLSKASSQLRKLQSLTSVSQANFIANPSGANTNTNNFSIATQEYLRRHNLDTNSNAGNHNNENYFSSIRLPNGDSLPKNKLLVSSTPAPHGQPFLEKCFIKKPNFNATGNNSDYSYVRILDGLKQQPSILPVLNQDYSLEFWPHKDSNSENRDFKKSISSEEIINVLDVDKLKQLPKYL
Sbjct:   19 SSLLNNDFIPRQINDHRQVNMNDFTGLEVPDVSLLINDTSSISTLKNFHNEEKINYNDMETKNLPASLISRITVHSNEESDEATPRHILPKPHVLSKNHNISNKEKLFQPCYPQMPYFPQQIYPYPPILHQPSNPYLIYPANMF----------------------KIQKPHKSSANKSVNIAEITKKSTSKTEPVMGNETKSKVDKSVIVDITNQTQQIPKRILQLDREEDLATLENLVQQIINQRHQNKCTMMSTGTNTSIIIPDKKLKVIEVSTDLPSFIEMNLCEHCKTAVDKHSVNESILSNGINRERNDTVNDKCNAEITQNDSDTLSALELEDNVKLSEESENSSDESENFDELLKNLESFVDQARNKSFHQIENENPGDEIEVMEGSKINYLEKAVLNLRELDVNKDFETQYWETLKLTESQRSNEHVNGNNSQLFSDKCSLDVTILQHKINYVSLFLNSSFSVSTLNSTDVSRGKISNSEQSAFIEELALKYLSKASSQLRKLQSLTSVSQANFIANPSGANTNTNNFSIATQEYLRRHNLDTNSNAGNHNNENYFSSIRLPNGDSLPKNKLLVSSTPAPHGQPFLEKCFIKKPNFNATGNNSDYSYVRILDGLKQQPSILPVLNQDYSLEFWPHKDSNSENRDFKKSISSEEIINVLDVDKLKQLPKYL 675          
BLAST of SMED30003876 vs. Planmine SMEST
Match: SMESG000000908.1 (SMESG000000908.1)

HSP 1 Score: 1132.47 bits (2928), Expect = 0.000e+0
Identity = 631/659 (95.75%), Postives = 635/659 (96.36%), Query Frame = 3
Query: 1167 MNDFTGLEVPDVSLLINDTSSISTLKNFHNEEKLNYNDMETKNLPASLISRITVHSNEESDEATPRHILPKPHVLSKNHNISNKEKLFQPCXXXXXXXXXXXXXXXXXXXXXSNPYLIYPANMFVTKTDPLPNFYXXXXXXXXXXEKSKNPHKSSANKSVNIAEITKKSTSKTEPVMGNETKSKVDKSVIVDITNQTQQIPKRILQLDREEDLATLENLVQQIINQRHQNKCTMMSTGTNTSIIIPDKKLKVIEVSTDLPSFIEMNLCEHCKTAVNKHSVNESILSNGINRERNDTVNDKCNAEITQNDSDTLSALELEDNVKLXXXXXXXXXXXXXXXXLLKNLESFVDQARNKSFHQIENENPGDEIEVMEGSKINYLEKAVLNLRELDVNKDFETQYWETLKLTESQRSNEHVNGNNSQLFSDKCSLDVTILQHKINYXXXXXXXXXXXXXXXXXDVSRGKISNNEQSAFIEELALKYLSKASSQLRKLQSLTSVSQANFIANPSGANTNTNNFSIATQEYLRRHNLDTNSNAGNHNNENYFSSIRLPNGDSLPKNKLLVSSTPAPHGQPFLEKCFIKKPNFNATGNNSDYSYVRILDGLKQQPSILPVLNQDYSLEFWPHKDSNSENRDFKKSISSEEIINVLDVDKLKQLPKYL 3143
            MNDFTGLEVPDVSLLINDTSSISTLKNFHNEEK+NYNDMETKNLPASLISRITVHSNEESDEATPRHILPKPHVLSKNHNISNKEKLFQPCYPQMPYFPQQIYPYPPILHQPSNPYLIYPANMF                      K + PHKSSANKSVNIAEITKKSTSKTEPVMGNETKSKVDKSVIVDITNQTQQIPKRILQLDREEDLATLENLVQQIINQRHQNKCTMMSTGTNTSIIIPDKKLKVIEVSTDLPSFIEMNLCEHCKTAV+KHSVNESILSNGINRERNDTVNDKCNAEITQNDSDTLSALELEDNVKLSEESENSSDESENFDELLKNLESFVDQARNKSFHQIENENPGDEIEVMEGSKINYLEKAVLNLRELDVNKDFETQYWETLKLTESQRSNEHVNGNNSQLFSDKCSLDVTILQHKINYVSLFLNSSFSVSTLNSTDVSRGKISN+EQSAFIEELALKYLSKASSQLRKLQSLTSVSQANFIANPSGANTNTNNFSIATQEYLRRHNLDTNSNAGNHNNENYFSSIRLPNGDSLPKNKLLVSSTPAPHGQPFLEKCFIKKPNFNATGNNSDYSYVRILDGLKQQPSILPVLNQDYSLEFWPHKDSNSENRDFKKSISSEEIINVLDVDKLKQLPKYL
Sbjct:    1 MNDFTGLEVPDVSLLINDTSSISTLKNFHNEEKINYNDMETKNLPASLISRITVHSNEESDEATPRHILPKPHVLSKNHNISNKEKLFQPCYPQMPYFPQQIYPYPPILHQPSNPYLIYPANMF----------------------KIQKPHKSSANKSVNIAEITKKSTSKTEPVMGNETKSKVDKSVIVDITNQTQQIPKRILQLDREEDLATLENLVQQIINQRHQNKCTMMSTGTNTSIIIPDKKLKVIEVSTDLPSFIEMNLCEHCKTAVDKHSVNESILSNGINRERNDTVNDKCNAEITQNDSDTLSALELEDNVKLSEESENSSDESENFDELLKNLESFVDQARNKSFHQIENENPGDEIEVMEGSKINYLEKAVLNLRELDVNKDFETQYWETLKLTESQRSNEHVNGNNSQLFSDKCSLDVTILQHKINYVSLFLNSSFSVSTLNSTDVSRGKISNSEQSAFIEELALKYLSKASSQLRKLQSLTSVSQANFIANPSGANTNTNNFSIATQEYLRRHNLDTNSNAGNHNNENYFSSIRLPNGDSLPKNKLLVSSTPAPHGQPFLEKCFIKKPNFNATGNNSDYSYVRILDGLKQQPSILPVLNQDYSLEFWPHKDSNSENRDFKKSISSEEIINVLDVDKLKQLPKYL 637          
BLAST of SMED30003876 vs. Planmine SMEST
Match: SMESG000000908.1 (SMESG000000908.1)

HSP 1 Score: 949.118 bits (2452), Expect = 0.000e+0
Identity = 508/513 (99.03%), Postives = 511/513 (99.61%), Query Frame = 3
Query: 1605 KSKNPHKSSANKSVNIAEITKKSTSKTEPVMGNETKSKVDKSVIVDITNQTQQIPKRILQLDREEDLATLENLVQQIINQRHQNKCTMMSTGTNTSIIIPDKKLKVIEVSTDLPSFIEMNLCEHCKTAVNKHSVNESILSNGINRERNDTVNDKCNAEITQNDSDTLSALELEDNVKLXXXXXXXXXXXXXXXXLLKNLESFVDQARNKSFHQIENENPGDEIEVMEGSKINYLEKAVLNLRELDVNKDFETQYWETLKLTESQRSNEHVNGNNSQLFSDKCSLDVTILQHKINYXXXXXXXXXXXXXXXXXDVSRGKISNNEQSAFIEELALKYLSKASSQLRKLQSLTSVSQANFIANPSGANTNTNNFSIATQEYLRRHNLDTNSNAGNHNNENYFSSIRLPNGDSLPKNKLLVSSTPAPHGQPFLEKCFIKKPNFNATGNNSDYSYVRILDGLKQQPSILPVLNQDYSLEFWPHKDSNSENRDFKKSISSEEIINVLDVDKLKQLPKYL 3143
            K + PHKSSANKSVNIAEITKKSTSKTEPVMGNETKSKVDKSVIVDITNQTQQIPKRILQLDREEDLATLENLVQQIINQRHQNKCTMMSTGTNTSIIIPDKKLKVIEVSTDLPSFIEMNLCEHCKTAV+KHSVNESILSNGINRERNDTVNDKCNAEITQNDSDTLSALELEDNVKLSEESENSSDESENFDELLKNLESFVDQARNKSFHQIENENPGDEIEVMEGSKINYLEKAVLNLRELDVNKDFETQYWETLKLTESQRSNEHVNGNNSQLFSDKCSLDVTILQHKINYVSLFLNSSFSVSTLNSTDVSRGKISN+EQSAFIEELALKYLSKASSQLRKLQSLTSVSQANFIANPSGANTNTNNFSIATQEYLRRHNLDTNSNAGNHNNENYFSSIRLPNGDSLPKNKLLVSSTPAPHGQPFLEKCFIKKPNFNATGNNSDYSYVRILDGLKQQPSILPVLNQDYSLEFWPHKDSNSENRDFKKSISSEEIINVLDVDKLKQLPKYL
Sbjct:   74 KIQKPHKSSANKSVNIAEITKKSTSKTEPVMGNETKSKVDKSVIVDITNQTQQIPKRILQLDREEDLATLENLVQQIINQRHQNKCTMMSTGTNTSIIIPDKKLKVIEVSTDLPSFIEMNLCEHCKTAVDKHSVNESILSNGINRERNDTVNDKCNAEITQNDSDTLSALELEDNVKLSEESENSSDESENFDELLKNLESFVDQARNKSFHQIENENPGDEIEVMEGSKINYLEKAVLNLRELDVNKDFETQYWETLKLTESQRSNEHVNGNNSQLFSDKCSLDVTILQHKINYVSLFLNSSFSVSTLNSTDVSRGKISNSEQSAFIEELALKYLSKASSQLRKLQSLTSVSQANFIANPSGANTNTNNFSIATQEYLRRHNLDTNSNAGNHNNENYFSSIRLPNGDSLPKNKLLVSSTPAPHGQPFLEKCFIKKPNFNATGNNSDYSYVRILDGLKQQPSILPVLNQDYSLEFWPHKDSNSENRDFKKSISSEEIINVLDVDKLKQLPKYL 586          

HSP 2 Score: 155.221 bits (391), Expect = 3.888e-39
Identity = 74/79 (93.67%), Postives = 76/79 (96.20%), Query Frame = 3
Query: 1167 MNDFTGLEVPDVSLLINDTSSISTLKNFHNEEKLNYNDMETKNLPASLISRITVHSNEESDEATPRHILPKPHVLSKNH 1403
            MNDFTGLEVPDVSLLINDTSSISTLKNFHNEEK+NYNDMETKNLPASLISRITVHSNEESDEATPRHILPKPH + K H
Sbjct:    1 MNDFTGLEVPDVSLLINDTSSISTLKNFHNEEKINYNDMETKNLPASLISRITVHSNEESDEATPRHILPKPHKIQKPH 79          
BLAST of SMED30003876 vs. Planmine SMEST
Match: SMESG000000911.1 (SMESG000000911.1)

HSP 1 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 305/306 (99.67%), Postives = 306/306 (100.00%), Query Frame = 3
Query:   24 MFNNINQNYLWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNYQSHNKFEIIIDRIECNLASYLSDNLLICSDDICIPLKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCPNFNWIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQLYSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSEEKDSFLKFI 941
            MFNNINQNYLWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNYQSHNKFEIIIDRIECNLASYLSDNLLICSDDICIPLKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCPNFNWIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQLYSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSEEKDSFLKF+
Sbjct:    1 MFNNINQNYLWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCSQNMVSCILIGCCNYQSHNKFEIIIDRIECNLASYLSDNLLICSDDICIPLKCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFNDSKLHCPNFNWIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQLYSTNEANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVTCMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSEEKDSFLKFV 306          
BLAST of SMED30003876 vs. Planmine SMEST
Match: SMESG000079877.1 (SMESG000079877.1)

HSP 1 Score: 547.74 bits (1410), Expect = 0.000e+0
Identity = 287/288 (99.65%), Postives = 287/288 (99.65%), Query Frame = 3
Query: 2280 MEGSKINYLEKAVLNLRELDVNKDFETQYWETLKLTESQRSNEHVNGNNSQLFSDKCSLDVTILQHKINYXXXXXXXXXXXXXXXXXDVSRGKISNNEQSAFIEELALKYLSKASSQLRKLQSLTSVSQANFIANPSGANTNTNNFSIATQEYLRRHNLDTNSNAGNHNNENYFSSIRLPNGDSLPKNKLLVSSTPAPHGQPFLEKCFIKKPNFNATGNNSDYSYVRILDGLKQQPSILPVLNQDYSLEFWPHKDSNSENRDFKKSISSEEIINVLDVDKLKQLPKYL 3143
            ME SKINYLEKAVLNLRELDVNKDFETQYWETLKLTESQRSNEHVNGNNSQLFSDKCSLDVTILQHKINYVSLFLNSSFSVSTLNSTDVSRGKISNNEQSAFIEELALKYLSKASSQLRKLQSLTSVSQANFIANPSGANTNTNNFSIATQEYLRRHNLDTNSNAGNHNNENYFSSIRLPNGDSLPKNKLLVSSTPAPHGQPFLEKCFIKKPNFNATGNNSDYSYVRILDGLKQQPSILPVLNQDYSLEFWPHKDSNSENRDFKKSISSEEIINVLDVDKLKQLPKYL
Sbjct:    1 MEESKINYLEKAVLNLRELDVNKDFETQYWETLKLTESQRSNEHVNGNNSQLFSDKCSLDVTILQHKINYVSLFLNSSFSVSTLNSTDVSRGKISNNEQSAFIEELALKYLSKASSQLRKLQSLTSVSQANFIANPSGANTNTNNFSIATQEYLRRHNLDTNSNAGNHNNENYFSSIRLPNGDSLPKNKLLVSSTPAPHGQPFLEKCFIKKPNFNATGNNSDYSYVRILDGLKQQPSILPVLNQDYSLEFWPHKDSNSENRDFKKSISSEEIINVLDVDKLKQLPKYL 288          
The following BLAST results are available for this feature:
BLAST of SMED30003876 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STIL9.688e-1923.70STIL centriolar assembly protein [Source:HGNC Symb... [more]
STIL1.158e-1823.70STIL centriolar assembly protein [Source:HGNC Symb... [more]
STIL1.191e-1823.70STIL centriolar assembly protein [Source:HGNC Symb... [more]
STIL1.639e-1021.43STIL centriolar assembly protein [Source:HGNC Symb... [more]
STIL2.491e-1021.43STIL centriolar assembly protein [Source:HGNC Symb... [more]
back to top
BLAST of SMED30003876 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003876 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003876 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stil2.568e-1723.37STIL centriolar assembly protein [Source:NCBI gene... [more]
stil3.797e-1723.37STIL centriolar assembly protein [Source:NCBI gene... [more]
stil3.797e-1723.37STIL centriolar assembly protein [Source:NCBI gene... [more]
stil3.797e-1723.37STIL centriolar assembly protein [Source:NCBI gene... [more]
stil4.414e-1723.37STIL centriolar assembly protein [Source:NCBI gene... [more]
back to top
BLAST of SMED30003876 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
stil1.581e-1422.11STIL, centriolar assembly protein [Source:NCBI gen... [more]
back to top
BLAST of SMED30003876 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Stil2.314e-1523.22Scl/Tal1 interrupting locus [Source:MGI Symbol;Acc... [more]
Stil2.816e-1523.48Scl/Tal1 interrupting locus [Source:MGI Symbol;Acc... [more]
Stil1.067e-1423.79Scl/Tal1 interrupting locus [Source:MGI Symbol;Acc... [more]
back to top
BLAST of SMED30003876 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q15468|STIL_HUMAN5.560e-1823.70SCL-interrupting locus protein OS=Homo sapiens OX=... [more]
sp|Q8JGS1|STIL_DANRE2.867e-1623.37SCL-interrupting locus protein homolog OS=Danio re... [more]
sp|Q4V7H1|STIL_XENLA1.945e-1421.77SCL-interrupting locus protein homolog OS=Xenopus ... [more]
sp|Q60988|STIL_MOUSE2.088e-1422.51SCL-interrupting locus protein homolog OS=Mus musc... [more]
back to top
BLAST of SMED30003876 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4W5P6A87.205e-1924.34Scl/tal1 interrupting locus OS=Hucho hucho OX=6206... [more]
A0A210QBV62.241e-1822.09SCL-interrupting locus protein OS=Mizuhopecten yes... [more]
A0A1S3JVN62.788e-1822.52SCL-interrupting locus protein homolog OS=Lingula ... [more]
A0A0L8I3H62.165e-1625.18Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A4W5RVW73.216e-1621.82Scl/tal1 interrupting locus OS=Hucho hucho OX=6206... [more]
back to top
BLAST of SMED30003876 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
stil1.833e-1422.62STIL centriolar assembly protein [Source:NCBI gene... [more]
stil2.221e-1422.62STIL centriolar assembly protein [Source:NCBI gene... [more]
stil2.593e-1425.00STIL centriolar assembly protein [Source:NCBI gene... [more]
back to top
BLAST of SMED30003876 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000004901.11.757e-1022.14pep scaffold:Pmarinus_7.0:GL476392:242919:257821:-... [more]
back to top
BLAST of SMED30003876 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003876 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO339882.209e-1522.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30003876 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000017608.22.182e-1720.63STIL centriolar assembly protein [Source:NCBI gene... [more]
back to top
BLAST of SMED30003876 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000908.10.000e+095.73SMESG000000908.1[more]
SMESG000000908.10.000e+095.75SMESG000000908.1[more]
SMESG000000908.13.888e-3999.03SMESG000000908.1[more]
SMESG000000911.10.000e+099.67SMESG000000911.1[more]
SMESG000079877.10.000e+099.65SMESG000079877.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003876 ID=SMED30003876|Name=SMED30003876|organism=Schmidtea mediterranea sexual|type=transcript|length=3186bp
TGACATCAAACTTGTAAATTTAAATGTTTAATAATATAAATCAAAATTAT
TTATGGGATCACAACTTAATTAATGAAATTTTAAATATTTCTTTTGATGA
CAATAAACAGTTTTCAGTTTTAATTAGTAGCCAAGTTCTTAAATTAGCAT
CCAAATACGTAAATCAATGTTCTCAAAATATGGTTTCTTGTATTCTAATC
GGTTGTTGTAATTACCAAAGTCACAATAAATTTGAAATAATCATTGACAG
AATTGAATGCAATTTAGCCAGTTATTTATCAGATAATCTGTTGATATGTT
CTGACGATATTTGTATTCCATTAAAATGCTTTAAATCGAAATCCGATTTG
ATATATTCCGAAGATGATTATAAATTGTCAATAAAGGAAATTCTGAAACA
TTTAGAAGAAGAATCGTCACCTTTGTCGATTTCTAAAGTGATTTCCTTGC
GAATCTATGCAGGATTTAATGACAGCAAACTTCACTGTCCGAATTTCAAT
TGGATAAAATTAAAATTAATTTATCCTGATCTGCATTTGACTGTATCGCC
AATTAATAAAATTCTCGTGTTTCGGTCGGCATTAGTGAGCAGTTTAGAGG
ATCAGCTTTATTCCACTAACGAAGCTAATTTCAATTATGGGTATCTTACA
ATGGATCACTCTAATAAGTTACATTTTCTTCTCTATTCCGATGACCGGGT
ACTCCTGTCACCGTTGGTAGGAGTCTGGGTACATGGCGGGTCACATGAAT
CTGATCTTCTCGTTTTTGTCACGTGTATGAAATTTATCCTTTTAAAGAAA
TCTTTGAATAAAATTTGTAAGCCTCCATTTCCGTTTTTATTGGTTCGATT
TACTGGTAATAAAAACGAACCGTTGAAATATTATGATATCAAATGGCCAA
CTGGACCATCAGAAGAAAAAGATTCATTTCTCAAATTCATCAATTTCAAA
TTGCAATCAGGAATTGATGATCTGAATAGATATTTCAAATCAACACAAGA
TCAGAAAATTAACAGTTTTGTAACTAAGTTATCACTTGCTAAAGCAAATG
ATAAGGCTTTGACTACTTTATTGCAGGCTTTCAAGCAATATATCTCTGAG
CATTGCTCCAATTTACTCAACAATGATTTCATTCCTCGGCAAATAAATGA
TCATCGACAAGTTAATATGAACGATTTTACCGGCCTAGAAGTTCCCGACG
TATCATTACTTATCAATGATACAAGTTCAATTTCAACTCTAAAAAATTTC
CATAATGAGGAAAAATTAAACTACAACGACATGGAAACTAAAAACTTACC
AGCCAGTTTGATATCTAGAATAACAGTTCATTCTAATGAAGAAAGTGATG
AGGCAACTCCAAGACACATTTTGCCAAAACCACATGTATTATCAAAAAAT
CATAACATTTCCAATAAAGAGAAATTATTTCAACCCTGCTATCCTCAAAT
GCCATATTTTCCCCAGCAAATCTATCCATATCCACCAATTTTACATCAAC
CATCGAATCCTTATCTAATTTACCCTGCAAACATGTTTGTTACCAAAACT
GATCCTTTACCCAATTTTTATACCAAACCTCCACAACCACCAAAACAAAC
AGAAAAATCCAAAAACCCACATAAATCATCAGCTAATAAATCTGTCAATA
TCGCAGAGATTACAAAAAAGTCAACCTCCAAAACCGAACCAGTTATGGGA
AATGAAACTAAATCAAAAGTCGATAAAAGTGTAATTGTTGATATTACAAA
CCAAACTCAACAGATACCGAAACGTATATTGCAGTTAGATAGAGAAGAAG
ATTTGGCAACGTTGGAAAATCTCGTACAACAAATTATAAATCAAAGACAT
CAAAATAAATGCACAATGATGTCAACTGGTACAAATACAAGCATCATAAT
ACCGGACAAAAAGCTCAAAGTTATTGAAGTATCAACCGATCTTCCTTCAT
TTATCGAAATGAATCTGTGTGAACATTGCAAGACAGCCGTAAATAAACAT
TCAGTCAATGAAAGTATATTGTCGAATGGCATAAATAGAGAACGAAATGA
TACAGTGAACGATAAGTGCAACGCAGAAATTACTCAAAATGATTCTGATA
CATTATCAGCGTTAGAGTTAGAAGATAATGTGAAATTAAGCGAAGAATCG
GAGAATTCTTCTGACGAAAGTGAAAATTTCGATGAGTTATTGAAAAATTT
GGAAAGTTTCGTTGACCAAGCTCGAAATAAATCATTTCATCAAATTGAAA
ATGAAAACCCTGGAGATGAAATTGAAGTAATGGAAGGATCAAAAATCAAT
TATCTGGAAAAAGCAGTCCTTAATCTCCGAGAACTAGATGTTAATAAGGA
TTTCGAGACTCAATATTGGGAAACTCTTAAATTAACCGAATCTCAGCGGT
CTAATGAACATGTTAATGGGAACAATAGTCAACTATTTTCTGATAAATGC
AGTCTCGATGTCACTATTCTTCAACATAAGATCAATTATGTTTCGTTATT
CCTCAACAGCTCTTTTTCGGTTTCCACTTTGAATTCTACAGATGTTAGTC
GTGGGAAAATTTCTAACAATGAACAAAGCGCCTTTATAGAAGAGTTAGCT
CTTAAATATTTATCAAAAGCCTCATCGCAATTGAGAAAGCTCCAAAGTCT
CACTAGTGTGTCTCAGGCCAATTTTATTGCAAATCCAAGCGGTGCAAATA
CAAACACTAACAATTTCAGCATTGCAACTCAAGAATATCTACGTCGACAC
AATCTCGATACAAATTCCAATGCCGGCAATCACAATAATGAGAACTATTT
CTCATCAATCCGACTGCCAAATGGTGATTCGTTGCCGAAGAATAAGCTAC
TGGTATCCAGCACTCCGGCTCCACATGGGCAGCCGTTTCTTGAAAAATGT
TTCATAAAGAAGCCTAATTTCAATGCAACCGGCAATAATTCTGATTATTC
CTACGTCAGAATTCTCGATGGACTGAAACAGCAACCGTCCATATTGCCGG
TGTTGAATCAAGATTATTCACTTGAGTTTTGGCCTCACAAAGATTCCAAC
TCTGAGAATCGAGATTTCAAAAAATCGATTTCTTCCGAGGAAATTATAAA
TGTTCTCGATGTCGACAAATTGAAACAGTTACCGAAATATTTGTAGGATT
GCTTAATTGGTTATAATTAGATGGAAATATTTGCAC
back to top

protein sequence of SMED30003876-orf-1

>SMED30003876-orf-1 ID=SMED30003876-orf-1|Name=SMED30003876-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1041bp
MFNNINQNYLWDHNLINEILNISFDDNKQFSVLISSQVLKLASKYVNQCS
QNMVSCILIGCCNYQSHNKFEIIIDRIECNLASYLSDNLLICSDDICIPL
KCFKSKSDLIYSEDDYKLSIKEILKHLEEESSPLSISKVISLRIYAGFND
SKLHCPNFNWIKLKLIYPDLHLTVSPINKILVFRSALVSSLEDQLYSTNE
ANFNYGYLTMDHSNKLHFLLYSDDRVLLSPLVGVWVHGGSHESDLLVFVT
CMKFILLKKSLNKICKPPFPFLLVRFTGNKNEPLKYYDIKWPTGPSEEKD
SFLKFINFKLQSGIDDLNRYFKSTQDQKINSFVTKLSLAKANDKALTTLL
QAFKQYISEHCSNLLNNDFIPRQINDHRQVNMNDFTGLEVPDVSLLINDT
SSISTLKNFHNEEKLNYNDMETKNLPASLISRITVHSNEESDEATPRHIL
PKPHVLSKNHNISNKEKLFQPCYPQMPYFPQQIYPYPPILHQPSNPYLIY
PANMFVTKTDPLPNFYTKPPQPPKQTEKSKNPHKSSANKSVNIAEITKKS
TSKTEPVMGNETKSKVDKSVIVDITNQTQQIPKRILQLDREEDLATLENL
VQQIINQRHQNKCTMMSTGTNTSIIIPDKKLKVIEVSTDLPSFIEMNLCE
HCKTAVNKHSVNESILSNGINRERNDTVNDKCNAEITQNDSDTLSALELE
DNVKLSEESENSSDESENFDELLKNLESFVDQARNKSFHQIENENPGDEI
EVMEGSKINYLEKAVLNLRELDVNKDFETQYWETLKLTESQRSNEHVNGN
NSQLFSDKCSLDVTILQHKINYVSLFLNSSFSVSTLNSTDVSRGKISNNE
QSAFIEELALKYLSKASSQLRKLQSLTSVSQANFIANPSGANTNTNNFSI
ATQEYLRRHNLDTNSNAGNHNNENYFSSIRLPNGDSLPKNKLLVSSTPAP
HGQPFLEKCFIKKPNFNATGNNSDYSYVRILDGLKQQPSILPVLNQDYSL
EFWPHKDSNSENRDFKKSISSEEIINVLDVDKLKQLPKYL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR026123Sil
Vocabulary: biological process
TermDefinition
GO:0000578embryonic axis specification
GO:0001701in utero embryonic development
GO:0001843neural tube closure
GO:0001947heart looping
GO:0007052mitotic spindle organization
GO:0007224smoothened signaling pathway
GO:0007275multicellular organism development
GO:0007368determination of left/right symmetry
GO:0008283cell proliferation
GO:0021915neural tube development
GO:0030900forebrain development
GO:0030903notochord development
GO:0033504floor plate development
GO:0035264multicellular organism growth
GO:0043066negative regulation of apoptotic process
GO:0046599regulation of centriole replication
GO:0051298centrosome duplication
GO:0071539protein localization to centrosome
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005814centriole
GO:0005829cytosol
GO:0005856cytoskeleton