nuclear factor Y subunit B

Overview
Namenuclear factor Y subunit B (ADG08186.1)
Smed IDSMED30003873
Length (bp)753
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of nuclear factor Y subunit B (SMED30003873) t-SNE clustered cells

Violin plots show distribution of expression levels for nuclear factor Y subunit B (SMED30003873) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of nuclear factor Y subunit B (SMED30003873) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for nuclear factor Y subunit B (SMED30003873) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003873

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30003873SMESG000017262.1 HM100653smed_ncbi_20200123PMID:27304889
Iyer et al., 2016
whole organism juvenile colorimetric in situ hybridization evidence
testisSMED30003873SMESG000017262.1 HM100653smed_ncbi_20200123PMID:27304889
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30003873SMESG000017262.1 KU366699smed_ncbi_20200123PMID:27304889
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
pharynxSMED30003873SMESG000017262.1 dd_Smed_v4_5828_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30003873SMESG000017262.1 Contig762uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30003873SMESG000017262.1 Contig762newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30003873SMESG000028748.1 Contig762uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30003873SMESG000028748.1 Contig762newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30003873SMESG000017262.1 dd_Smed_v4_5828_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
testisSMED30003873SMESG000017262.1 HM100653smed_ncbi_20200123PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatogoniumSMED30003873SMESG000017262.1 HM100653smed_ncbi_20200123PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatocyteSMED30003873SMESG000017262.1 HM100653smed_ncbi_20200123PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatidSMED30003873SMESG000017262.1 HM100653smed_ncbi_20200123PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testis primordiumSMED30003873SMESG000017262.1 Contig282_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of nuclear factor Y subunit B vs. Ensembl Human
Match: NFYB (nuclear transcription factor Y subunit beta [Source:HGNC Symbol;Acc:HGNC:7805])

HSP 1 Score: 136.346 bits (342), Expect = 4.283e-39
Identity = 64/108 (59.26%), Postives = 84/108 (77.78%), Query Frame = 1
Query:  124 DIDGN-DCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
            D +G+ +  ++QD +LPI NV++IMK  +P + KIAKDAK+CVQEC SEFISF++SEA+E C  +KRKTINGEDIL A + LGFD+YVE L+ +LQ +REA K E  I
Sbjct:   44 DTNGSKESFREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGI 151          
BLAST of nuclear factor Y subunit B vs. Ensembl Human
Match: NFYB (nuclear transcription factor Y subunit beta [Source:HGNC Symbol;Acc:HGNC:7805])

HSP 1 Score: 136.346 bits (342), Expect = 4.283e-39
Identity = 64/108 (59.26%), Postives = 84/108 (77.78%), Query Frame = 1
Query:  124 DIDGN-DCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
            D +G+ +  ++QD +LPI NV++IMK  +P + KIAKDAK+CVQEC SEFISF++SEA+E C  +KRKTINGEDIL A + LGFD+YVE L+ +LQ +REA K E  I
Sbjct:   44 DTNGSKESFREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGI 151          
BLAST of nuclear factor Y subunit B vs. Ensembl Human
Match: NFYB (nuclear transcription factor Y subunit beta [Source:HGNC Symbol;Acc:HGNC:7805])

HSP 1 Score: 136.346 bits (342), Expect = 4.548e-39
Identity = 64/108 (59.26%), Postives = 84/108 (77.78%), Query Frame = 1
Query:  124 DIDGN-DCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
            D +G+ +  ++QD +LPI NV++IMK  +P + KIAKDAK+CVQEC SEFISF++SEA+E C  +KRKTINGEDIL A + LGFD+YVE L+ +LQ +REA K E  I
Sbjct:   45 DTNGSKESFREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGI 152          
BLAST of nuclear factor Y subunit B vs. Ensembl Human
Match: DR1 (down-regulator of transcription 1 [Source:HGNC Symbol;Acc:HGNC:3017])

HSP 1 Score: 73.9442 bits (180), Expect = 1.363e-15
Identity = 34/86 (39.53%), Postives = 57/86 (66.28%), Query Frame = 1
Query:  151 DQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQ 408
            D D  +P   ++K++K+ LP + ++A DA++ V  C +EFI  +SSEA EIC   ++KTI+ E ++QA  +LGF +Y+  ++  LQ
Sbjct:    8 DDDLTIPRAAINKMIKETLP-NVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEHVIQALESLGFGSYISEVKEVLQ 92          
BLAST of nuclear factor Y subunit B vs. Ensembl Human
Match: DR1 (down-regulator of transcription 1 [Source:HGNC Symbol;Acc:HGNC:3017])

HSP 1 Score: 73.9442 bits (180), Expect = 1.363e-15
Identity = 34/86 (39.53%), Postives = 57/86 (66.28%), Query Frame = 1
Query:  151 DQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQ 408
            D D  +P   ++K++K+ LP + ++A DA++ V  C +EFI  +SSEA EIC   ++KTI+ E ++QA  +LGF +Y+  ++  LQ
Sbjct:    8 DDDLTIPRAAINKMIKETLP-NVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEHVIQALESLGFGSYISEVKEVLQ 92          
BLAST of nuclear factor Y subunit B vs. Ensembl Celegans
Match: nfyb-1 (Nuclear transcription Factor Y, B (Beta) subunit [Source:UniProtKB/TrEMBL;Acc:A0A0M7RFF4])

HSP 1 Score: 127.102 bits (318), Expect = 4.289e-34
Identity = 59/101 (58.42%), Postives = 72/101 (71.29%), Query Frame = 1
Query:  142 CLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
             L DQ+RFLPI NV +IMK  +   AK+AKDAK+C QEC SEFISF++SEAAEIC   KRKTI  +D+L A    GFDNY E ++ FLQ YR+A+K    I
Sbjct:   58 VLLDQERFLPIANVVRIMKTQMDPQAKLAKDAKECAQECVSEFISFIASEAAEICNITKRKTITADDLLTAMEATGFDNYAEPMRIFLQKYRQAHKITGPI 158          
BLAST of nuclear factor Y subunit B vs. Ensembl Celegans
Match: nfyb-1 (Nuclear transcription Factor Y, B (Beta) subunit [Source:UniProtKB/TrEMBL;Acc:A0A0M7RFF4])

HSP 1 Score: 103.219 bits (256), Expect = 8.449e-26
Identity = 48/84 (57.14%), Postives = 59/84 (70.24%), Query Frame = 1
Query:  193 MKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
            MK  +   AK+AKDAK+C QEC SEFISF++SEAAEIC   KRKTI  +D+L A    GFDNY E ++ FLQ YR+A+K    I
Sbjct:    1 MKTQMDPQAKLAKDAKECAQECVSEFISFIASEAAEICNITKRKTITADDLLTAMEATGFDNYAEPMRIFLQKYRQAHKITGPI 84          
BLAST of nuclear factor Y subunit B vs. Ensembl Celegans
Match: dro-1 (DR1 (One) transcription factor family [Source:UniProtKB/TrEMBL;Acc:O45550])

HSP 1 Score: 50.8322 bits (120), Expect = 1.011e-7
Identity = 27/81 (33.33%), Postives = 47/81 (58.02%), Query Frame = 1
Query:  166 LPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFD-NYVETLQNFL 405
            LP   +++I+K+ +P   +IA +++  +  C  EF+  ++ EA  I   D+RKTI  E + +A  NLGF  +Y+E   + L
Sbjct:   22 LPQKGINQIIKEVVP-EMRIANESRDMINACCVEFVKHIAREAQRIASQDQRKTIYHEHVQKALQNLGFTPDYLEAADSVL 101          
BLAST of nuclear factor Y subunit B vs. Ensembl Fly
Match: Nf-YB (gene:FBgn0032816 transcript:FBtr0343854)

HSP 1 Score: 139.043 bits (349), Expect = 4.182e-41
Identity = 64/100 (64.00%), Postives = 80/100 (80.00%), Query Frame = 1
Query:  130 DGNDCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANK 429
            DG   L++QDRFLPICN+ KIMK  +P + KIAKDA++C+QEC SEFISF+SSEA E    + RKT+NG+D+L AF+NLGFDNYVE L  +LQ YRE+NK
Sbjct:   31 DGGIMLREQDRFLPICNIIKIMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIERSVAENRKTVNGDDLLVAFSNLGFDNYVEPLSIYLQKYRESNK 130          
BLAST of nuclear factor Y subunit B vs. Ensembl Fly
Match: Nf-YB (gene:FBgn0032816 transcript:FBtr0081289)

HSP 1 Score: 139.043 bits (349), Expect = 4.182e-41
Identity = 64/100 (64.00%), Postives = 80/100 (80.00%), Query Frame = 1
Query:  130 DGNDCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANK 429
            DG   L++QDRFLPICN+ KIMK  +P + KIAKDA++C+QEC SEFISF+SSEA E    + RKT+NG+D+L AF+NLGFDNYVE L  +LQ YRE+NK
Sbjct:   31 DGGIMLREQDRFLPICNIIKIMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIERSVAENRKTVNGDDLLVAFSNLGFDNYVEPLSIYLQKYRESNK 130          
BLAST of nuclear factor Y subunit B vs. Ensembl Fly
Match: NC2beta (gene:FBgn0028926 transcript:FBtr0080695)

HSP 1 Score: 67.3958 bits (163), Expect = 1.697e-13
Identity = 32/91 (35.16%), Postives = 57/91 (62.64%), Query Frame = 1
Query:  148 KDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYRE 420
            +D +  LP  +++KI+K+ +P + ++A ++++ +  C SEFI  +SSEA E+C    +KTIN E +L+A   LGF +Y +  +  L   +E
Sbjct:   14 EDDELTLPRASINKIIKELVP-TVRVANESRELILNCCSEFIHLISSEANEVCNMRNKKTINAEHVLEALERLGFHDYKQEAEAVLHDCKE 103          
BLAST of nuclear factor Y subunit B vs. Ensembl Fly
Match: Chrac-14 (gene:FBgn0043002 transcript:FBtr0100268)

HSP 1 Score: 56.225 bits (134), Expect = 6.119e-10
Identity = 30/88 (34.09%), Postives = 50/88 (56.82%), Query Frame = 1
Query:  154 QDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYR 417
            +D  LP   + +++K+ LP SA ++K+A+  +   AS F  FV+S +  +      KTI  +DILQ    L F+++V +L   L+ YR
Sbjct:    6 EDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTSSSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYR 93          
BLAST of nuclear factor Y subunit B vs. Ensembl Zebrafish
Match: nfybb (nuclear transcription factor Y, beta b [Source:ZFIN;Acc:ZDB-GENE-050306-25])

HSP 1 Score: 138.658 bits (348), Expect = 5.420e-40
Identity = 67/108 (62.04%), Postives = 83/108 (76.85%), Query Frame = 1
Query:  130 DGN---DCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
            DGN   D L++QD +LPI NV++IMK  +P + KIAKDAK+CVQEC SEFISF++SEA+E C  +KRKTINGEDIL A + LGFD YVE L+ +LQ +REA K E  I
Sbjct:   64 DGNGSKDNLREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDMYVEPLKLYLQKFREAMKGEKGI 171          
BLAST of nuclear factor Y subunit B vs. Ensembl Zebrafish
Match: nfybb (nuclear transcription factor Y, beta b [Source:ZFIN;Acc:ZDB-GENE-050306-25])

HSP 1 Score: 137.887 bits (346), Expect = 6.033e-40
Identity = 67/108 (62.04%), Postives = 83/108 (76.85%), Query Frame = 1
Query:  130 DGN---DCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
            DGN   D L++QD +LPI NV++IMK  +P + KIAKDAK+CVQEC SEFISF++SEA+E C  +KRKTINGEDIL A + LGFD YVE L+ +LQ +REA K E  I
Sbjct:   43 DGNGSKDNLREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDMYVEPLKLYLQKFREAMKGEKGI 150          
BLAST of nuclear factor Y subunit B vs. Ensembl Zebrafish
Match: nfybb (nuclear transcription factor Y, beta b [Source:ZFIN;Acc:ZDB-GENE-050306-25])

HSP 1 Score: 138.658 bits (348), Expect = 6.103e-40
Identity = 67/108 (62.04%), Postives = 83/108 (76.85%), Query Frame = 1
Query:  130 DGN---DCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
            DGN   D L++QD +LPI NV++IMK  +P + KIAKDAK+CVQEC SEFISF++SEA+E C  +KRKTINGEDIL A + LGFD YVE L+ +LQ +REA K E  I
Sbjct:   38 DGNGSKDNLREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDMYVEPLKLYLQKFREAMKGEKGI 145          
BLAST of nuclear factor Y subunit B vs. Ensembl Zebrafish
Match: nfyba (nuclear transcription factor Y, beta a [Source:ZFIN;Acc:ZDB-GENE-050417-13])

HSP 1 Score: 136.346 bits (342), Expect = 2.349e-39
Identity = 66/108 (61.11%), Postives = 82/108 (75.93%), Query Frame = 1
Query:  130 DGN---DCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
            DGN   D  ++QD +LPI NV++IMK  +P + KIAKDAK+CVQEC SEFISF++SEA+E C  +KRKTINGEDIL A + LGFD YVE L+ +LQ +REA K E  I
Sbjct:   42 DGNGSKDFFREQDIYLPIANVARIMKNAVPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDMYVEPLKLYLQKFREAMKGEKGI 149          
BLAST of nuclear factor Y subunit B vs. Ensembl Zebrafish
Match: nfyba (nuclear transcription factor Y, beta a [Source:ZFIN;Acc:ZDB-GENE-050417-13])

HSP 1 Score: 136.346 bits (342), Expect = 2.349e-39
Identity = 66/108 (61.11%), Postives = 82/108 (75.93%), Query Frame = 1
Query:  130 DGN---DCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
            DGN   D  ++QD +LPI NV++IMK  +P + KIAKDAK+CVQEC SEFISF++SEA+E C  +KRKTINGEDIL A + LGFD YVE L+ +LQ +REA K E  I
Sbjct:   42 DGNGSKDFFREQDIYLPIANVARIMKNAVPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDMYVEPLKLYLQKFREAMKGEKGI 149          
BLAST of nuclear factor Y subunit B vs. Ensembl Xenopus
Match: cdk5r1 (cyclin-dependent kinase 5, regulatory subunit 1 (p35) [Source:Xenbase;Acc:XB-GENE-1032903])

HSP 1 Score: 135.191 bits (339), Expect = 9.860e-39
Identity = 62/102 (60.78%), Postives = 80/102 (78.43%), Query Frame = 1
Query:  139 DCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
            +  ++QD +LPI NV++IMK  +P + KIAKDAK+CVQEC SEFISF++SEA+E C  +KRKTINGEDIL A + LGFD+YVE L+ +LQ +REA K E  I
Sbjct:   49 ESFREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGI 150          
BLAST of nuclear factor Y subunit B vs. Ensembl Xenopus
Match: cdk5r1 (cyclin-dependent kinase 5, regulatory subunit 1 (p35) [Source:Xenbase;Acc:XB-GENE-1032903])

HSP 1 Score: 136.346 bits (342), Expect = 1.743e-38
Identity = 62/102 (60.78%), Postives = 80/102 (78.43%), Query Frame = 1
Query:  139 DCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
            +  ++QD +LPI NV++IMK  +P + KIAKDAK+CVQEC SEFISF++SEA+E C  +KRKTINGEDIL A + LGFD+YVE L+ +LQ +REA K E  I
Sbjct:  111 ESFREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGI 212          
BLAST of nuclear factor Y subunit B vs. Ensembl Xenopus
Match: rad17 (RAD17 checkpoint clamp loader component [Source:Xenbase;Acc:XB-GENE-1002356])

HSP 1 Score: 74.3294 bits (181), Expect = 8.895e-16
Identity = 34/86 (39.53%), Postives = 58/86 (67.44%), Query Frame = 1
Query:  151 DQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQ 408
            D D  +P   ++K++K+ LP + ++A DA++ V  C +EFI  +SSEA EIC   ++KTI+ E ++QA  +LGF +Y+  +++ LQ
Sbjct:    8 DDDLTIPRAAINKMIKETLP-NVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEHVIQALESLGFGSYISEVKDVLQ 92          
BLAST of nuclear factor Y subunit B vs. Ensembl Xenopus
Match: pole3 (polymerase (DNA directed), epsilon 3, accessory subunit [Source:NCBI gene;Acc:550018])

HSP 1 Score: 59.6918 bits (143), Expect = 1.075e-10
Identity = 30/94 (31.91%), Postives = 51/94 (54.26%), Query Frame = 1
Query:  148 KDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANK 429
            + +D  LP   V++I+K+ LP    I+K+A+  +   AS F+ + +S A       KRKT+N  D+L A   + F  ++  L+  L+ YR+  K
Sbjct:    4 RPEDLNLPNAVVTRIIKEALPEGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNATDVLAAMEEMEFQRFLTPLKESLEVYRQDQK 97          
BLAST of nuclear factor Y subunit B vs. Ensembl Mouse
Match: Nfyb (nuclear transcription factor-Y beta [Source:MGI Symbol;Acc:MGI:97317])

HSP 1 Score: 136.346 bits (342), Expect = 2.756e-39
Identity = 64/108 (59.26%), Postives = 84/108 (77.78%), Query Frame = 1
Query:  124 DIDGN-DCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
            D +G+ +  ++QD +LPI NV++IMK  +P + KIAKDAK+CVQEC SEFISF++SEA+E C  +KRKTINGEDIL A + LGFD+YVE L+ +LQ +REA K E  I
Sbjct:   44 DTNGSKESFREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGI 151          
BLAST of nuclear factor Y subunit B vs. Ensembl Mouse
Match: Nfyb (nuclear transcription factor-Y beta [Source:MGI Symbol;Acc:MGI:97317])

HSP 1 Score: 80.1073 bits (196), Expect = 7.481e-19
Identity = 34/55 (61.82%), Postives = 45/55 (81.82%), Query Frame = 1
Query:  145 LKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQ 309
             ++QD +LPI NV++IMK  +P + KIAKDAK+CVQEC SEFISF++SEA+E C 
Sbjct:   52 FREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCH 106          
BLAST of nuclear factor Y subunit B vs. Ensembl Mouse
Match: Dr1 (down-regulator of transcription 1 [Source:MGI Symbol;Acc:MGI:1100515])

HSP 1 Score: 73.9442 bits (180), Expect = 9.360e-16
Identity = 34/86 (39.53%), Postives = 57/86 (66.28%), Query Frame = 1
Query:  151 DQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQ 408
            D D  +P   ++K++K+ LP + ++A DA++ V  C +EFI  +SSEA EIC   ++KTI+ E ++QA  +LGF +Y+  ++  LQ
Sbjct:    8 DDDLTIPRAAINKMIKETLP-NVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEHVIQALESLGFGSYISEVKEVLQ 92          
BLAST of nuclear factor Y subunit B vs. Ensembl Mouse
Match: Pole3 (polymerase (DNA directed), epsilon 3 (p17 subunit) [Source:MGI Symbol;Acc:MGI:1933378])

HSP 1 Score: 60.077 bits (144), Expect = 6.143e-11
Identity = 29/94 (30.85%), Postives = 50/94 (53.19%), Query Frame = 1
Query:  148 KDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANK 429
            + +D  LP   +++I+K+ LP    I+K+A+  +   AS F+ + +S A       KRKT+N  D+L A   + F  ++  L+  L+ YR   K
Sbjct:    4 RPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFITPLKEALEAYRREQK 97          
BLAST of nuclear factor Y subunit B vs. UniProt/SwissProt
Match: sp|P25210|NFYB_PETMA (Nuclear transcription factor Y subunit beta OS=Petromyzon marinus OX=7757 GN=NFYB PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 2.064e-40
Identity = 64/102 (62.75%), Postives = 80/102 (78.43%), Query Frame = 1
Query:  139 DCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
            D  ++QD +LPI NV++IMK  +P S KIAKDAK+CVQEC SEFISF++SEA+E C  +KRKTINGEDIL A + LGFD+YVE L+ +LQ YRE+ K E  I
Sbjct:   51 DPYREQDIYLPIANVARIMKTSIPSSGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKQYLQKYRESMKGEKGI 152          
BLAST of nuclear factor Y subunit B vs. UniProt/SwissProt
Match: sp|O23310|NFYB3_ARATH (Nuclear transcription factor Y subunit B-3 OS=Arabidopsis thaliana OX=3702 GN=NFYB3 PE=1 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 3.746e-39
Identity = 61/96 (63.54%), Postives = 78/96 (81.25%), Query Frame = 1
Query:  133 GNDCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYRE 420
            GN   ++QDRFLPI NVS+IMKK LP +AKI+KDAK+ VQEC SEFISF++ EA++ CQ +KRKTING+D+L A   LGF++YVE L+ +LQ YRE
Sbjct:   15 GNASTREQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQKYRE 110          
BLAST of nuclear factor Y subunit B vs. UniProt/SwissProt
Match: sp|P63140|NFYB_RAT (Nuclear transcription factor Y subunit beta OS=Rattus norvegicus OX=10116 GN=Nfyb PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.928e-38
Identity = 64/108 (59.26%), Postives = 84/108 (77.78%), Query Frame = 1
Query:  124 DIDGN-DCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
            D +G+ +  ++QD +LPI NV++IMK  +P + KIAKDAK+CVQEC SEFISF++SEA+E C  +KRKTINGEDIL A + LGFD+YVE L+ +LQ +REA K E  I
Sbjct:   44 DTNGSKESFREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGI 151          
BLAST of nuclear factor Y subunit B vs. UniProt/SwissProt
Match: sp|P63139|NFYB_MOUSE (Nuclear transcription factor Y subunit beta OS=Mus musculus OX=10090 GN=Nfyb PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.928e-38
Identity = 64/108 (59.26%), Postives = 84/108 (77.78%), Query Frame = 1
Query:  124 DIDGN-DCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
            D +G+ +  ++QD +LPI NV++IMK  +P + KIAKDAK+CVQEC SEFISF++SEA+E C  +KRKTINGEDIL A + LGFD+YVE L+ +LQ +REA K E  I
Sbjct:   44 DTNGSKESFREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGI 151          
BLAST of nuclear factor Y subunit B vs. UniProt/SwissProt
Match: sp|Q6RG77|NFYB_HORSE (Nuclear transcription factor Y subunit beta OS=Equus caballus OX=9796 GN=NFYB PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 2.035e-38
Identity = 64/108 (59.26%), Postives = 84/108 (77.78%), Query Frame = 1
Query:  124 DIDGN-DCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
            D +G+ +  ++QD +LPI NV++IMK  +P + KIAKDAK+CVQEC SEFISF++SEA+E C  +KRKTINGEDIL A + LGFD+YVE L+ +LQ +REA K E  I
Sbjct:   44 DTNGSKESFREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGI 151          
BLAST of nuclear factor Y subunit B vs. TrEMBL
Match: A0A172G7H7 (Nuclear factor-Y subunit B OS=Schmidtea mediterranea OX=79327 GN=NF-YB PE=2 SV=1)

HSP 1 Score: 383.259 bits (983), Expect = 4.268e-133
Identity = 211/211 (100.00%), Postives = 211/211 (100.00%), Query Frame = 1
Query:   64 MDDNMNTFLEPLCSASYKACDIDGNDCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDIIDLGNNNNAQGRPWSMAPVNSNSSSELNIKLNMPHLLSMXXXXXXXXXXXXXXXXXXXXXFQRAVLNHLKKSSTDEDSFNMDEA 696
            MDDNMNTFLEPLCSASYKACDIDGNDCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDIIDLGNNNNAQGRPWSMAPVNSNSSSELNIKLNMPHLLSMLPLTDLTSSNLNLENLLRDSDFQRAVLNHLKKSSTDEDSFNMDEA
Sbjct:    1 MDDNMNTFLEPLCSASYKACDIDGNDCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDIIDLGNNNNAQGRPWSMAPVNSNSSSELNIKLNMPHLLSMLPLTDLTSSNLNLENLLRDSDFQRAVLNHLKKSSTDEDSFNMDEA 211          
BLAST of nuclear factor Y subunit B vs. TrEMBL
Match: E2FB14 (Nuclear factor Y subunit B (Fragment) OS=Schmidtea mediterranea OX=79327 GN=NF-YB PE=2 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 1.832e-107
Identity = 179/179 (100.00%), Postives = 179/179 (100.00%), Query Frame = 1
Query:  160 RFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDIIDLGNNNNAQGRPWSMAPVNSNSSSELNIKLNMPHLLSMXXXXXXXXXXXXXXXXXXXXXFQRAVLNHLKKSSTDEDSFNMDEA 696
            RFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDIIDLGNNNNAQGRPWSMAPVNSNSSSELNIKLNMPHLLSMLPLTDLTSSNLNLENLLRDSDFQRAVLNHLKKSSTDEDSFNMDEA
Sbjct:    1 RFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDIIDLGNNNNAQGRPWSMAPVNSNSSSELNIKLNMPHLLSMLPLTDLTSSNLNLENLLRDSDFQRAVLNHLKKSSTDEDSFNMDEA 179          
BLAST of nuclear factor Y subunit B vs. TrEMBL
Match: A0A087W114 (Nuclear transcription factor Y subunit beta OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000204400 PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 8.491e-44
Identity = 73/115 (63.48%), Postives = 91/115 (79.13%), Query Frame = 1
Query:  106 ASYKACDIDGNDCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDIID 450
            A Y A DI+    L++QDRFLPI NVSKIMK+ +P + K+AKDAK+CVQEC SEFISF++SEAAE CQN+KRKTINGED+L A   LGF+NYVE L+ FL  YR+A K ++ II+
Sbjct:   32 ADYSAADIEQRSPLREQDRFLPIANVSKIMKRAIPSNGKVAKDAKECVQECVSEFISFITSEAAERCQNEKRKTINGEDLLWAMNALGFENYVEPLKTFLVKYRDAIKIDSSIIN 146          
BLAST of nuclear factor Y subunit B vs. TrEMBL
Match: A0A564Z2X0 (CBFD_NFYB_HMF domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS11698 PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 8.493e-44
Identity = 72/113 (63.72%), Postives = 90/113 (79.65%), Query Frame = 1
Query:  112 YKACDIDGNDCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDIID 450
            Y   D++    L++QDRFLPI NVSKIMKK +P   K+AKDAK+CVQEC SEFISF++SEAAE CQN+KRKTINGED+L A +NLGFDNYV+ L+ FL  YR+A K ++ II+
Sbjct:   34 YSTGDMEQRSPLREQDRFLPIANVSKIMKKAIPPQGKVAKDAKECVQECVSEFISFITSEAAERCQNEKRKTINGEDLLWAMSNLGFDNYVDPLKTFLLKYRDAIKIDSSIIN 146          
BLAST of nuclear factor Y subunit B vs. TrEMBL
Match: A0A068WQE2 (Nuclear transcription factor Y subunit beta OS=Echinococcus granulosus OX=6210 GN=EgrG_000204400 PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 8.630e-44
Identity = 73/115 (63.48%), Postives = 91/115 (79.13%), Query Frame = 1
Query:  106 ASYKACDIDGNDCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDIID 450
            A Y A DI+    L++QDRFLPI NVSKIMK+ +P + K+AKDAK+CVQEC SEFISF++SEAAE CQN+KRKTINGED+L A   LGF+NYVE L+ FL  YR+A K ++ II+
Sbjct:   32 ADYSAADIEQRSPLREQDRFLPIANVSKIMKRAIPSNGKVAKDAKECVQECVSEFISFITSEAAERCQNEKRKTINGEDLLWAMNALGFENYVEPLKTFLVKYRDAIKIDSSIIN 146          
BLAST of nuclear factor Y subunit B vs. Ensembl Cavefish
Match: nfyba (nuclear transcription factor Y subunit beta [Source:NCBI gene;Acc:103021655])

HSP 1 Score: 139.813 bits (351), Expect = 9.790e-41
Identity = 66/108 (61.11%), Postives = 83/108 (76.85%), Query Frame = 1
Query:  130 DGNDC---LKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
            DGN C   L++QD +LPI NV++IMK  +P + KIAKDAK+CVQEC SEFISF++SEA+E C  +KRKTINGEDIL A + LGFD YVE L+ +LQ +REA K E  +
Sbjct:   43 DGNGCKDNLREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDMYVEPLKLYLQKFREAMKGEKGV 150          
BLAST of nuclear factor Y subunit B vs. Ensembl Cavefish
Match: dr1 (down-regulator of transcription 1 [Source:ZFIN;Acc:ZDB-GENE-061013-797])

HSP 1 Score: 71.633 bits (174), Expect = 5.754e-15
Identity = 33/86 (38.37%), Postives = 57/86 (66.28%), Query Frame = 1
Query:  151 DQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQ 408
            D D  +P   ++K++K+ LP + ++A DA++ V  C +EFI  +SSEA EIC   ++KTI+ E ++ A  +LGF +Y+  +++ LQ
Sbjct:    8 DDDLTIPRAAINKMIKETLP-NVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEHVINALESLGFGSYIAEVKDVLQ 92          
BLAST of nuclear factor Y subunit B vs. Ensembl Cavefish
Match: pole3 (DNA polymerase epsilon 3, accessory subunit [Source:NCBI gene;Acc:103024896])

HSP 1 Score: 59.6918 bits (143), Expect = 6.922e-11
Identity = 26/94 (27.66%), Postives = 55/94 (58.51%), Query Frame = 1
Query:  148 KDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANK 429
            + +D  LP   +++I+K+ LP    ++K+A++ + + AS F+ + +S A       KRKT+N  D++ A   + F+ ++  L++ L+ Y++  K
Sbjct:    4 RPEDLNLPNAVITRIIKEALPDGVNVSKEARRAISQAASVFVLYATSCANSFAMKAKRKTLNAGDVMSAMEEMEFERFLPPLRDALEAYKKGQK 97          
BLAST of nuclear factor Y subunit B vs. Ensembl Sea Lamprey
Match: nfybb (Nuclear transcription factor Y subunit beta [Source:UniProtKB/Swiss-Prot;Acc:P25210])

HSP 1 Score: 141.354 bits (355), Expect = 4.700e-42
Identity = 64/102 (62.75%), Postives = 80/102 (78.43%), Query Frame = 1
Query:  139 DCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
            D  ++QD +LPI NV++IMK  +P S KIAKDAK+CVQEC SEFISF++SEA+E C  +KRKTINGEDIL A + LGFD+YVE L+ +LQ YRE+ K E  I
Sbjct:   51 DPYREQDIYLPIANVARIMKTSIPSSGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKQYLQKYRESMKGEKGI 152          
BLAST of nuclear factor Y subunit B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005397.1 (pep scaffold:Pmarinus_7.0:GL480146:24969:27649:-1 gene:ENSPMAG00000004898.1 transcript:ENSPMAT00000005397.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 1.621e-14
Identity = 32/86 (37.21%), Postives = 56/86 (65.12%), Query Frame = 1
Query:  151 DQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQ 408
            D D  +P   ++K++K+ LP + ++A DA++ V  C +EFI  +SSEA +IC   ++KTI+ E +++A  +LGF  Y+  ++  LQ
Sbjct:    8 DDDLTIPRAAINKLIKELLP-NVRVANDARELVVSCCTEFIHLISSEANDICNKSEKKTISPEHVIKALESLGFGAYIGEVKAVLQ 92          
BLAST of nuclear factor Y subunit B vs. Ensembl Yeast
Match: HAP3 (Subunit of the Hap2p/3p/4p/5p CCAAT-binding complex; complex is heme-activated and glucose-repressed; complex is a transcriptional activator and global regulator of respiratory gene expression; contains sequences contributing to both complex assembly and DNA binding [Source:SGD;Acc:S000000117])

HSP 1 Score: 127.487 bits (319), Expect = 1.158e-37
Identity = 57/101 (56.44%), Postives = 78/101 (77.23%), Query Frame = 1
Query:  145 LKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDII 447
            L++QDR+LPI NV+++MK  LP SAK++KDAK+C+QEC SE ISFV+SEA++ C  DKRKTINGEDIL +   LGF+NY E L+ +L  YR+    +N ++
Sbjct:   35 LREQDRWLPINNVARLMKNTLPPSAKVSKDAKECMQECVSELISFVTSEASDRCAADKRKTINGEDILISLHALGFENYAEVLKIYLAKYRQQQALKNQLM 135          
BLAST of nuclear factor Y subunit B vs. Ensembl Yeast
Match: NCB2 (Subunit of a heterodimeric NC2 transcription regulator complex; complex binds to TBP and can repress transcription by preventing preinitiation complex assembly or stimulate activated transcription; homologous to human NC2beta; complex also includes Bur6p [Source:SGD;Acc:S000002805])

HSP 1 Score: 50.0618 bits (118), Expect = 1.991e-8
Identity = 25/83 (30.12%), Postives = 49/83 (59.04%), Query Frame = 1
Query:  181 VSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANK 429
            +S+I+ +DL F+    KDA++ +     EFI  +SS A+E+  N+ +KTI  E +++A   L ++ ++  L+  L  ++ + K
Sbjct:   19 ISEILDQDLMFT----KDAREIIINSGIEFIMILSSMASEMADNEAKKTIAPEHVIKALEELEYNEFIPFLEEILLNFKGSQK 97          
BLAST of nuclear factor Y subunit B vs. Ensembl Nematostella
Match: EDO46868 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNJ1])

HSP 1 Score: 136.346 bits (342), Expect = 4.595e-41
Identity = 63/90 (70.00%), Postives = 74/90 (82.22%), Query Frame = 1
Query:  154 QDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREA 423
            QDRFLPI NV++IMKK +P + KIAKDAK+CVQEC SEFISF++SEA+E C  +KRKTINGEDIL A   LGFDNYVE L+ +LQ YRE 
Sbjct:    4 QDRFLPIANVARIMKKSIPKTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMQTLGFDNYVEPLKLYLQKYREV 93          
BLAST of nuclear factor Y subunit B vs. Ensembl Nematostella
Match: EDO43839 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXF9])

HSP 1 Score: 67.781 bits (164), Expect = 1.033e-13
Identity = 32/90 (35.56%), Postives = 57/90 (63.33%), Query Frame = 1
Query:  136 NDCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFL 405
             + L D D  LP   V+K++K+ +P + +++ DA++ +  C +EFI  +SSEA ++C    +KTI+ + IL A   LGF +Y+E +++ L
Sbjct:    4 REALADDDVTLPRAAVNKMIKEMIP-NMRVSNDARELILNCCTEFIHLISSEANDVCNRQMKKTISPDHILLALEGLGFQHYIEDVKSVL 92          
BLAST of nuclear factor Y subunit B vs. Ensembl Medaka
Match: nfyba (nuclear transcription factor Y subunit beta [Source:NCBI gene;Acc:101165365])

HSP 1 Score: 132.494 bits (332), Expect = 6.671e-38
Identity = 61/99 (61.62%), Postives = 78/99 (78.79%), Query Frame = 1
Query:  148 KDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
            ++QD +LPI NV++IMK  +P + KIAKDAK+CVQEC SEFISF++SEA+E C  +KRKTINGEDIL A + LGFD YV+ L+ +LQ +REA K E  I
Sbjct:   51 REQDIYLPIANVARIMKNAVPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDMYVDPLKLYLQKFREAMKGEKGI 149          
BLAST of nuclear factor Y subunit B vs. Ensembl Medaka
Match: nfyba (nuclear transcription factor Y subunit beta [Source:NCBI gene;Acc:101165365])

HSP 1 Score: 131.724 bits (330), Expect = 6.436e-37
Identity = 61/99 (61.62%), Postives = 78/99 (78.79%), Query Frame = 1
Query:  148 KDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
            ++QD +LPI NV++IMK  +P + KIAKDAK+CVQEC SEFISF++SEA+E C  +KRKTINGEDIL A + LGFD YV+ L+ +LQ +REA K E  I
Sbjct:   51 REQDIYLPIANVARIMKNAVPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDMYVDPLKLYLQKFREAMKGEKGI 149          
BLAST of nuclear factor Y subunit B vs. Ensembl Medaka
Match: dr1 (down-regulator of transcription 1 [Source:NCBI gene;Acc:101168111])

HSP 1 Score: 64.6994 bits (156), Expect = 1.778e-12
Identity = 32/86 (37.21%), Postives = 55/86 (63.95%), Query Frame = 1
Query:  151 DQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQ 408
            D D  +P   ++K++K+ LP + ++A DA++ V  C +EFI  +SSEA EIC    +KTI+ E ++    +LGF +Y+  +++ LQ
Sbjct:    8 DDDLTIPRAAINKMIKETLP-NVRVANDARELVVNCCTEFIHLISSEANEICNKSDKKTISPEHVIN-LESLGFGSYITEVKDVLQ 91          
BLAST of nuclear factor Y subunit B vs. Ensembl Medaka
Match: ENSORLT00000000708.2 (DNA polymerase epsilon 3, accessory subunit [Source:NCBI gene;Acc:101172142])

HSP 1 Score: 62.3882 bits (150), Expect = 6.113e-12
Identity = 29/99 (29.29%), Postives = 58/99 (58.59%), Query Frame = 1
Query:  148 KDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDI 444
            K +D  LP   +++I+K+ LP    ++K+A++ + + AS F+ + +S A       KRKT+N  D+L A   + F+ ++E L+  L+ Y++  K + ++
Sbjct:    4 KPEDLNLPNAVITRIIKEALPDGVNVSKEARRAISQAASVFVLYATSCANNFALKAKRKTLNAADVLAAMEEMEFERFLEPLRAALEVYKKGQKGKKEV 102          
BLAST of nuclear factor Y subunit B vs. Planmine SMEST
Match: SMESG000017262.1 (SMESG000017262.1)

HSP 1 Score: 383.259 bits (983), Expect = 1.187e-136
Identity = 211/211 (100.00%), Postives = 211/211 (100.00%), Query Frame = 1
Query:   64 MDDNMNTFLEPLCSASYKACDIDGNDCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDIIDLGNNNNAQGRPWSMAPVNSNSSSELNIKLNMPHLLSMXXXXXXXXXXXXXXXXXXXXXFQRAVLNHLKKSSTDEDSFNMDEA 696
            MDDNMNTFLEPLCSASYKACDIDGNDCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDIIDLGNNNNAQGRPWSMAPVNSNSSSELNIKLNMPHLLSMLPLTDLTSSNLNLENLLRDSDFQRAVLNHLKKSSTDEDSFNMDEA
Sbjct:    1 MDDNMNTFLEPLCSASYKACDIDGNDCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDIIDLGNNNNAQGRPWSMAPVNSNSSSELNIKLNMPHLLSMLPLTDLTSSNLNLENLLRDSDFQRAVLNHLKKSSTDEDSFNMDEA 211          
BLAST of nuclear factor Y subunit B vs. Planmine SMEST
Match: SMESG000017262.1 (SMESG000017262.1)

HSP 1 Score: 375.555 bits (963), Expect = 1.146e-133
Identity = 207/207 (100.00%), Postives = 207/207 (100.00%), Query Frame = 1
Query:   76 MNTFLEPLCSASYKACDIDGNDCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDIIDLGNNNNAQGRPWSMAPVNSNSSSELNIKLNMPHLLSMXXXXXXXXXXXXXXXXXXXXXFQRAVLNHLKKSSTDEDSFNMDEA 696
            MNTFLEPLCSASYKACDIDGNDCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDIIDLGNNNNAQGRPWSMAPVNSNSSSELNIKLNMPHLLSMLPLTDLTSSNLNLENLLRDSDFQRAVLNHLKKSSTDEDSFNMDEA
Sbjct:    1 MNTFLEPLCSASYKACDIDGNDCLKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDIIDLGNNNNAQGRPWSMAPVNSNSSSELNIKLNMPHLLSMLPLTDLTSSNLNLENLLRDSDFQRAVLNHLKKSSTDEDSFNMDEA 207          
BLAST of nuclear factor Y subunit B vs. Planmine SMEST
Match: SMESG000040141.1 (SMESG000040141.1)

HSP 1 Score: 144.05 bits (362), Expect = 2.909e-42
Identity = 67/102 (65.69%), Postives = 84/102 (82.35%), Query Frame = 1
Query:  145 LKDQDRFLPICNVSKIMKKDLPFSAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFANLGFDNYVETLQNFLQTYREANKFENDIID 450
            L++QDRFLPI NVSKIMKK +P + KI+K+AK+ VQEC SE+ISF++SEAAE CQ +KRKTINGED+L A ANLGF+  VE L+ FL  YREANK ++ I+D
Sbjct:   42 LREQDRFLPIANVSKIMKKAVPTNGKISKEAKEIVQECVSEYISFITSEAAEKCQQEKRKTINGEDLLWAMANLGFEQSVEPLRLFLTKYREANKLDSSIMD 143          
The following BLAST results are available for this feature:
BLAST of nuclear factor Y subunit B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NFYB4.283e-3959.26nuclear transcription factor Y subunit beta [Sourc... [more]
NFYB4.283e-3959.26nuclear transcription factor Y subunit beta [Sourc... [more]
NFYB4.548e-3959.26nuclear transcription factor Y subunit beta [Sourc... [more]
DR11.363e-1539.53down-regulator of transcription 1 [Source:HGNC Sym... [more]
DR11.363e-1539.53down-regulator of transcription 1 [Source:HGNC Sym... [more]
back to top
BLAST of nuclear factor Y subunit B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nfyb-14.289e-3458.42Nuclear transcription Factor Y, B (Beta) subunit ... [more]
nfyb-18.449e-2657.14Nuclear transcription Factor Y, B (Beta) subunit ... [more]
dro-11.011e-733.33DR1 (One) transcription factor family [Source:Uni... [more]
back to top
BLAST of nuclear factor Y subunit B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Nf-YB4.182e-4164.00gene:FBgn0032816 transcript:FBtr0343854[more]
Nf-YB4.182e-4164.00gene:FBgn0032816 transcript:FBtr0081289[more]
NC2beta1.697e-1335.16gene:FBgn0028926 transcript:FBtr0080695[more]
Chrac-146.119e-1034.09gene:FBgn0043002 transcript:FBtr0100268[more]
back to top
BLAST of nuclear factor Y subunit B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfybb5.420e-4062.04nuclear transcription factor Y, beta b [Source:ZFI... [more]
nfybb6.033e-4062.04nuclear transcription factor Y, beta b [Source:ZFI... [more]
nfybb6.103e-4062.04nuclear transcription factor Y, beta b [Source:ZFI... [more]
nfyba2.349e-3961.11nuclear transcription factor Y, beta a [Source:ZFI... [more]
nfyba2.349e-3961.11nuclear transcription factor Y, beta a [Source:ZFI... [more]
back to top
BLAST of nuclear factor Y subunit B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cdk5r19.860e-3960.78cyclin-dependent kinase 5, regulatory subunit 1 (p... [more]
cdk5r11.743e-3860.78cyclin-dependent kinase 5, regulatory subunit 1 (p... [more]
rad178.895e-1639.53RAD17 checkpoint clamp loader component [Source:Xe... [more]
pole31.075e-1031.91polymerase (DNA directed), epsilon 3, accessory su... [more]
back to top
BLAST of nuclear factor Y subunit B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Nfyb2.756e-3959.26nuclear transcription factor-Y beta [Source:MGI Sy... [more]
Nfyb7.481e-1961.82nuclear transcription factor-Y beta [Source:MGI Sy... [more]
Dr19.360e-1639.53down-regulator of transcription 1 [Source:MGI Symb... [more]
Pole36.143e-1130.85polymerase (DNA directed), epsilon 3 (p17 subunit)... [more]
back to top
BLAST of nuclear factor Y subunit B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P25210|NFYB_PETMA2.064e-4062.75Nuclear transcription factor Y subunit beta OS=Pet... [more]
sp|O23310|NFYB3_ARATH3.746e-3963.54Nuclear transcription factor Y subunit B-3 OS=Arab... [more]
sp|P63140|NFYB_RAT1.928e-3859.26Nuclear transcription factor Y subunit beta OS=Rat... [more]
sp|P63139|NFYB_MOUSE1.928e-3859.26Nuclear transcription factor Y subunit beta OS=Mus... [more]
sp|Q6RG77|NFYB_HORSE2.035e-3859.26Nuclear transcription factor Y subunit beta OS=Equ... [more]
back to top
BLAST of nuclear factor Y subunit B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A172G7H74.268e-133100.00Nuclear factor-Y subunit B OS=Schmidtea mediterran... [more]
E2FB141.832e-107100.00Nuclear factor Y subunit B (Fragment) OS=Schmidtea... [more]
A0A087W1148.491e-4463.48Nuclear transcription factor Y subunit beta OS=Ech... [more]
A0A564Z2X08.493e-4463.72CBFD_NFYB_HMF domain-containing protein OS=Hymenol... [more]
A0A068WQE28.630e-4463.48Nuclear transcription factor Y subunit beta OS=Ech... [more]
back to top
BLAST of nuclear factor Y subunit B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nfyba9.790e-4161.11nuclear transcription factor Y subunit beta [Sourc... [more]
dr15.754e-1538.37down-regulator of transcription 1 [Source:ZFIN;Acc... [more]
pole36.922e-1127.66DNA polymerase epsilon 3, accessory subunit [Sourc... [more]
back to top
BLAST of nuclear factor Y subunit B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nfybb4.700e-4262.75Nuclear transcription factor Y subunit beta [Sour... [more]
ENSPMAT00000005397.11.621e-1437.21pep scaffold:Pmarinus_7.0:GL480146:24969:27649:-1 ... [more]
back to top
BLAST of nuclear factor Y subunit B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
HAP31.158e-3756.44Subunit of the Hap2p/3p/4p/5p CCAAT-binding comple... [more]
NCB21.991e-830.12Subunit of a heterodimeric NC2 transcription regul... [more]
back to top
BLAST of nuclear factor Y subunit B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO468684.595e-4170.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438391.033e-1335.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of nuclear factor Y subunit B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nfyba6.671e-3861.62nuclear transcription factor Y subunit beta [Sourc... [more]
nfyba6.436e-3761.62nuclear transcription factor Y subunit beta [Sourc... [more]
dr11.778e-1237.21down-regulator of transcription 1 [Source:NCBI gen... [more]
ENSORLT00000000708.26.113e-1229.29DNA polymerase epsilon 3, accessory subunit [Sourc... [more]
back to top
BLAST of nuclear factor Y subunit B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000017262.11.187e-136100.00SMESG000017262.1[more]
SMESG000017262.11.146e-133100.00SMESG000017262.1[more]
SMESG000040141.12.909e-4265.69SMESG000040141.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30003873
GenBankADG08186.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003873 ID=SMED30003873|Name=nuclear factor Y subunit B|organism=Schmidtea mediterranea sexual|type=transcript|length=753bp
ATTAATTTGATTTTATTTAAATTTGAAATATTGAATTTAATTAACGATCG
TTAATTTAAAAAAATGGACGATAACATGAATACTTTTCTTGAGCCTCTTT
GTTCAGCTTCATACAAAGCTTGCGATATAGATGGAAATGATTGTTTGAAA
GATCAGGACAGATTCCTGCCGATTTGCAACGTTTCGAAAATAATGAAAAA
GGATCTTCCGTTCAGTGCAAAGATAGCCAAGGATGCTAAACAGTGCGTTC
AAGAATGCGCATCGGAATTCATCAGCTTTGTGAGCAGCGAAGCAGCAGAA
ATCTGTCAAAATGACAAAAGGAAAACAATTAATGGAGAAGATATTTTGCA
AGCTTTTGCCAATTTGGGATTTGATAATTACGTGGAGACCTTGCAGAACT
TTTTGCAAACTTATAGAGAGGCAAATAAATTTGAAAATGATATCATTGAC
CTGGGCAACAATAATAATGCGCAAGGCAGGCCTTGGTCAATGGCGCCAGT
AAACTCAAACTCGTCATCAGAACTGAATATCAAACTGAACATGCCTCATC
TGCTTTCCATGCTCCCGTTGACCGACCTCACCTCGAGCAATCTGAATTTG
GAAAATCTTCTTCGTGATTCAGATTTCCAAAGAGCAGTTTTGAATCACTT
GAAGAAATCATCAACCGATGAAGACTCCTTTAATATGGATGAAGCATTAT
AATTATTATTTTTATTGTTCAAATTATATATTTTTTGGATTCTTAAAAAA
AAA
back to top

protein sequence of SMED30003873-orf-1

>SMED30003873-orf-1 ID=SMED30003873-orf-1|Name=SMED30003873-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=213bp
MDDNMNTFLEPLCSASYKACDIDGNDCLKDQDRFLPICNVSKIMKKDLPF
SAKIAKDAKQCVQECASEFISFVSSEAAEICQNDKRKTINGEDILQAFAN
LGFDNYVETLQNFLQTYREANKFENDIIDLGNNNNAQGRPWSMAPVNSNS
SSELNIKLNMPHLLSMLPLTDLTSSNLNLENLLRDSDFQRAVLNHLKKSS
TDEDSFNMDEAL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000208testis
PLANA:0000220spermatogonium
PLANA:0000221spermatocyte
PLANA:0000222spermatid
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR003958CBFA_NFYB_domain
IPR009072Histone-fold
Vocabulary: molecular function
TermDefinition
GO:0046982protein heterodimerization activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00615CCAATSUBUNTAcoord: 100..118
score: 31.58
coord: 81..99
score: 41.51
coord: 62..80
score: 48.56
NoneNo IPR availablePANTHERPTHR11064CCAAT-BINDING TRANSCRIPTION FACTOR-RELATEDcoord: 28..137
NoneNo IPR availablePANTHERPTHR11064:SF9NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETAcoord: 28..137
IPR009072Histone-foldGENE3DG3DSA:1.10.20.10coord: 24..152
e-value: 1.7E-40
score: 140.1
IPR009072Histone-foldSUPERFAMILYSSF47113Histone-foldcoord: 31..128
IPR003958Transcription factor CBF/NF-Y/archaeal histone domainPFAMPF00808CBFD_NFYB_HMFcoord: 34..97
e-value: 4.4E-26
score: 90.9